BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007P14

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092558.1|  PREDICTED: 40S ribosomal protein S16-like          289   2e-96   Sesamum indicum [beniseed]
ref|XP_009792138.1|  PREDICTED: 40S ribosomal protein S16-like          288   8e-96   Nicotiana sylvestris
ref|XP_011089620.1|  PREDICTED: 40S ribosomal protein S16               286   3e-95   Sesamum indicum [beniseed]
emb|CDO97194.1|  unnamed protein product                                286   4e-95   Coffea canephora [robusta coffee]
ref|XP_009612267.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    285   1e-94   Nicotiana tomentosiformis
ref|XP_010105611.1|  40S ribosomal protein S16                          284   2e-94   Morus notabilis
gb|EPS67947.1|  hypothetical protein M569_06824                         284   2e-94   Genlisea aurea
ref|XP_004229156.1|  PREDICTED: 40S ribosomal protein S16-like          284   3e-94   Solanum lycopersicum
gb|KDP42492.1|  hypothetical protein JCGZ_00289                         283   3e-94   Jatropha curcas
ref|XP_004237264.1|  PREDICTED: 40S ribosomal protein S16               283   4e-94   Solanum lycopersicum
ref|XP_009602130.1|  PREDICTED: 40S ribosomal protein S16-like          283   4e-94   Nicotiana tomentosiformis
ref|XP_009612269.1|  PREDICTED: 40S ribosomal protein S16               283   7e-94   Nicotiana tomentosiformis
ref|XP_009623909.1|  PREDICTED: 40S ribosomal protein S16-like          282   1e-93   Nicotiana tomentosiformis
gb|EPS63821.1|  hypothetical protein M569_10962                         282   1e-93   Genlisea aurea
ref|XP_004238675.1|  PREDICTED: 40S ribosomal protein S16               281   3e-93   Solanum lycopersicum
ref|XP_010066008.1|  PREDICTED: 40S ribosomal protein S16               280   5e-93   Eucalyptus grandis [rose gum]
ref|XP_007034683.1|  Ribosomal protein S5 domain 2-like superfami...    280   6e-93   Theobroma cacao [chocolate]
ref|XP_002281350.1|  PREDICTED: 40S ribosomal protein S16               280   1e-92   Vitis vinifera
gb|ADR71284.1|  40S ribosomal protein S16B                              280   1e-92   Hevea brasiliensis [jebe]
ref|XP_002300225.1|  ribosomal protein S16                              280   1e-92   
gb|ADR71283.1|  40S ribosomal protein S16A                              279   1e-92   Hevea brasiliensis [jebe]
ref|XP_002285101.1|  PREDICTED: 40S ribosomal protein S16               279   1e-92   Vitis vinifera
gb|EPS69719.1|  hypothetical protein M569_05046                         279   2e-92   Genlisea aurea
ref|XP_006422982.1|  hypothetical protein CICLE_v10029508mg             279   3e-92   Citrus clementina [clementine]
ref|XP_004136973.1|  PREDICTED: 40S ribosomal protein S16-like          278   3e-92   Cucumis sativus [cucumbers]
gb|AAF34799.1|AF227979_1  40S ribosomal protein S16                     278   3e-92   Euphorbia esula [wolf's milk]
ref|XP_007201870.1|  hypothetical protein PRUPE_ppa012998mg             278   3e-92   Prunus persica
gb|AEW43294.1|  putative ribosomal protein S9                           278   4e-92   Hevea brasiliensis [jebe]
ref|XP_010916936.1|  PREDICTED: 40S ribosomal protein S16-like          278   4e-92   Elaeis guineensis
gb|ABK20993.1|  unknown                                                 278   5e-92   Picea sitchensis
ref|XP_010551554.1|  PREDICTED: 40S ribosomal protein S16-1-like        277   9e-92   Tarenaya hassleriana [spider flower]
gb|ADR71285.1|  40S ribosomal protein S16C                              277   1e-91   Hevea brasiliensis [jebe]
ref|XP_010255966.1|  PREDICTED: 40S ribosomal protein S16-like          277   1e-91   Nelumbo nucifera [Indian lotus]
ref|XP_008236476.1|  PREDICTED: 40S ribosomal protein S16-like          277   1e-91   Prunus mume [ume]
ref|XP_010524961.1|  PREDICTED: 40S ribosomal protein S16-1-like        277   1e-91   Tarenaya hassleriana [spider flower]
ref|XP_007226006.1|  hypothetical protein PRUPE_ppa012996mg             277   1e-91   Prunus persica
ref|XP_010528603.1|  PREDICTED: 40S ribosomal protein S16-1-like        276   2e-91   Tarenaya hassleriana [spider flower]
ref|XP_010549634.1|  PREDICTED: 40S ribosomal protein S16-1             276   3e-91   Tarenaya hassleriana [spider flower]
ref|XP_002312518.1|  40S ribosomal protein S16                          276   3e-91   Populus trichocarpa [western balsam poplar]
ref|XP_008383171.1|  PREDICTED: 40S ribosomal protein S16               276   3e-91   Malus domestica [apple tree]
ref|XP_006419873.1|  hypothetical protein CICLE_v10006162mg             275   6e-91   Citrus clementina [clementine]
gb|ABK23888.1|  unknown                                                 275   7e-91   Picea sitchensis
ref|XP_002518738.1|  ribosomal protein S9, putative                     275   7e-91   
ref|XP_008375886.1|  PREDICTED: 40S ribosomal protein S16-like          278   8e-91   
ref|XP_004296911.1|  PREDICTED: 40S ribosomal protein S16               275   8e-91   Fragaria vesca subsp. vesca
gb|KJB12247.1|  hypothetical protein B456_002G008400                    275   9e-91   Gossypium raimondii
ref|XP_009804322.1|  PREDICTED: 40S ribosomal protein S16-like          275   9e-91   Nicotiana sylvestris
ref|XP_002314714.1|  40S ribosomal protein S16                          274   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010558732.1|  PREDICTED: 40S ribosomal protein S16-1-like        274   1e-90   Tarenaya hassleriana [spider flower]
ref|XP_008390856.1|  PREDICTED: 40S ribosomal protein S16-like          274   1e-90   Malus domestica [apple tree]
ref|XP_008373839.1|  PREDICTED: 40S ribosomal protein S16-like          274   1e-90   Malus domestica [apple tree]
gb|KHG18721.1|  40S ribosomal S16                                       274   1e-90   Gossypium arboreum [tree cotton]
ref|XP_006400383.1|  hypothetical protein EUTSA_v10014948mg             274   2e-90   Eutrema salsugineum [saltwater cress]
ref|XP_007160464.1|  hypothetical protein PHAVU_002G324300g             274   2e-90   Phaseolus vulgaris [French bean]
ref|XP_010926242.1|  PREDICTED: 40S ribosomal protein S16-like          273   3e-90   Elaeis guineensis
ref|XP_010263487.1|  PREDICTED: 40S ribosomal protein S16-like          273   3e-90   Nelumbo nucifera [Indian lotus]
gb|KJB79354.1|  hypothetical protein B456_013G045400                    273   3e-90   Gossypium raimondii
ref|XP_008780865.1|  PREDICTED: 40S ribosomal protein S16-like          273   3e-90   Phoenix dactylifera
ref|XP_010277830.1|  PREDICTED: 40S ribosomal protein S16-like          273   5e-90   Nelumbo nucifera [Indian lotus]
ref|XP_004290594.1|  PREDICTED: 40S ribosomal protein S16-like          273   6e-90   Fragaria vesca subsp. vesca
ref|XP_010420587.1|  PREDICTED: 40S ribosomal protein S16-3-like        272   8e-90   Camelina sativa [gold-of-pleasure]
ref|XP_010270291.1|  PREDICTED: 40S ribosomal protein S16               272   9e-90   Nelumbo nucifera [Indian lotus]
gb|KJB31216.1|  hypothetical protein B456_005G236900                    272   9e-90   Gossypium raimondii
ref|XP_010449924.1|  PREDICTED: 40S ribosomal protein S16-3             272   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_007042464.1|  Ribosomal protein S5 domain 2-like superfami...    272   1e-89   
ref|XP_006284710.1|  hypothetical protein CARUB_v10005968mg             271   2e-89   Capsella rubella
ref|XP_003530932.1|  PREDICTED: 40S ribosomal protein S16-like          271   2e-89   Glycine max [soybeans]
sp|P46293.1|RS16_GOSHI  RecName: Full=40S ribosomal protein S16         271   3e-89   Gossypium hirsutum [American cotton]
ref|XP_008795884.1|  PREDICTED: 40S ribosomal protein S16               270   3e-89   Phoenix dactylifera
ref|NP_001235533.1|  uncharacterized protein LOC100527911               271   4e-89   Glycine max [soybeans]
ref|XP_004489248.1|  PREDICTED: 40S ribosomal protein S16-like is...    270   4e-89   Cicer arietinum [garbanzo]
ref|XP_004489247.1|  PREDICTED: 40S ribosomal protein S16-like is...    271   4e-89   
ref|XP_002527855.1|  ribosomal protein S9, putative                     270   5e-89   Ricinus communis
ref|XP_003631001.1|  40S ribosomal protein S16                          270   5e-89   Medicago truncatula
ref|XP_004503325.1|  PREDICTED: 40S ribosomal protein S16-like          270   5e-89   Cicer arietinum [garbanzo]
ref|XP_006408213.1|  hypothetical protein EUTSA_v10021712mg             270   6e-89   Eutrema salsugineum [saltwater cress]
ref|XP_010928344.1|  PREDICTED: 40S ribosomal protein S16               270   6e-89   Elaeis guineensis
ref|XP_001755340.1|  predicted protein                                  270   8e-89   
sp|O22647.1|RS16_FRIAG  RecName: Full=40S ribosomal protein S16         270   8e-89   Fritillaria agrestis
ref|XP_008788842.1|  PREDICTED: 40S ribosomal protein S16-like          269   1e-88   Phoenix dactylifera
ref|XP_003518703.1|  PREDICTED: 40S ribosomal protein S16-like          270   1e-88   Glycine max [soybeans]
ref|XP_003616020.1|  40S ribosomal protein S16                          269   1e-88   Medicago truncatula
gb|KFK37850.1|  hypothetical protein AALP_AA3G037300                    269   2e-88   Arabis alpina [alpine rockcress]
gb|ACJ86025.1|  unknown                                                 268   2e-88   Medicago truncatula
ref|XP_009409231.1|  PREDICTED: 40S ribosomal protein S16-like          268   2e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006840429.1|  hypothetical protein AMTR_s00045p00161540          269   2e-88   
ref|XP_002873890.1|  40S ribosomal protein S16                          268   2e-88   
ref|XP_007153584.1|  hypothetical protein PHAVU_003G047800g             268   2e-88   Phaseolus vulgaris [French bean]
gb|KHN21629.1|  40S ribosomal protein S16                               269   3e-88   Glycine soja [wild soybean]
gb|AFK46930.1|  unknown                                                 268   3e-88   Medicago truncatula
ref|XP_001775963.1|  predicted protein                                  268   3e-88   
ref|XP_001777696.1|  predicted protein                                  268   6e-88   
ref|XP_009390916.1|  PREDICTED: 40S ribosomal protein S16-like          267   8e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505244.1|  PREDICTED: 40S ribosomal protein S16-like          267   1e-87   
gb|ACJ85555.1|  unknown                                                 266   1e-87   Medicago truncatula
gb|KFK26075.1|  hypothetical protein AALP_AA8G199800                    267   1e-87   Arabis alpina [alpine rockcress]
ref|XP_001780940.1|  predicted protein                                  266   1e-87   
ref|XP_003607926.1|  40S ribosomal protein S16-1                        266   1e-87   Medicago truncatula
ref|XP_006298754.1|  hypothetical protein CARUB_v10014854mg             266   2e-87   Capsella rubella
ref|NP_178826.1|  40S ribosomal protein S16-1                           266   2e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413003.1|  PREDICTED: 40S ribosomal protein S16-1-like ...    266   2e-87   
ref|XP_006856488.1|  hypothetical protein AMTR_s00046p00076360          266   3e-87   Amborella trichopoda
ref|NP_197339.1|  40S ribosomal protein S16-3                           266   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010694150.1|  PREDICTED: 40S ribosomal protein S16-like          265   5e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|ABW89384.1|  40S ribosomal protein S16                               265   5e-87   Helianthus annuus
emb|CDY29988.1|  BnaC01g40200D                                          265   5e-87   Brassica napus [oilseed rape]
gb|AFK36270.1|  unknown                                                 264   1e-86   Lotus japonicus
gb|ACJ85531.1|  unknown                                                 263   4e-86   Medicago truncatula
emb|CDY21134.1|  BnaA01g33650D                                          263   5e-86   Brassica napus [oilseed rape]
ref|XP_010689120.1|  PREDICTED: 40S ribosomal protein S16-like          263   5e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010695861.1|  PREDICTED: 40S ribosomal protein S16               263   5e-86   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX92061.1|  BnaC03g33630D                                          262   7e-86   
ref|XP_009393541.1|  PREDICTED: 40S ribosomal protein S16-like          262   7e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125004.1|  PREDICTED: 40S ribosomal protein S16-3             262   8e-86   Brassica rapa
emb|CDY49352.1|  BnaA05g33140D                                          262   8e-86   Brassica napus [oilseed rape]
ref|XP_009390299.1|  PREDICTED: 40S ribosomal protein S16               261   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404058.1|  PREDICTED: 40S ribosomal protein S16-like is...    261   3e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009131657.1|  PREDICTED: 40S ribosomal protein S16-3-like ...    260   3e-85   Brassica rapa
ref|XP_009124006.1|  PREDICTED: 40S ribosomal protein S16-3-like        260   5e-85   Brassica rapa
ref|XP_002884433.1|  40S ribosomal protein S16                          260   6e-85   Arabidopsis lyrata subsp. lyrata
emb|CDY25423.1|  BnaC09g39380D                                          259   7e-85   Brassica napus [oilseed rape]
ref|XP_009134755.1|  PREDICTED: 40S ribosomal protein S16-3-like        259   1e-84   Brassica rapa
emb|CDY70652.1|  BnaA03g57330D                                          258   2e-84   Brassica napus [oilseed rape]
ref|XP_009120979.1|  PREDICTED: 40S ribosomal protein S16-3-like        258   2e-84   Brassica rapa
sp|Q9XEK7.1|RS16_TORRU  RecName: Full=40S ribosomal protein S16         256   1e-83   Syntrichia ruralis
ref|XP_002994222.1|  hypothetical protein SELMODRAFT_138369             256   1e-83   Selaginella moellendorffii
gb|ABW89401.1|  40S ribosomal protein S16                               252   3e-82   Helianthus annuus
ref|NP_187073.1|  40S ribosomal protein S16-2                           252   8e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107873.1|  PREDICTED: 40S ribosomal protein S16-3-like        248   6e-80   Brassica rapa
emb|CDY24915.1|  BnaC03g22570D                                          247   8e-80   Brassica napus [oilseed rape]
ref|NP_001065632.1|  Os11g0127900                                       245   6e-79   
gb|AAR87752.1|  small subunit ribosomal protein S16                     241   5e-78   Capsicum annuum
ref|XP_006662696.1|  PREDICTED: 40S ribosomal protein S16-like          241   8e-78   
ref|XP_010252415.1|  PREDICTED: 40S ribosomal protein S16-like          240   4e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009404059.1|  PREDICTED: 40S ribosomal protein S16-like is...    239   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA33916.1|  ribosomal protein S16                                   239   6e-77   Oryza sativa Indica Group [Indian rice]
gb|EXX61063.1|  ribosomal 40S subunit protein S16A                      238   2e-76   Rhizophagus irregularis DAOM 197198w
ref|XP_002500989.1|  predicted protein                                  238   2e-76   Micromonas commoda
ref|NP_001134097.1|  40S ribosomal protein S16                          238   4e-76   Salmo salar
gb|AFK11567.1|  Rps16 protein                                           238   4e-76   Callorhinchus milii [Australian ghost shark]
ref|XP_007232866.1|  PREDICTED: 40S ribosomal protein S16-like is...    237   5e-76   
ref|XP_003056886.1|  predicted protein                                  237   5e-76   Micromonas pusilla CCMP1545
ref|XP_010885525.1|  PREDICTED: 40S ribosomal protein S16               237   6e-76   Esox lucius
ref|XP_007010573.1|  Ribosomal protein S5 domain 2-like superfami...    237   6e-76   
gb|KFO64775.1|  40S ribosomal protein S16                               237   9e-76   Corvus brachyrhynchos
ref|XP_003221173.1|  PREDICTED: 40S ribosomal protein S16               236   9e-76   Anolis carolinensis [Carolina anole]
gb|ACR24967.1|  ribosomal protein S16                                   236   1e-75   Lepidochitona cinerea
gb|ACM08724.1|  40S ribosomal protein S16                               236   1e-75   Salmo salar
ref|XP_003915560.1|  PREDICTED: 40S ribosomal protein S16               236   1e-75   Papio anubis [baboon]
ref|XP_006064132.1|  PREDICTED: 40S ribosomal protein S16-like          236   2e-75   
gb|ACG26490.1|  40S ribosomal protein S16                               236   2e-75   Zea mays [maize]
gb|AAX29081.1|  ribosomal protein S16                                   236   2e-75   synthetic construct
ref|XP_008608456.1|  40S ribosomal protein S16                          236   2e-75   Saprolegnia diclina VS20
ref|XP_002441754.1|  hypothetical protein SORBIDRAFT_08g001870          236   2e-75   Sorghum bicolor [broomcorn]
ref|NP_001011.1|  40S ribosomal protein S16                             236   2e-75   Homo sapiens [man]
ref|XP_008893682.1|  40S ribosomal protein S16                          236   2e-75   Phytophthora parasitica INRA-310
gb|AAH82286.1|  Rps16 protein                                           236   3e-75   Mus musculus [mouse]
gb|AAI59439.1|  Rps16 protein                                           236   3e-75   Rattus norvegicus [brown rat]
ref|XP_004670475.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    235   3e-75   Jaculus jaculus
gb|AAH64030.1|  Rps16 protein                                           236   3e-75   Rattus norvegicus [brown rat]
gb|AAH84715.1|  Rps16 protein                                           236   3e-75   Rattus norvegicus [brown rat]
ref|NP_001232350.1|  putative ribosomal protein S16                     235   3e-75   Taeniopygia guttata
sp|Q90YQ7.1|RS16_ICTPU  RecName: Full=40S ribosomal protein S16         235   3e-75   Ictalurus punctatus
dbj|BAF45905.1|  ribosomal protein S16                                  235   3e-75   Solea senegalensis
gb|KFV62939.1|  40S ribosomal protein S16                               235   3e-75   Picoides pubescens
gb|ACO09841.1|  40S ribosomal protein S16                               235   3e-75   Osmerus mordax
gb|KHN16514.1|  40S ribosomal protein S16                               234   3e-75   Glycine soja [wild soybean]
ref|XP_003452097.1|  PREDICTED: 40S ribosomal protein S16-like is...    235   3e-75   Oreochromis niloticus
ref|XP_004083248.1|  PREDICTED: 40S ribosomal protein S16               235   3e-75   Oryzias latipes [Japanese rice fish]
dbj|BAK02478.1|  predicted protein                                      235   3e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004714191.1|  PREDICTED: 40S ribosomal protein S16-like is...    235   3e-75   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009531521.1|  hypothetical protein PHYSODRAFT_355047             235   3e-75   Phytophthora sojae
ref|XP_002450189.1|  hypothetical protein SORBIDRAFT_05g001680          235   4e-75   Sorghum bicolor [broomcorn]
ref|NP_001187219.1|  40S ribosomal protein S16                          235   4e-75   Ictalurus punctatus
gb|EMT04029.1|  40S ribosomal protein S16                               235   4e-75   
ref|XP_008398658.1|  PREDICTED: 40S ribosomal protein S16               235   4e-75   Poecilia reticulata
gb|AAH90618.1|  Rps16 protein                                           236   4e-75   Mus musculus [mouse]
ref|XP_008313605.1|  PREDICTED: 40S ribosomal protein S16               235   4e-75   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AFM90848.1|  40S ribosomal protein S16-like protein                  235   5e-75   Callorhinchus milii [Australian ghost shark]
ref|NP_001278474.1|  40S ribosomal protein S16                          234   5e-75   Zea mays [maize]
ref|XP_002899087.1|  40S ribosomal protein S16                          235   5e-75   Phytophthora infestans T30-4
gb|ETL91183.1|  40S ribosomal protein S16                               235   6e-75   Phytophthora parasitica
gb|ACM08397.1|  40S ribosomal protein S16                               234   6e-75   Salmo salar
gb|KFQ38885.1|  40S ribosomal protein S16                               235   6e-75   Mesitornis unicolor
ref|XP_006633603.1|  PREDICTED: 40S ribosomal protein S16-like          234   7e-75   Lepisosteus oculatus
ref|XP_004548484.1|  PREDICTED: 40S ribosomal protein S16-like          234   7e-75   Maylandia zebra
ref|NP_001011146.1|  ribosomal protein S16                              234   7e-75   Xenopus tropicalis [western clawed frog]
ref|XP_010379207.1|  PREDICTED: 40S ribosomal protein S16               234   8e-75   Rhinopithecus roxellana
gb|ACM09220.1|  40S ribosomal protein S16                               234   9e-75   Salmo salar
sp|Q98TR7.1|RS16_HETFO  RecName: Full=40S ribosomal protein S16         234   1e-74   Heteropneustes fossilis
gb|ACO51844.1|  40S ribosomal protein S16                               234   1e-74   Rana catesbeiana [bullfrog]
gb|EDL15855.1|  mCG3370                                                 234   1e-74   Mus musculus [mouse]
dbj|BAK02829.1|  predicted protein                                      234   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006677977.1|  hypothetical protein BATDEDRAFT_33120              234   1e-74   Batrachochytrium dendrobatidis JAM81
ref|XP_004341583.1|  ribosomal protein S9, putative                     234   1e-74   Acanthamoeba castellanii str. Neff
dbj|BAJ85048.1|  predicted protein                                      234   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEF98090.1|  Ribosomal protein S9, conserved site                   233   1e-74   Ostreococcus tauri
ref|XP_007555348.1|  PREDICTED: 40S ribosomal protein S16               233   1e-74   Poecilia formosa
ref|NP_001078601.1|  40S ribosomal protein S16-3                        233   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003688797.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    234   2e-74   Mus musculus [mouse]
ref|NP_001279691.1|  ribosomal protein S16                              233   2e-74   Callorhinchus milii [Australian ghost shark]
ref|XP_006178002.1|  PREDICTED: 40S ribosomal protein S16               233   2e-74   
gb|ACD65104.1|  putative 40S ribosomal protein RPS16                    233   2e-74   Novocrania anomala
gb|AFR11277.1|  ribosomal protein S16                                   233   2e-74   Zea mays [maize]
gb|ACO08300.1|  40S ribosomal protein S16                               233   2e-74   Oncorhynchus mykiss
ref|XP_005995898.1|  PREDICTED: 40S ribosomal protein S16-like is...    235   2e-74   
ref|XP_005868880.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    236   2e-74   
ref|XP_003420822.1|  PREDICTED: 40S ribosomal protein S16               233   2e-74   Loxodonta africana [African bush elephant]
ref|XP_004978481.1|  PREDICTED: 40S ribosomal protein S16-like          233   2e-74   Setaria italica
ref|XP_004977429.1|  PREDICTED: 40S ribosomal protein S16-like          233   2e-74   Setaria italica
gb|EPB82886.1|  40S ribosomal protein                                   233   3e-74   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009039660.1|  hypothetical protein AURANDRAFT_30567              233   3e-74   Aureococcus anophagefferens
ref|XP_001417833.1|  Ribosomal protein S16, component of cytosoli...    232   3e-74   Ostreococcus lucimarinus CCE9901
ref|XP_003577865.1|  PREDICTED: 40S ribosomal protein S16               233   3e-74   Brachypodium distachyon [annual false brome]
ref|XP_006021181.1|  PREDICTED: 40S ribosomal protein S16-like          234   3e-74   
ref|XP_005362618.1|  PREDICTED: 40S ribosomal protein S16-like          233   3e-74   
ref|XP_006772017.1|  PREDICTED: 40S ribosomal protein S16               232   4e-74   
gb|AFM86674.1|  40S ribosomal protein S16-like protein                  232   5e-74   Callorhinchus milii [Australian ghost shark]
ref|XP_005908688.1|  PREDICTED: 40S ribosomal protein S16-like is...    232   5e-74   Bos mutus
ref|XP_005646504.1|  40S ribosomal protein S16                          232   5e-74   Coccomyxa subellipsoidea C-169
ref|XP_011450742.1|  PREDICTED: 40S ribosomal protein S16               232   6e-74   Crassostrea gigas
gb|AFM90796.1|  40S ribosomal protein S16-like protein                  232   6e-74   Callorhinchus milii [Australian ghost shark]
ref|XP_004060764.1|  PREDICTED: 40S ribosomal protein S16               232   6e-74   
ref|XP_005109349.1|  PREDICTED: 40S ribosomal protein S16               232   6e-74   Aplysia californica
ref|XP_004647957.1|  PREDICTED: 40S ribosomal protein S16-like is...    232   6e-74   Octodon degus
gb|AFM86626.1|  40S ribosomal protein S16-like protein                  232   7e-74   Callorhinchus milii [Australian ghost shark]
gb|AFM87781.1|  40S ribosomal protein S16-like protein                  231   8e-74   Callorhinchus milii [Australian ghost shark]
ref|XP_004605794.1|  PREDICTED: 40S ribosomal protein S16-like          233   8e-74   
ref|XP_005572789.1|  PREDICTED: 40S ribosomal protein S16-like          231   1e-73   
emb|CCI50246.1|  unnamed protein product                                231   1e-73   Albugo candida
ref|XP_005616647.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    231   1e-73   
gb|ELU16265.1|  hypothetical protein CAPTEDRAFT_153161                  231   1e-73   Capitella teleta
sp|P16149.1|RS16_LUPPO  RecName: Full=40S ribosomal protein S16         231   2e-73   Lupinus polyphyllus
emb|CCA24817.1|  40S ribosomal protein S16 putative                     231   2e-73   Albugo laibachii Nc14
gb|AAY66897.1|  ribosomal protein S16                                   231   2e-73   Ixodes scapularis [blacklegged tick]
ref|XP_003972741.1|  PREDICTED: 40S ribosomal protein S16-like is...    230   2e-73   Takifugu rubripes [tiger puffer]
gb|AAX62440.1|  ribosomal protein S16                                   230   2e-73   Lysiphlebus testaceipes
gb|ADV40078.1|  ribosomal protein S16                                   230   3e-73   Latrodectus hesperus [black widow]
gb|AFM90407.1|  40S ribosomal protein S16-like protein                  230   3e-73   Callorhinchus milii [Australian ghost shark]
ref|NP_001150980.1|  40S ribosomal protein S16                          230   4e-73   Zea mays [maize]
ref|NP_611685.1|  ribosomal protein S16, isoform A                      230   4e-73   Drosophila melanogaster
tpe|CBF70472.1|  TPA: 40S ribosomal protein S16 (Broad)                 229   4e-73   Aspergillus nidulans FGSC A4
ref|XP_001360809.1|  GA17915                                            229   5e-73   
gb|EAW56893.1|  ribosomal protein S16, isoform CRA_b                    229   5e-73   Homo sapiens [man]
ref|XP_003579002.1|  PREDICTED: 40S ribosomal protein S16-like          229   5e-73   Brachypodium distachyon [annual false brome]
gb|AAA03646.1|  16S ribosomal protein                                   229   7e-73   Mus musculus [mouse]
gb|EIE79686.1|  40S ribosomal protein S16                               229   8e-73   Rhizopus delemar RA 99-880
ref|XP_002949171.1|  component of cytosolic 80S ribosome and 40S ...    229   1e-72   Volvox carteri f. nagariensis
gb|ABW23146.1|  ribosomal protein rps16                                 229   1e-72   Arenicola marina [rock worm]
gb|ABI52717.1|  ribosomal protein S16                                   229   1e-72   Argas monolakensis
ref|XP_008875223.1|  40S ribosomal protein S16                          229   1e-72   Aphanomyces invadans
ref|XP_009028241.1|  hypothetical protein HELRODRAFT_115475             229   1e-72   Helobdella robusta
ref|XP_004639481.1|  PREDICTED: 40S ribosomal protein S16-like          228   1e-72   
ref|XP_001208887.1|  40S ribosomal protein S16                          228   1e-72   Aspergillus terreus NIH2624
ref|XP_011315455.1|  PREDICTED: 40S ribosomal protein S16               228   1e-72   Fopius arisanus
emb|CBJ30363.1|  conserved unknown protein                              228   1e-72   Ectocarpus siliculosus
gb|KEQ63880.1|  ribosomal protein S9                                    228   1e-72   Aureobasidium melanogenum CBS 110374
ref|XP_003373139.1|  40S ribosomal protein S16                          228   2e-72   Trichinella spiralis
gb|EIE78170.1|  40S ribosomal protein S16                               228   2e-72   Rhizopus delemar RA 99-880
ref|XP_001959719.1|  GF11903                                            228   2e-72   Drosophila ananassae
emb|CCX13673.1|  Similar to 40S ribosomal protein S16; acc. no. Q...    228   2e-72   Pyronema omphalodes CBS 100304
ref|XP_005692459.1|  PREDICTED: 40S ribosomal protein S16               228   2e-72   
gb|ESA22278.1|  hypothetical protein GLOINDRAFT_342744                  228   2e-72   
ref|XP_001275347.1|  40S ribosomal protein S16                          228   2e-72   Aspergillus clavatus NRRL 1
ref|XP_001986536.1|  GH20474                                            228   2e-72   Drosophila grimshawi
gb|KEQ80503.1|  ribosomal protein S9                                    228   2e-72   Aureobasidium pullulans EXF-150
emb|CDH52735.1|  40s ribosomal protein s16                              228   2e-72   Lichtheimia corymbifera JMRC:FSU:9682
gb|ABX44789.1|  putative 40S ribosomal protein RPS16                    228   2e-72   Flustra foliacea
ref|XP_005871817.1|  PREDICTED: 40S ribosomal protein S16-like          228   3e-72   Myotis brandtii
gb|KEQ75559.1|  ribosomal protein S9                                    228   3e-72   Aureobasidium namibiae CBS 147.97
ref|XP_010773777.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    228   3e-72   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005369791.1|  PREDICTED: 40S ribosomal protein S16-like          228   3e-72   
ref|XP_001693495.1|  ribosomal protein S16, component of cytosoli...    228   3e-72   Chlamydomonas reinhardtii
gb|AAN52388.1|  ribosomal protein S16                                   228   3e-72   Branchiostoma belcheri
ref|XP_001122174.1|  PREDICTED: 40S ribosomal protein S16               228   3e-72   Apis mellifera [bee]
ref|XP_004517607.1|  PREDICTED: 40S ribosomal protein S16-like          227   4e-72   Ceratitis capitata [medfly]
ref|XP_003701887.1|  PREDICTED: 40S ribosomal protein S16-like          227   4e-72   Megachile rotundata
ref|XP_002107880.1|  conserved hypothetical protein                     227   6e-72   Trichoplax adhaerens
ref|XP_317881.2|  AGAP011424-PA                                         227   6e-72   Anopheles gambiae str. PEST
ref|XP_008546676.1|  PREDICTED: 40S ribosomal protein S16               226   8e-72   
ref|XP_011136659.1|  PREDICTED: 40S ribosomal protein S16               226   9e-72   
gb|KIM94888.1|  hypothetical protein OIDMADRAFT_21207                   226   9e-72   
ref|XP_755383.1|  40S ribosomal protein Rps16                           226   9e-72   
gb|EME41332.1|  ribosomal protein-like protein                          226   9e-72   
gb|KDR22490.1|  40S ribosomal protein S16                               226   1e-71   
ref|XP_011067354.1|  PREDICTED: 40S ribosomal protein S16               226   1e-71   
gb|AGH70201.1|  40S ribosomal protein S16                               226   1e-71   
gb|EFZ11651.1|  hypothetical protein SINV_04941                         226   1e-71   
emb|CDH54149.1|  40s ribosomal protein s16                              226   1e-71   
gb|EFX86712.1|  hypothetical protein DAPPUDRAFT_307788                  226   1e-71   
gb|KFB37779.1|  ribosomal protein S9, putative                          226   1e-71   
dbj|GAM90516.1|  hypothetical protein ANO11243_085600                   226   1e-71   
tpg|DAA30928.1|  TPA: ribosomal protein S16-like                        226   1e-71   
gb|ERE41892.1|  40S ribosomal protein S16-like protein                  226   2e-71   
ref|XP_004060441.1|  PREDICTED: 40S ribosomal protein S16-like is...    226   2e-71   
ref|XP_003503901.2|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    226   2e-71   
gb|ACB70353.1|  ribosomal protein S16                                   226   2e-71   
ref|XP_001849641.1|  ribosomal protein S16                              226   2e-71   
ref|XP_011188471.1|  PREDICTED: 40S ribosomal protein S16               226   2e-71   
ref|XP_005363648.1|  PREDICTED: 40S ribosomal protein S16-like          225   2e-71   
gb|EHJ74931.1|  40S ribosomal protein S16                               226   2e-71   
ref|XP_001399741.1|  40S ribosomal protein S16                          225   2e-71   
ref|XP_009493693.1|  40S ribosomal protein S16                          225   2e-71   
ref|XP_001260529.1|  40S ribosomal protein S16                          225   2e-71   
gb|EGI57137.1|  40S ribosomal protein S16                               226   2e-71   
gb|ACF35258.1|  ribosomal protein S16                                   225   3e-71   
ref|XP_001244905.1|  40S ribosomal protein S16                          225   3e-71   
dbj|BAM17736.1|  ribosomal protein S16                                  225   3e-71   
ref|XP_001096607.2|  PREDICTED: 40S ribosomal protein S16-like          226   3e-71   
ref|XP_002424258.1|  40S ribosomal protein S16, putative                225   4e-71   
emb|CCA26309.1|  Rab11 family GTPase putative                           233   4e-71   
ref|XP_001656820.1|  AAEL003427-PA                                      225   4e-71   
ref|XP_005176871.1|  PREDICTED: 40S ribosomal protein S16               225   4e-71   
ref|XP_001798536.1|  hypothetical protein SNOG_08214                    226   5e-71   
ref|XP_007832090.1|  40S ribosomal protein S16                          224   5e-71   
gb|EPS28897.1|  hypothetical protein PDE_03843                          224   5e-71   
ref|XP_007932485.1|  hypothetical protein MYCFIDRAFT_60541              224   5e-71   
gb|KGG53001.1|  40S ribosomal protein S16                               224   6e-71   
ref|XP_002565995.1|  Pc22g20980                                         224   6e-71   
gb|KFH72737.1|  40S ribosomal protein S16                               224   6e-71   
sp|Q95V31.1|RS16_SPOFR  RecName: Full=40S ribosomal protein S16         224   6e-71   
ref|XP_002835431.1|  40S ribosomal protein S16                          224   6e-71   
gb|ACY95345.1|  ribosomal protein S16                                   224   7e-71   
gb|EYE97512.1|  ribosomal protein S9                                    224   7e-71   
gb|KFH62734.1|  40S ribosomal protein S16                               224   7e-71   
ref|XP_002126231.1|  PREDICTED: 40S ribosomal protein S16-like          224   8e-71   
ref|XP_008140569.1|  PREDICTED: 40S ribosomal protein S16-like          224   8e-71   
gb|AAV90714.1|  ribosomal protein S16                                   225   8e-71   
dbj|BAM18896.1|  ribosomal protein S16                                  224   8e-71   
emb|CAD32467.1|  ribosomal protein S16                                  223   9e-71   
gb|ADT80665.1|  ribosomal protein S16                                   224   9e-71   
ref|XP_005660372.1|  PREDICTED: 40S ribosomal protein S16-like          224   9e-71   
gb|EPY85984.1|  ribosomal protein S16                                   224   9e-71   
gb|ETN57891.1|  ribosomal protein S16                                   224   1e-70   
ref|XP_006674637.1|  40S ribosomal protein S16                          223   1e-70   
gb|EKV09594.1|  40S ribosomal protein Rps16, putative                   223   1e-70   
ref|XP_008029776.1|  hypothetical protein SETTUDRAFT_165152             223   1e-70   
ref|XP_007781496.1|  40S ribosomal protein S16                          223   1e-70   
ref|XP_003045227.1|  40S ribosomal protein S16                          223   1e-70   
ref|XP_003427491.1|  PREDICTED: 40S ribosomal protein S16               223   1e-70   
gb|EFW13750.1|  40S ribosomal protein S9                                226   2e-70   
gb|ABM55425.1|  40S ribosomal protein S16                               223   2e-70   
ref|XP_007757836.1|  40S ribosomal protein S16                          223   2e-70   
ref|XP_007686327.1|  hypothetical protein COCMIDRAFT_35302              223   2e-70   
ref|XP_007807991.1|  30S ribosomal protein S9                           223   2e-70   
gb|KFD50978.1|  hypothetical protein M513_08161                         224   2e-70   
gb|KID78369.1|  Ribosomal protein S9                                    223   2e-70   
ref|XP_006996257.1|  PREDICTED: 40S ribosomal protein S16-like          223   3e-70   
emb|CAJ17205.1|  ribosomal protein S16e                                 223   3e-70   
emb|CAJ17204.1|  ribosomal protein S16e                                 223   3e-70   
ref|NP_001155817.1|  40S ribosomal protein S16-like                     223   3e-70   
ref|XP_011502658.1|  PREDICTED: 40S ribosomal protein S16               223   3e-70   
ref|XP_001598002.1|  40S ribosomal protein S16                          222   3e-70   
gb|EQL03131.1|  Ribosomal protein S9                                    222   3e-70   
ref|XP_008597075.1|  ribosomal protein S9/S16                           222   3e-70   
ref|NP_001037508.1|  ribosomal protein S16                              223   3e-70   
ref|XP_008729424.1|  40S ribosomal protein S16                          222   4e-70   
gb|KIW66708.1|  40S ribosomal protein S16                               222   4e-70   
gb|KIW47833.1|  40S ribosomal protein S16                               222   4e-70   
gb|KIW17179.1|  40S ribosomal protein S16                               222   4e-70   
gb|KIW57063.1|  40S ribosomal protein S16                               222   5e-70   
ref|XP_007294963.1|  40S ribosomal protein S16                          222   5e-70   
emb|CCT73613.1|  probable RPS16B-ribosomal protein S16.e                222   5e-70   
gb|AIU94812.1|  40S ribosomal protein                                   222   5e-70   
ref|XP_001938684.1|  40S ribosomal protein S16                          222   5e-70   
ref|XP_007818672.1|  hypothetical protein MAA_02483                     222   5e-70   
ref|XP_003079490.1|  40S ribosomal protein S16 (ISS)                    222   5e-70   
ref|XP_003794357.1|  PREDICTED: 40S ribosomal protein S16-like is...    222   5e-70   
gb|ABS57443.1|  ribosomal protein S16                                   222   6e-70   
gb|KIW32566.1|  40S ribosomal protein S16                               221   6e-70   
gb|KIE01576.1|  Ribosomal protein S9                                    221   6e-70   
ref|XP_006963581.1|  hypothetical protein TRIREDRAFT_46490              221   7e-70   
ref|XP_005657548.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    222   7e-70   
ref|XP_002622587.1|  40S ribosomal protein S16                          221   8e-70   
ref|XP_002542077.1|  40S ribosomal protein S16                          221   8e-70   
gb|KIW85180.1|  40S ribosomal protein S16                               221   8e-70   
gb|ELR06410.1|  40S ribosomal protein S16                               221   9e-70   
ref|XP_011124562.1|  hypothetical protein AOL_s00097g427                221   9e-70   
ref|XP_011399450.1|  40S ribosomal protein S16                          221   1e-69   
ref|XP_002796427.1|  40S ribosomal protein S16                          221   1e-69   
ref|XP_003855745.1|  40S ribosomal protein S16                          221   1e-69   
ref|XP_007746508.1|  40S ribosomal protein S16                          221   1e-69   
gb|EHK19908.1|  hypothetical protein TRIVIDRAFT_83253                   221   1e-69   
ref|XP_001555512.1|  40S ribosomal protein S16                          221   1e-69   
gb|KIX02816.1|  40S ribosomal protein S16                               221   1e-69   
gb|KIY00823.1|  40S ribosomal protein S16                               221   1e-69   
gb|KFY16535.1|  hypothetical protein V492_01253                         222   1e-69   
emb|CCQ18592.1|  40S ribosomal protein S16                              221   1e-69   
gb|KHJ31540.1|  putative 40s ribosomal protein s16                      221   1e-69   
ref|XP_007804760.1|  40S ribosomal protein S16                          221   1e-69   
dbj|GAN05521.1|  40S ribosomal protein S16                              220   2e-69   
ref|XP_002850095.1|  40S ribosomal protein S16                          220   2e-69   
gb|EWG51312.1|  40S ribosomal protein S16                               220   2e-69   
gb|AAX48893.1|  S16                                                     221   2e-69   
gb|ACY71273.1|  ribosomal protein S16                                   221   2e-69   
gb|KFY72802.1|  hypothetical protein V499_07066                         222   2e-69   
gb|KFZ07922.1|  hypothetical protein V502_09659                         222   2e-69   
gb|KDD73182.1|  ribosomal protein S9/S16                                220   2e-69   
ref|XP_006392218.1|  hypothetical protein EUTSA_v10023899mg             220   2e-69   
gb|ADG23112.1|  40S ribosomal protein Rps16                             220   2e-69   
gb|ESZ99352.1|  40S ribosomal protein S16                               220   2e-69   
gb|EKG20079.1|  Ribosomal protein S9                                    220   2e-69   
ref|XP_007583861.1|  putative 40s ribosomal protein s16 protein         220   2e-69   
ref|XP_007723453.1|  40S ribosomal protein S16                          220   3e-69   
ref|XP_003834453.1|  similar to 40S ribosomal protein S16               220   3e-69   
ref|XP_008714363.1|  40S ribosomal protein S16                          220   3e-69   
gb|KFZ59414.1|  40S ribosomal protein S16                               219   3e-69   
dbj|GAD93775.1|  40S ribosomal protein S16                              220   3e-69   
gb|KDB16501.1|  30S ribosomal protein S9                                220   3e-69   
gb|KIV84862.1|  40S ribosomal protein S16-B                             219   4e-69   
ref|XP_001629182.1|  predicted protein                                  219   4e-69   
ref|XP_005818736.1|  small subunit ribosomal protein S16e, cytopl...    219   4e-69   
ref|NP_001070200.1|  40S ribosomal protein S16                          219   4e-69   
gb|EPB92643.1|  40S ribosomal protein                                   219   4e-69   
gb|EHK46585.1|  hypothetical protein TRIATDRAFT_256508                  219   4e-69   
dbj|BAN21249.1|  ribosomal protein S16                                  219   5e-69   
ref|XP_011339624.1|  PREDICTED: 40S ribosomal protein S16               219   5e-69   
tpe|CAL69104.1|  TPA: putative 40S ribosomal protein S16 isoform 1      219   6e-69   
ref|XP_007729768.1|  40S ribosomal protein S16                          219   6e-69   
ref|XP_005480827.1|  PREDICTED: 40S ribosomal protein S16-like          219   7e-69   
emb|CDQ77129.1|  unnamed protein product                                219   7e-69   
ref|XP_780037.1|  PREDICTED: 40S ribosomal protein S16-like isofo...    219   7e-69   
gb|KIL86733.1|  30s ribosomal protein s9                                219   7e-69   
ref|XP_008079047.1|  Ribosomal protein S5 2-like protein                219   8e-69   
gb|ACN44179.1|  ribosomal protein S16                                   218   1e-68   
ref|XP_005963532.1|  PREDICTED: 40S ribosomal protein S16 isoform X1    220   1e-68   
gb|EWC44421.1|  40S ribosomal protein S16                               218   1e-68   
tpe|CAL69105.1|  TPA: putative 40S ribosomal protein S16 isoform 2      218   1e-68   
ref|XP_009161029.1|  40S ribosomal protein S16                          218   1e-68   
ref|XP_970777.1|  PREDICTED: 40S ribosomal protein S16                  219   1e-68   
gb|EMF11109.1|  40S ribosomal protein Rps16                             218   1e-68   
ref|XP_010756302.1|  40S ribosomal protein S16                          218   1e-68   
ref|XP_003003065.1|  40S ribosomal protein S16                          218   1e-68   
ref|XP_003386151.1|  PREDICTED: 40S ribosomal protein S16-like          218   1e-68   
gb|KFX87860.1|  hypothetical protein O988_09259                         218   1e-68   
ref|XP_004347857.1|  ribosomal protein S16                              218   1e-68   
emb|CCE27535.1|  probable RPS16B-ribosomal protein S16.e                218   1e-68   
ref|XP_002741890.1|  PREDICTED: 40S ribosomal protein S16-like          218   2e-68   
ref|XP_009251551.1|  hypothetical protein FPSE_00156                    219   2e-68   
gb|ENH86473.1|  40s ribosomal protein s16                               218   2e-68   
ref|XP_007679998.1|  hypothetical protein BAUCODRAFT_125558             218   2e-68   
ref|XP_005010858.1|  PREDICTED: 40S ribosomal protein S16-like          218   2e-68   
gb|EMC80167.1|  40S ribosomal protein S16                               217   2e-68   
gb|EFQ25244.1|  ribosomal protein S9/S16                                218   2e-68   
ref|XP_007276780.1|  40s ribosomal protein s16                          218   2e-68   
gb|KHN82434.1|  40S ribosomal protein S16                               217   3e-68   
ref|XP_003765171.1|  PREDICTED: uncharacterized protein LOC100920892    223   3e-68   
gb|EOB07742.1|  40S ribosomal protein S16                               217   3e-68   
ref|XP_011110711.1|  hypothetical protein H072_4821                     217   3e-68   
gb|EPY52929.1|  40S ribosomal protein S16                               217   3e-68   
gb|EPQ64664.1|  Protein component of the small (40S) ribosomal su...    216   5e-68   
ref|XP_005716748.1|  unnamed protein product                            217   6e-68   
ref|XP_001746925.1|  hypothetical protein                               216   6e-68   
ref|XP_007597205.1|  ribosomal protein S9/S16                           216   6e-68   
gb|EPX71321.1|  40S ribosomal protein S16                               216   7e-68   
ref|XP_005512790.1|  PREDICTED: 40S ribosomal protein S16-like          219   8e-68   
gb|ERG80845.1|  40s ribosomal protein s16                               216   9e-68   
ref|XP_007874994.1|  30S ribosomal protein S9                           216   1e-67   
ref|XP_002174569.1|  40S ribosomal protein S16                          216   1e-67   
gb|EEH04485.1|  40S ribosomal protein S16                               216   1e-67   
ref|XP_004441577.1|  PREDICTED: 40S ribosomal protein S16 isoform 1     217   1e-67   
gb|AEE63267.1|  unknown                                                 216   1e-67   
emb|CDW57740.1|  40S ribosomal protein S16                              216   1e-67   
gb|ELW72377.1|  40S ribosomal protein S16                               220   2e-67   
ref|XP_001536964.1|  40S ribosomal protein S16                          215   2e-67   
ref|XP_005039959.1|  PREDICTED: uncharacterized protein LOC101812684    222   2e-67   
gb|KIW08229.1|  40S ribosomal protein S16                               215   2e-67   
gb|KEY65597.1|  hypothetical protein S7711_08785                        215   2e-67   
ref|NP_595738.1|  40S ribosomal protein S16                             215   2e-67   
gb|ESW98678.1|  40S ribosomal protein S16                               215   2e-67   
ref|XP_011321495.1|  40S ribosomal protein S16                          215   2e-67   
gb|KIV89975.1|  40S ribosomal protein S16                               215   3e-67   
ref|XP_003647271.1|  hypothetical protein Ecym_6051                     214   3e-67   
ref|XP_007798148.1|  putative 40s ribosomal protein s16 protein         214   3e-67   
ref|XP_005703741.1|  40S ribosomal protein S16e                         214   4e-67   
gb|KEF59434.1|  40S ribosomal protein S16                               214   4e-67   
ref|XP_002172859.1|  40S ribosomal protein S16                          214   5e-67   
dbj|BAA33368.1|  ribosomal protein S16 homolog                          214   6e-67   
gb|EMP36507.1|  40S ribosomal protein S16                               221   6e-67   
gb|KGU33682.1|  40S ribosomal protein S16                               214   6e-67   
gb|ELK24038.1|  40S ribosomal protein S16                               213   7e-67   
gb|EIE92043.1|  40S ribosomal protein S16                               214   8e-67   
ref|XP_003743332.1|  PREDICTED: 40S ribosomal protein S16-like          214   8e-67   
gb|ABW90422.1|  putative ribosomal protein S16                          213   9e-67   
ref|NP_984354.1|  40S ribosomal protein S16                             213   1e-66   
emb|CCK70468.1|  hypothetical protein KNAG_0E02060                      213   1e-66   
emb|CEJ92107.1|  Putative 30S ribosomal protein S9                      213   1e-66   
ref|XP_003958027.1|  hypothetical protein KAFR_0F02960                  213   1e-66   
gb|KFH43951.1|  40S ribosomal protein-like protein                      213   2e-66   
ref|XP_003682894.1|  40S ribosomal protein S16                          213   2e-66   
ref|XP_004481507.1|  PREDICTED: 40S ribosomal protein S16 isoform 1     214   3e-66   
ref|XP_001894284.1|  40S ribosomal protein S16                          212   3e-66   
ref|XP_002416955.1|  40S ribosomal protein S16                          212   3e-66   
gb|KFM74061.1|  40S ribosomal protein S16                               212   3e-66   
dbj|GAM36975.1|  40S ribosomal protein                                  212   3e-66   
ref|XP_011274624.1|  40S ribosomal protein S16                          212   3e-66   
ref|XP_003686476.1|  40S ribosomal protein S16                          212   3e-66   
emb|CCK68250.1|  hypothetical protein KNAG_0A05870                      212   4e-66   
gb|ELT87813.1|  hypothetical protein CAPTEDRAFT_220902                  212   4e-66   
ref|XP_002151957.1|  40S ribosomal protein S16                          212   4e-66   



>ref|XP_011092558.1| PREDICTED: 40S ribosomal protein S16-like [Sesamum indicum]
Length=145

 Score =   289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAAA  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRH
Sbjct  1    MAAATTESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_009792138.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=148

 Score =   288 bits (736),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A+P+ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRF
Sbjct  6    ASPMESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRF  65

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  66   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  125

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  126  PRRCEPKKFGGRGARARFQKSYR  148



>ref|XP_011089620.1| PREDICTED: 40S ribosomal protein S16 [Sesamum indicum]
Length=144

 Score =   286 bits (732),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A P ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRF
Sbjct  2    ATPTESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>emb|CDO97194.1| unnamed protein product [Coffea canephora]
Length=144

 Score =   286 bits (731),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRF
Sbjct  2    AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            A VDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AAVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_009612267.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009612268.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009759825.1| PREDICTED: 40S ribosomal protein S16 [Nicotiana sylvestris]
Length=147

 Score =   285 bits (728),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 143/147 (97%), Gaps = 2/147 (1%)
 Frame = -2

Query  552  MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLG  379
            M AAP  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLG
Sbjct  1    MNAAPAAVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLG  60

Query  378  RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL  199
            RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQ KKEIKDILVRYDRTL
Sbjct  61   RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQQKKEIKDILVRYDRTL  120

Query  198  LVADPRRCEPKKFGGRGARARFQKSYR  118
            LVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  LVADPRRCEPKKFGGRGARARFQKSYR  147



>ref|XP_010105611.1| 40S ribosomal protein S16 [Morus notabilis]
 gb|EXC51104.1| 40S ribosomal protein S16 [Morus notabilis]
Length=145

 Score =   284 bits (727),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAAAP ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRH
Sbjct  1    MAAAPTESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>gb|EPS67947.1| hypothetical protein M569_06824 [Genlisea aurea]
Length=144

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRF
Sbjct  2    AAPAESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            +GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   SGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_004229156.1| PREDICTED: 40S ribosomal protein S16-like [Solanum lycopersicum]
 ref|XP_006365442.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=150

 Score =   284 bits (726),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AAA VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHR
Sbjct  7    AAATVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHR  66

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQK+VDEQ KKEIKDIL+RYDRTLLVA
Sbjct  67   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKFVDEQQKKEIKDILIRYDRTLLVA  126

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  127  DPRRCEPKKFGGRGARSRFQKSYR  150



>gb|KDP42492.1| hypothetical protein JCGZ_00289 [Jatropha curcas]
 gb|KDP42493.1| hypothetical protein JCGZ_00290 [Jatropha curcas]
Length=145

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAAAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRH
Sbjct  1    MAAAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_004237264.1| PREDICTED: 40S ribosomal protein S16 [Solanum lycopersicum]
 ref|XP_006341850.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=147

 Score =   283 bits (725),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AAA  ESVQCFGRKKTAVAVTHCKRG+GLIKINGVPIEL+QPEILRYKA+EPILLLGRHR
Sbjct  4    AAATAESVQCFGRKKTAVAVTHCKRGKGLIKINGVPIELVQPEILRYKAYEPILLLGRHR  63

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA
Sbjct  64   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  123

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  124  DPRRCEPKKFGGRGARSRFQKSYR  147



>ref|XP_009602130.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana tomentosiformis]
 ref|XP_009764504.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=147

 Score =   283 bits (724),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRFA
Sbjct  6    ATAESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRFA  65

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  66   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  125

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  126  RRCEPKKFGGRGARARFQKSYR  147



>ref|XP_009612269.1| PREDICTED: 40S ribosomal protein S16 [Nicotiana tomentosiformis]
Length=147

 Score =   283 bits (723),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 2/147 (1%)
 Frame = -2

Query  552  MAAAPV--ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLG  379
            M AAP   ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLG
Sbjct  1    MNAAPAAAESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLG  60

Query  378  RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL  199
            RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQ KKEIKDILVRYDRTL
Sbjct  61   RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQQKKEIKDILVRYDRTL  120

Query  198  LVADPRRCEPKKFGGRGARARFQKSYR  118
            LVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  LVADPRRCEPKKFGGRGARARFQKSYR  147



>ref|XP_009623909.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana tomentosiformis]
Length=150

 Score =   282 bits (722),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 143/146 (98%), Gaps = 2/146 (1%)
 Frame = -2

Query  549  AAAPV--ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            AAAP   ESVQCFGRKKTAVAVTHCKRG+GLIKINGVPIEL+QPEILRYKAFEPILLLGR
Sbjct  5    AAAPAAAESVQCFGRKKTAVAVTHCKRGKGLIKINGVPIELVQPEILRYKAFEPILLLGR  64

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQK+VDEQSKKEIKDILVRYDRTLL
Sbjct  65   HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKFVDEQSKKEIKDILVRYDRTLL  124

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  125  VADPRRCEPKKFGGRGARARFQKSYR  150



>gb|EPS63821.1| hypothetical protein M569_10962, partial [Genlisea aurea]
Length=145

 Score =   282 bits (721),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AAA  ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHR
Sbjct  2    AAAAKESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHR  61

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            F+GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA
Sbjct  62   FSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  121

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  122  DPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_004238675.1| PREDICTED: 40S ribosomal protein S16 [Solanum lycopersicum]
 ref|XP_006355978.1| PREDICTED: 40S ribosomal protein S16-like [Solanum tuberosum]
Length=147

 Score =   281 bits (718),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 2/147 (1%)
 Frame = -2

Query  552  MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLG  379
            M AAP  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLG
Sbjct  1    MQAAPATVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLG  60

Query  378  RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL  199
            R RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQ+KKEIKDIL+RYDRTL
Sbjct  61   RQRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQTKKEIKDILIRYDRTL  120

Query  198  LVADPRRCEPKKFGGRGARARFQKSYR  118
            LVADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  LVADPRRCEPKKFGGRGARSRFQKSYR  147



>ref|XP_010066008.1| PREDICTED: 40S ribosomal protein S16 [Eucalyptus grandis]
 ref|XP_010028435.1| PREDICTED: 40S ribosomal protein S16 [Eucalyptus grandis]
 gb|KCW55181.1| hypothetical protein EUGRSUZ_I01133 [Eucalyptus grandis]
 gb|KCW55182.1| hypothetical protein EUGRSUZ_I01133 [Eucalyptus grandis]
Length=144

 Score =   280 bits (717),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 143/143 (100%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL++PEILR+KA+EPILLLGRHRF
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVEPEILRFKAYEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQK+VDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKFVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_007034683.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
 gb|EOY05609.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
Length=144

 Score =   280 bits (716),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAPVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+EPILLLGRHRF
Sbjct  2    AAPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQK+VDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKFVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_002281350.1| PREDICTED: 40S ribosomal protein S16 [Vitis vinifera]
 emb|CAN75982.1| hypothetical protein VITISV_012186 [Vitis vinifera]
Length=144

 Score =   280 bits (715),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILR+KA+EPILLLGRHRF
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRHKAYEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>gb|ADR71284.1| 40S ribosomal protein S16B [Hevea brasiliensis]
Length=146

 Score =   280 bits (715),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 143/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A+AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHR
Sbjct  3    ASAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHR  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKD+LVRYDRTLLVA
Sbjct  63   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDVLVRYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  123  DPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_002300225.1| ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011000124.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92774.1| unknown [Populus trichocarpa]
 gb|ABK93739.1| unknown [Populus trichocarpa]
 gb|ABK95393.1| unknown [Populus trichocarpa]
 gb|EEE85030.1| ribosomal protein S16 [Populus trichocarpa]
Length=146

 Score =   280 bits (715),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
             AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHR
Sbjct  3    TAAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGSPIELVEPEILRFKAYEPILLLGRHR  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA
Sbjct  63   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGGRGARARFQKSYR
Sbjct  123  DPRRCETKKFGGRGARARFQKSYR  146



>gb|ADR71283.1| 40S ribosomal protein S16A [Hevea brasiliensis]
Length=147

 Score =   279 bits (714),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF
Sbjct  5    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRF  64

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  65   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  124

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  125  PRRCEPKKFGGRGARARFQKSYR  147



>ref|XP_002285101.1| PREDICTED: 40S ribosomal protein S16 [Vitis vinifera]
 emb|CAN72805.1| hypothetical protein VITISV_035308 [Vitis vinifera]
Length=144

 Score =   279 bits (714),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A+PVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA EPILLLGRHRF
Sbjct  2    ASPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAVEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>gb|EPS69719.1| hypothetical protein M569_05046, partial [Genlisea aurea]
Length=145

 Score =   279 bits (714),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 2/145 (1%)
 Frame = -2

Query  546  AAPV--ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            AAP   ESVQCFGRKKTAVAVT+CKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRH
Sbjct  1    AAPTATESVQCFGRKKTAVAVTYCKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF+GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_006422982.1| hypothetical protein CICLE_v10029508mg [Citrus clementina]
 ref|XP_006487042.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 ref|XP_006487044.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 gb|ESR36222.1| hypothetical protein CICLE_v10029508mg [Citrus clementina]
 gb|KDO35909.1| hypothetical protein CISIN_1g032049mg [Citrus sinensis]
Length=148

 Score =   279 bits (713),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A PVESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF
Sbjct  6    AGPVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRF  65

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  66   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  125

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  126  PRRCEPKKFGGRGARARFQKSYR  148



>ref|XP_004136973.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004140706.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004149967.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004159897.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004160469.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_004161434.1| PREDICTED: 40S ribosomal protein S16-like [Cucumis sativus]
 ref|XP_008454961.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 ref|XP_008456099.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 ref|XP_008456141.1| PREDICTED: 40S ribosomal protein S16 [Cucumis melo]
 gb|KGN43920.1| hypothetical protein Csa_7G073560 [Cucumis sativus]
 gb|KGN57515.1| hypothetical protein Csa_3G202730 [Cucumis sativus]
 gb|KGN57574.1| hypothetical protein Csa_3G215620 [Cucumis sativus]
Length=144

 Score =   278 bits (712),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF
Sbjct  2    AAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            +GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   SGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>gb|AAF34799.1|AF227979_1 40S ribosomal protein S16 [Euphorbia esula]
Length=144

 Score =   278 bits (712),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AA P ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHR
Sbjct  1    AATPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHR  60

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQSKKEIKDILVRYDRTLLVA
Sbjct  61   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQSKKEIKDILVRYDRTLLVA  120

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  DPRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_007201870.1| hypothetical protein PRUPE_ppa012998mg [Prunus persica]
 ref|XP_010107915.1| 40S ribosomal protein S16 [Morus notabilis]
 gb|EMJ03069.1| hypothetical protein PRUPE_ppa012998mg [Prunus persica]
 gb|EXC17315.1| 40S ribosomal protein S16 [Morus notabilis]
Length=145

 Score =   278 bits (712),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRH
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>gb|AEW43294.1| putative ribosomal protein S9, partial [Hevea brasiliensis]
Length=143

 Score =   278 bits (711),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            +AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF
Sbjct  1    SAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRF  60

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  61   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  120

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  121  PRRCEPKKFGGRGARARFQKSYR  143



>ref|XP_010916936.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
 ref|XP_010916937.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
Length=145

 Score =   278 bits (711),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAAA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRH
Sbjct  1    MAAAATESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>gb|ABK20993.1| unknown [Picea sitchensis]
 gb|ABK22272.1| unknown [Picea sitchensis]
 gb|ACN40265.1| unknown [Picea sitchensis]
Length=143

 Score =   278 bits (710),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A V+SVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILRYKAFEPILLLGRHRFA
Sbjct  2    AAVDSVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRYKAFEPILLLGRHRFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  62   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  122  RRCEPKKFGGRGARARFQKSYR  143



>ref|XP_010551554.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
 ref|XP_010553878.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score =   277 bits (709),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 141/146 (97%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MAA P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FEPILLLGR
Sbjct  1    MAAQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFEPILLLGR  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>gb|ADR71285.1| 40S ribosomal protein S16C [Hevea brasiliensis]
Length=146

 Score =   277 bits (709),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A+AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEI R+KA+EPILLLGRHR
Sbjct  3    ASAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEIFRFKAYEPILLLGRHR  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV YDRTLLVA
Sbjct  63   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVSYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  123  DPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_010255966.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=144

 Score =   277 bits (708),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A P+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKAFEPILLLGRHRF
Sbjct  2    ATPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAFEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            +GVDMRIRV+GGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   SGVDMRIRVRGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_008236476.1| PREDICTED: 40S ribosomal protein S16-like [Prunus mume]
Length=145

 Score =   277 bits (708),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRH
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQK+VDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKFVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_010524961.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score =   277 bits (708),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 141/146 (97%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+KAFEPILLLGR
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKAFEPILLLGR  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKE+KDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEVKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_007226006.1| hypothetical protein PRUPE_ppa012996mg [Prunus persica]
 ref|XP_008222957.1| PREDICTED: 40S ribosomal protein S16 [Prunus mume]
 gb|EMJ27205.1| hypothetical protein PRUPE_ppa012996mg [Prunus persica]
Length=145

 Score =   277 bits (708),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRH
Sbjct  1    MATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_010528603.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score =   276 bits (707),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 141/146 (97%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MAA P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FEPILLLGR
Sbjct  1    MAAQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFEPILLLGR  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDI+VRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDIMVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_010549634.1| PREDICTED: 40S ribosomal protein S16-1 [Tarenaya hassleriana]
Length=146

 Score =   276 bits (705),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 140/146 (96%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FEPILLLGR
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFEPILLLGR  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_002312518.1| 40S ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011026141.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92953.1| unknown [Populus trichocarpa]
 gb|ABK94067.1| unknown [Populus trichocarpa]
 gb|EEE89885.1| 40S ribosomal protein S16 [Populus trichocarpa]
Length=144

 Score =   276 bits (705),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGR RF
Sbjct  2    AAPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCE KKFGGRGARARFQKSYR
Sbjct  122  PRRCETKKFGGRGARARFQKSYR  144



>ref|XP_008383171.1| PREDICTED: 40S ribosomal protein S16 [Malus domestica]
 ref|XP_009338447.1| PREDICTED: 40S ribosomal protein S16 [Pyrus x bretschneideri]
Length=145

 Score =   276 bits (705),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGR 
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_006419873.1| hypothetical protein CICLE_v10006162mg [Citrus clementina]
 ref|XP_006489340.1| PREDICTED: 40S ribosomal protein S16-like [Citrus sinensis]
 gb|ESR33113.1| hypothetical protein CICLE_v10006162mg [Citrus clementina]
 gb|KDO74722.1| hypothetical protein CISIN_1g032125mg [Citrus sinensis]
Length=147

 Score =   275 bits (703),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AA   ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRHR
Sbjct  4    AAPKTESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHR  63

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            F GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA
Sbjct  64   FNGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  123

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  124  DPRRCEPKKFGGRGARARFQKSYR  147



>gb|ABK23888.1| unknown [Picea sitchensis]
 gb|AFJ04416.1| putative ribosomal S16 [Picea wilsonii]
Length=143

 Score =   275 bits (703),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A V+SVQCFGRKKTAVAVT+CKRGRGLIKING PIELI+PEILRYKAFEPILLLGR RFA
Sbjct  2    AAVDSVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELIEPEILRYKAFEPILLLGRQRFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  62   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  122  RRCEPKKFGGRGARARFQKSYR  143



>ref|XP_002518738.1| ribosomal protein S9, putative [Ricinus communis]
 gb|EEF43663.1| ribosomal protein S9, putative [Ricinus communis]
Length=151

 Score =   275 bits (703),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 142/150 (95%), Gaps = 7/150 (5%)
 Frame = -2

Query  546  AAPV-------ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPIL  388
            AAPV       ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPIL
Sbjct  2    AAPVATTPSQTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPIL  61

Query  387  LLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYD  208
            LLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYD
Sbjct  62   LLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYD  121

Query  207  RTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            RTLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  122  RTLLVADPRRCEPKKFGGRGARARFQKSYR  151



>ref|XP_008375886.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
Length=222

 Score =   278 bits (710),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  588  FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  409
            F YS +  +T  MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+
Sbjct  66   FHYSIQSNQTLAMATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRF  125

Query  408  KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIK  229
            KA+EPILLLGR RFAGVDMRIRVKGGGH SQIYAIRQSIAKALVAFYQKYVDEQSKKEIK
Sbjct  126  KAYEPILLLGRQRFAGVDMRIRVKGGGHISQIYAIRQSIAKALVAFYQKYVDEQSKKEIK  185

Query  228  DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  186  DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  222



>ref|XP_004296911.1| PREDICTED: 40S ribosomal protein S16 [Fragaria vesca subsp. vesca]
Length=145

 Score =   275 bits (702),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAA P++SVQCFGRKKTAVAVT+CK GRGLIKING PIEL++PEILR+KA+EPILLLGRH
Sbjct  1    MAAPPIKSVQCFGRKKTAVAVTYCKEGRGLIKINGCPIELVEPEILRFKAYEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>gb|KJB12247.1| hypothetical protein B456_002G008400 [Gossypium raimondii]
Length=145

 Score =   275 bits (702),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA   VESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA EPILLLGRH
Sbjct  1    MAEKAVESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKK+IKD+LV YDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKDIKDVLVTYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_009804322.1| PREDICTED: 40S ribosomal protein S16-like [Nicotiana sylvestris]
Length=154

 Score =   275 bits (703),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  534  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD  355
            ESVQCFGRKKTAVAV+HCKRG+GL+KINGVPIEL+QPEILRYKAFEPILLLGRHRFAGVD
Sbjct  16   ESVQCFGRKKTAVAVSHCKRGKGLMKINGVPIELVQPEILRYKAFEPILLLGRHRFAGVD  75

Query  354  MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  175
            MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKY DEQSKKEIKDILVRYDRTLLVADPRRC
Sbjct  76   MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYGDEQSKKEIKDILVRYDRTLLVADPRRC  135

Query  174  EPKKFGGRGARARFQKSYR  118
            EPKKFGGRGARARFQKSYR
Sbjct  136  EPKKFGGRGARARFQKSYR  154



>ref|XP_002314714.1| 40S ribosomal protein S16 [Populus trichocarpa]
 ref|XP_011021570.1| PREDICTED: 40S ribosomal protein S16 [Populus euphratica]
 gb|ABK92685.1| unknown [Populus trichocarpa]
 gb|EEF00885.1| 40S ribosomal protein S16 [Populus trichocarpa]
Length=144

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AAP ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGR RF
Sbjct  2    AAPKESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCE KKFGGRGARARFQKSYR
Sbjct  122  PRRCETKKFGGRGARARFQKSYR  144



>ref|XP_010558732.1| PREDICTED: 40S ribosomal protein S16-1-like [Tarenaya hassleriana]
Length=146

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            VESVQCFGRKKTAVAVT+CKRG GLIKING PIELIQPEILR+K FEPILLLGRHRFAGV
Sbjct  7    VESVQCFGRKKTAVAVTYCKRGSGLIKINGCPIELIQPEILRFKVFEPILLLGRHRFAGV  66

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  67   DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  126

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  127  CEPKKFGGRGARARFQKSYR  146



>ref|XP_008390856.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
 ref|XP_009364210.1| PREDICTED: 40S ribosomal protein S16-like [Pyrus x bretschneideri]
Length=145

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAA  +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGR 
Sbjct  1    MAAPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDIL+RYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILIRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARSRFQKSYR  145



>ref|XP_008373839.1| PREDICTED: 40S ribosomal protein S16-like [Malus domestica]
 ref|XP_008364534.1| PREDICTED: 40S ribosomal protein S16 [Malus domestica]
Length=145

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGR 
Sbjct  1    MATPAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>gb|KHG18721.1| 40S ribosomal S16 [Gossypium arboreum]
 gb|KJB77662.1| hypothetical protein B456_012G149700 [Gossypium raimondii]
Length=146

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            AP+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA EPILLLGR RFA
Sbjct  5    APIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  65   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  125  RRCEPKKFGGRGARARFQKSYR  146



>ref|XP_006400383.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum]
 gb|ESQ41836.1| hypothetical protein EUTSA_v10014948mg [Eutrema salsugineum]
Length=146

 Score =   274 bits (700),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 139/146 (95%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGSPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_007160464.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris]
 gb|ESW32458.1| hypothetical protein PHAVU_002G324300g [Phaseolus vulgaris]
Length=147

 Score =   274 bits (700),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            AA  +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRHR
Sbjct  4    AAPALEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHR  63

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVA
Sbjct  64   FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVA  123

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  124  DPRRCEPKKFGGRGARARFQKSYR  147



>ref|XP_010926242.1| PREDICTED: 40S ribosomal protein S16-like [Elaeis guineensis]
Length=144

 Score =   273 bits (699),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEP+LLLGRHRF
Sbjct  2    AAATESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPVLLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_010263487.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=143

 Score =   273 bits (699),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+EPILLLGRHRF+
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYEPILLLGRHRFS  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRV+GGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  62   GVDMRIRVRGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  122  RRCEPKKFGGRGARARFQKSYR  143



>gb|KJB79354.1| hypothetical protein B456_013G045400 [Gossypium raimondii]
Length=146

 Score =   273 bits (699),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            AP+ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA EPILLLGR RFA
Sbjct  5    APIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV YDRTLLVADP
Sbjct  65   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVGYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  125  RRCEPKKFGGRGARARFQKSYR  146



>ref|XP_008780865.1| PREDICTED: 40S ribosomal protein S16-like [Phoenix dactylifera]
Length=144

 Score =   273 bits (698),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AA  ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRHRF
Sbjct  2    AAASESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  62   AGVDMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_010277830.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=144

 Score =   273 bits (697),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            ++P+ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF
Sbjct  2    SSPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            +GVDMRIRV+GGGHTSQIYAIRQSIAKALVA+YQKYVDEQ+KKEIKDILVRYDRTLLVAD
Sbjct  62   SGVDMRIRVRGGGHTSQIYAIRQSIAKALVAYYQKYVDEQAKKEIKDILVRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>ref|XP_004290594.1| PREDICTED: 40S ribosomal protein S16-like [Fragaria vesca subsp. 
vesca]
Length=148

 Score =   273 bits (697),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 142/148 (96%), Gaps = 3/148 (2%)
 Frame = -2

Query  552  MAAAPV---ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLL  382
            MAAA V   ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA+EPILLL
Sbjct  1    MAAAVVPSKESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLL  60

Query  381  GRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT  202
            GRHRFA VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT
Sbjct  61   GRHRFADVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT  120

Query  201  LLVADPRRCEPKKFGGRGARARFQKSYR  118
            LLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  LLVADPRRCEPKKFGGRGARARFQKSYR  148



>ref|XP_010420587.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010434945.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010440282.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
 ref|XP_010454073.1| PREDICTED: 40S ribosomal protein S16-3-like [Camelina sativa]
Length=146

 Score =   272 bits (696),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKVFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_010270291.1| PREDICTED: 40S ribosomal protein S16 [Nelumbo nucifera]
Length=143

 Score =   272 bits (695),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILRYKA+EPILLLGR RFA
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRYKAYEPILLLGRQRFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRV+GGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  62   GVDMRIRVRGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  122  RRCEPKKFGGRGARARFQKSYR  143



>gb|KJB31216.1| hypothetical protein B456_005G236900 [Gossypium raimondii]
Length=145

 Score =   272 bits (696),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA   +ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA EPILLLGR 
Sbjct  1    MAEKAIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV YDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVGYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_010449924.1| PREDICTED: 40S ribosomal protein S16-3 [Camelina sativa]
 ref|XP_010492838.1| PREDICTED: 40S ribosomal protein S16-3 [Camelina sativa]
Length=146

 Score =   272 bits (695),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_007042464.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
 gb|EOX98295.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
Length=146

 Score =   272 bits (695),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KA EPILLLGR RFA
Sbjct  5    ASIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  65   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  125  RRCEPKKFGGRGARARFQKSYR  146



>ref|XP_006284710.1| hypothetical protein CARUB_v10005968mg [Capsella rubella]
 ref|XP_006288853.1| hypothetical protein CARUB_v10002207mg [Capsella rubella]
 gb|EOA17608.1| hypothetical protein CARUB_v10005968mg [Capsella rubella]
 gb|EOA21751.1| hypothetical protein CARUB_v10002207mg [Capsella rubella]
Length=146

 Score =   271 bits (693),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P VESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPAVESVQCFGRKKTAVAVTHCKRGSGMIKLNGCPIELFQPEILRFKVFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>ref|XP_003530932.1| PREDICTED: 40S ribosomal protein S16-like [Glycine max]
Length=155

 Score =   271 bits (694),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRHRFAGV
Sbjct  16   IEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHRFAGV  75

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  76   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  135

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  136  CEPKKFGGRGARARFQKSYR  155



>sp|P46293.1|RS16_GOSHI RecName: Full=40S ribosomal protein S16 [Gossypium hirsutum]
 emb|CAA53567.1| RS16 protein, 40S subunit [Gossypium hirsutum]
Length=145

 Score =   271 bits (692),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA   +ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA EPILLLGR 
Sbjct  1    MAEKAIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV YDRTLLV
Sbjct  61   RFTGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVGYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_008795884.1| PREDICTED: 40S ribosomal protein S16 [Phoenix dactylifera]
 ref|XP_010906569.1| PREDICTED: 40S ribosomal protein S16 [Elaeis guineensis]
Length=142

 Score =   270 bits (691),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRHRFAGV
Sbjct  3    TESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRHRFAGV  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  63   DMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  123  CEPKKFGGRGARARFQKSYR  142



>ref|NP_001235533.1| uncharacterized protein LOC100527911 [Glycine max]
 gb|ACU17122.1| unknown [Glycine max]
Length=157

 Score =   271 bits (693),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = -2

Query  534  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD  355
            E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRHRFAGVD
Sbjct  19   EQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHRFAGVD  78

Query  354  MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  175
            MRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRRC
Sbjct  79   MRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  138

Query  174  EPKKFGGRGARARFQKSYR  118
            EPKKFGGRGARARFQKSYR
Sbjct  139  EPKKFGGRGARARFQKSYR  157



>ref|XP_004489248.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Cicer arietinum]
 ref|XP_004489249.1| PREDICTED: 40S ribosomal protein S16-like isoform X3 [Cicer arietinum]
Length=140

 Score =   270 bits (691),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+EPILLLGRHRFAGV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKKGRGLIKINGSPIELIEPEILRFKAYEPILLLGRHRFAGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>ref|XP_004489247.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Cicer arietinum]
Length=181

 Score =   271 bits (694),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
             + +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+EPILLLGRHRF
Sbjct  39   GSKMEQVQCFGRKKNAVAVTHCKKGRGLIKINGSPIELIEPEILRFKAYEPILLLGRHRF  98

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVAD
Sbjct  99   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVAD  158

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  159  PRRCEPKKFGGRGARARFQKSYR  181



>ref|XP_002527855.1| ribosomal protein S9, putative [Ricinus communis]
 gb|EEF34558.1| ribosomal protein S9, putative [Ricinus communis]
Length=152

 Score =   270 bits (691),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRFA V
Sbjct  13   TESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFAAV  72

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  73   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQSKKEIKDILVRYDRTLLVADPRR  132

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  133  CEPKKFGGRGARARFQKSYR  152



>ref|XP_003631001.1| 40S ribosomal protein S16 [Medicago truncatula]
 ref|XP_003631007.1| 40S ribosomal protein S16 [Medicago truncatula]
 gb|AET05477.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AET05483.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AFK47743.1| unknown [Medicago truncatula]
Length=140

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRFAGV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFAGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>ref|XP_004503325.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
 ref|XP_004503326.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
Length=140

 Score =   270 bits (690),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCK+GRGLIKING PIELI+PEILR+KA+EPILLLGRHRFAGV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKKGRGLIKINGCPIELIEPEILRFKAYEPILLLGRHRFAGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>ref|XP_006408213.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum]
 gb|ESQ49666.1| hypothetical protein EUTSA_v10021712mg [Eutrema salsugineum]
Length=146

 Score =   270 bits (690),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA+ P VESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEPILLLG+
Sbjct  1    MASKPAVESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELYQPEILRFKIFEPILLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGG+TSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGNTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_010928344.1| PREDICTED: 40S ribosomal protein S16 [Elaeis guineensis]
Length=142

 Score =   270 bits (690),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             ESVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRHRFAGV
Sbjct  3    TESVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRHRFAGV  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDIL+RYDRTLLVADPRR
Sbjct  63   DMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILIRYDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  123  CEPKKFGGRGARARFQKSYR  142



>ref|XP_001755340.1| predicted protein [Physcomitrella patens]
 ref|XP_001777866.1| predicted protein [Physcomitrella patens]
 gb|EDQ57294.1| predicted protein [Physcomitrella patens]
 gb|EDQ79820.1| predicted protein [Physcomitrella patens]
Length=144

 Score =   270 bits (689),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A P ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFEP+LLLGR +F
Sbjct  2    ATPTESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFEPVLLLGRQKF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGAR+RFQKSYR
Sbjct  122  PRRCEPKKFGGRGARSRFQKSYR  144



>sp|O22647.1|RS16_FRIAG RecName: Full=40S ribosomal protein S16 [Fritillaria agrestis]
 gb|AAB86856.1| ribosomal protein S16 [Fritillaria agrestis]
Length=145

 Score =   270 bits (689),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA    ESVQCFGRKKTAVAVTHCKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRH
Sbjct  1    MATPATESVQCFGRKKTAVAVTHCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF GVDMRIRV+GGG TSQIYAIRQSIAKALVA+YQKYVDEQ+KKE+KDIL+RYDRTLLV
Sbjct  61   RFVGVDMRIRVRGGGKTSQIYAIRQSIAKALVAYYQKYVDEQAKKEVKDILMRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARSRFQKSYR  145



>ref|XP_008788842.1| PREDICTED: 40S ribosomal protein S16-like [Phoenix dactylifera]
Length=142

 Score =   269 bits (688),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             +SVQCFGRKKTAVAVT+CKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRHRFAGV
Sbjct  3    TDSVQCFGRKKTAVAVTYCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRHRFAGV  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRV+GGG TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  63   DMRIRVRGGGKTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  123  CEPKKFGGRGARARFQKSYR  142



>ref|XP_003518703.1| PREDICTED: 40S ribosomal protein S16-like [Glycine max]
Length=156

 Score =   270 bits (689),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLG+ RFA
Sbjct  15   AALEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGKSRFA  74

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  75   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  134

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  135  RRCEPKKFGGRGARARFQKSYR  156



>ref|XP_003616020.1| 40S ribosomal protein S16 [Medicago truncatula]
 gb|AES98978.1| 30S ribosomal protein S9P [Medicago truncatula]
Length=140

 Score =   269 bits (688),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF+GV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFSGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>gb|KFK37850.1| hypothetical protein AALP_AA3G037300 [Arabis alpina]
Length=145

 Score =   269 bits (687),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA A  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FEPILLLG+H
Sbjct  1    MATAAKESVQCFGRKKTAVAVTHCKRGSGMIKLNGSPIELHQPEILRFKIFEPILLLGKH  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVDMRIRVKGGG+TSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFAGVDMRIRVKGGGNTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARSRFQKSYR  145



>gb|ACJ86025.1| unknown [Medicago truncatula]
Length=140

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRFAGV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFAGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIR KGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRAKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>ref|XP_009409231.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=145

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MAAA VESVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEILR KAFEP+LLLGR 
Sbjct  1    MAAATVESVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILRLKAFEPVLLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF GVD+RIRV+GGG TSQIYAIRQSIAKA+VAF QKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFMGVDLRIRVRGGGKTSQIYAIRQSIAKAIVAFNQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_006840429.1| hypothetical protein AMTR_s00045p00161540 [Amborella trichopoda]
 gb|ERN02104.1| hypothetical protein AMTR_s00045p00161540 [Amborella trichopoda]
Length=151

 Score =   269 bits (687),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -2

Query  561  TTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLL  382
             + MA   +ESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL+  +ILRYKA+EPIL+L
Sbjct  4    ASSMATEAIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELMSSDILRYKAYEPILVL  63

Query  381  GRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT  202
            GRHRFAGVDMRIRVKGGG TS+IYAIRQSIAKALVAFYQKYVDEQSKKEIKD+LVRYDRT
Sbjct  64   GRHRFAGVDMRIRVKGGGQTSRIYAIRQSIAKALVAFYQKYVDEQSKKEIKDLLVRYDRT  123

Query  201  LLVADPRRCEPKKFGGRGARARFQKSYR  118
            LLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  124  LLVADPRRCEPKKFGGRGARARFQKSYR  151



>ref|XP_002873890.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50149.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
Length=146

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+HRFA
Sbjct  5    AAAESVQCFGRKKTAVAVTHCKRGSGLIKLNGSPIELFQPEILRFKIFEPVLLLGKHRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKD+LVRYDRTLLVADP
Sbjct  65   GVDMRIRVKGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDVLVRYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGG GARARFQKSYR
Sbjct  125  RRCEPKKFGGPGARARFQKSYR  146



>ref|XP_007153584.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris]
 gb|ESW25578.1| hypothetical protein PHAVU_003G047800g [Phaseolus vulgaris]
Length=146

 Score =   268 bits (686),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLG+ RFAGV
Sbjct  7    LEQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGKSRFAGV  66

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  67   DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  126

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  127  CEPKKFGGRGARARFQKSYR  146



>gb|KHN21629.1| 40S ribosomal protein S16 [Glycine soja]
Length=157

 Score =   269 bits (687),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = -2

Query  534  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD  355
            E VQCFGRKKTAVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLGRHRFAGVD
Sbjct  19   EQVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHRFAGVD  78

Query  354  MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  175
            MRIRVKGGGHTSQIYAIRQSIAK LVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRRC
Sbjct  79   MRIRVKGGGHTSQIYAIRQSIAKHLVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  138

Query  174  EPKKFGGRGARARFQKSYR  118
            EPKKFGGRGARARFQKSYR
Sbjct  139  EPKKFGGRGARARFQKSYR  157



>gb|AFK46930.1| unknown [Medicago truncatula]
Length=140

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRK+ AVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHRF+GV
Sbjct  1    MEQVQCFGRKRNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFSGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>ref|XP_001775963.1| predicted protein [Physcomitrella patens]
 gb|EDQ59155.1| predicted protein [Physcomitrella patens]
Length=143

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A VESVQCFGRKKTAVAVT+CK+G GLIKING PIEL++PEILRYKAFEP+LLLGRH+FA
Sbjct  2    AAVESVQCFGRKKTAVAVTYCKKGLGLIKINGCPIELVEPEILRYKAFEPVLLLGRHKFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVADP
Sbjct  62   GVDMRIRVKGGGHTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGAR+RFQKSYR
Sbjct  122  RRCEPKKFGGRGARSRFQKSYR  143



>ref|XP_001777696.1| predicted protein [Physcomitrella patens]
 gb|EDQ57476.1| predicted protein [Physcomitrella patens]
Length=144

 Score =   268 bits (684),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A+  ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFEP+LLLGR +F
Sbjct  2    ASTTESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFEPVLLLGRQKF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRVKGGGHTSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVAD
Sbjct  62   AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGAR+RFQKSYR
Sbjct  122  PRRCEPKKFGGRGARSRFQKSYR  144



>ref|XP_009390916.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=149

 Score =   267 bits (683),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A APVESVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEILR KAFEPILLLGR R
Sbjct  6    ATAPVESVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILRLKAFEPILLLGRQR  65

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            F GVD+RIRV+GGG TSQIYAIRQSIAKALVA++QK+VDEQSKKEIKDILVRYDRTLLVA
Sbjct  66   FMGVDIRIRVRGGGKTSQIYAIRQSIAKALVAYHQKFVDEQSKKEIKDILVRYDRTLLVA  125

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  126  DPRRCEPKKFGGRGARARFQKSYR  149



>ref|XP_004505244.1| PREDICTED: 40S ribosomal protein S16-like [Cicer arietinum]
Length=143

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIELI+PEILR+KAFEPILLLG+ RFAGV
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELIEPEILRFKAFEPILLLGKSRFAGV  63

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  64   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  123

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  124  CEPKKFGGRGARARFQKSYR  143



>gb|ACJ85555.1| unknown [Medicago truncatula]
Length=140

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILL GRHRF+GV
Sbjct  1    MEQVQCFGRKKNAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLHGRHRFSGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  121  CEPKKFGGRGARARFQKSYR  140



>gb|KFK26075.1| hypothetical protein AALP_AA8G199800 [Arabis alpina]
Length=146

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  534  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD  355
            ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL+QPEILR+K FEP+ LLG+HRFAGVD
Sbjct  8    ESVQCFGRKKTAVAVTHCKRGTGMIKLNGSPIELLQPEILRFKVFEPVYLLGKHRFAGVD  67

Query  354  MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  175
            MRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC
Sbjct  68   MRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  127

Query  174  EPKKFGGRGARARFQKSYR  118
            EPKKFGGRGAR+RFQKSYR
Sbjct  128  EPKKFGGRGARSRFQKSYR  146



>ref|XP_001780940.1| predicted protein [Physcomitrella patens]
 gb|EDQ54278.1| predicted protein [Physcomitrella patens]
Length=144

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A   ESVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILRYKAFEPILLLGR +F
Sbjct  2    ATATESVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRYKAFEPILLLGRQKF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            +GVDMRIRVKGGGHTSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVAD
Sbjct  62   SGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGAR+RFQKSYR
Sbjct  122  PRRCEPKKFGGRGARSRFQKSYR  144



>ref|XP_003607926.1| 40S ribosomal protein S16-1 [Medicago truncatula]
 gb|AES90123.1| 30S ribosomal protein S9P [Medicago truncatula]
 gb|AFK45246.1| unknown [Medicago truncatula]
 gb|AFK48830.1| unknown [Medicago truncatula]
Length=143

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLG+HRFAGV
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELVEPEILRFKAFEPILLLGKHRFAGV  63

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRV GGGHT+QIYAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRR
Sbjct  64   DMRIRVNGGGHTAQIYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  123

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  124  CEPKKFGGRGARARFQKSYR  143



>ref|XP_006298754.1| hypothetical protein CARUB_v10014854mg [Capsella rubella]
 gb|EOA31652.1| hypothetical protein CARUB_v10014854mg [Capsella rubella]
Length=146

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILRYK FEPILLLG+
Sbjct  1    MATQPAKESVQCFGRKKTAVAVTHCKRGTGMIKLNGSPIELHQPEILRYKIFEPILLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGG+TSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGNTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>ref|NP_178826.1| 40S ribosomal protein S16-1 [Arabidopsis thaliana]
 sp|Q9SK22.1|RS161_ARATH RecName: Full=40S ribosomal protein S16-1 [Arabidopsis thaliana]
 gb|AAK49582.1|AF370576_1 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAD22696.1| 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAM63947.1| 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AEC06138.1| 40S ribosomal protein S16-1 [Arabidopsis thaliana]
Length=146

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEPILLLG+
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPILLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGV+MRIRV GGGHTSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+R+QKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRYQKSYR  146



>ref|XP_010413003.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010413060.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X2 [Camelina 
sativa]
 ref|XP_010463899.1| PREDICTED: 40S ribosomal protein S16-1 [Camelina sativa]
 ref|XP_010485793.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010485794.1| PREDICTED: 40S ribosomal protein S16-1-like isoform X2 [Camelina 
sativa]
Length=146

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEPILLLG+
Sbjct  1    MATQPAKESVQCFGRKKTAVAVTHCKRGTGLIKLNGSPIELHQPEILRFKIFEPILLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGG+TSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGNTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARARFQKSYR  146



>ref|XP_006856488.1| hypothetical protein AMTR_s00046p00076360 [Amborella trichopoda]
 gb|ERN17955.1| hypothetical protein AMTR_s00046p00076360 [Amborella trichopoda]
Length=148

 Score =   266 bits (679),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A   VESVQCFGRKKTAVAVT+CKRGRGLIKING PIEL+  +ILRYKA+EPIL+LGRHR
Sbjct  5    AVQAVESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELMSSDILRYKAYEPILVLGRHR  64

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVDMRIRVKGGG TS+IYAIRQSIAKALVAFYQKYVDEQSKKEIKD+LVRYDRTLLVA
Sbjct  65   FAGVDMRIRVKGGGQTSRIYAIRQSIAKALVAFYQKYVDEQSKKEIKDLLVRYDRTLLVA  124

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGGRGARARFQKSYR
Sbjct  125  DPRRCEPKKFGGRGARARFQKSYR  148



>ref|NP_197339.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
 sp|Q42340.1|RS163_ARATH RecName: Full=40S ribosomal protein S16-3 [Arabidopsis thaliana]
 gb|AAK43993.1|AF370178_1 putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAL15244.1| putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AED92546.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
Length=146

 Score =   266 bits (679),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGV+MRIRV GGGHTSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+R+QKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRYQKSYR  146



>ref|XP_010694150.1| PREDICTED: 40S ribosomal protein S16-like [Beta vulgaris subsp. 
vulgaris]
Length=147

 Score =   265 bits (678),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = -2

Query  552  MAAAP--VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLG  379
            MAA P  + SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FEPILLLG
Sbjct  1    MAATPPPIHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFEPILLLG  60

Query  378  RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL  199
            R +F GVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQ KKEIKDILVRYDRTL
Sbjct  61   RSKFNGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQQKKEIKDILVRYDRTL  120

Query  198  LVADPRRCEPKKFGGRGARARFQKSYR  118
            LVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  LVADPRRCEPKKFGGRGARARFQKSYR  147



>gb|ABW89384.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89385.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89386.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89387.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89388.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89389.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89390.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89391.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89392.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89393.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89394.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89395.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89396.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89397.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89398.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89399.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89400.1| 40S ribosomal protein S16, partial [Helianthus annuus]
 gb|ABW89402.1| 40S ribosomal protein S16, partial [Helianthus annuus]
Length=135

 Score =   265 bits (676),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -2

Query  522  CFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIR  343
            CFGRKKTAVAVTHCK GRGLIKINGVPIEL+QPEILRYKAFEPILLLGRH+FAGVDMRIR
Sbjct  1    CFGRKKTAVAVTHCKAGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHKFAGVDMRIR  60

Query  342  VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK  163
            VKGGGHTSQIYAIRQSI+KALVA+YQK+VDE+SKKEIKDILVRYDRTLLVADPRRCEPKK
Sbjct  61   VKGGGHTSQIYAIRQSISKALVAYYQKFVDEESKKEIKDILVRYDRTLLVADPRRCEPKK  120

Query  162  FGGRGARARFQKSYR  118
            FGGRGARARFQKSYR
Sbjct  121  FGGRGARARFQKSYR  135



>emb|CDY29988.1| BnaC01g40200D [Brassica napus]
Length=146

 Score =   265 bits (677),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATKPANESVQCFGRKKTAVAVTHCKRGCGMIKLNGSPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVGGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>gb|AFK36270.1| unknown [Lotus japonicus]
Length=140

 Score =   264 bits (674),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVT+CKRGRGLIKI+G PIELI+PEILR+KAFEPILLLG+ RFAGV
Sbjct  1    MEQVQCFGRKKNAVAVTYCKRGRGLIKIDGSPIELIEPEILRFKAFEPILLLGKSRFAGV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDIL+RYDRTLLVADPRR
Sbjct  61   DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILIRYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGAR+RFQKSYR
Sbjct  121  CEPKKFGGRGARSRFQKSYR  140



>gb|ACJ85531.1| unknown [Medicago truncatula]
Length=143

 Score =   263 bits (671),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E VQCFGRKK AVAVT+CKRGRGLIKING PIEL++PEILR+KAFEPILLLG+HRFAGV
Sbjct  4    LEQVQCFGRKKNAVAVTYCKRGRGLIKINGAPIELVEPEILRFKAFEPILLLGKHRFAGV  63

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRV GGGHT+QIYAIRQSIA+ALVA+YQKYVDE+SKKEIKDILVRYDRTLLVADPRR
Sbjct  64   DMRIRVNGGGHTAQIYAIRQSIAEALVAYYQKYVDERSKKEIKDILVRYDRTLLVADPRR  123

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  124  CEPKKFGGRGARARFQKSYR  143



>emb|CDY21134.1| BnaA01g33650D [Brassica napus]
Length=146

 Score =   263 bits (671),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  +SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGLIKLNGSPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>ref|XP_010689120.1| PREDICTED: 40S ribosomal protein S16-like [Beta vulgaris subsp. 
vulgaris]
Length=149

 Score =   263 bits (671),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            V SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FEPILLLGR +F GV
Sbjct  10   VHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFEPILLLGRSKFNGV  69

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQ KKEIKDILVRYDRTLLVADPRR
Sbjct  70   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQQKKEIKDILVRYDRTLLVADPRR  129

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  130  CEPKKFGGRGARARFQKSYR  149



>ref|XP_010695861.1| PREDICTED: 40S ribosomal protein S16 [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   263 bits (671),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            V SVQCFGRKKTAVAVT+CK GRGLIKING PIEL+QPEILRYK FEPILLLGR +F GV
Sbjct  10   VHSVQCFGRKKTAVAVTYCKTGRGLIKINGTPIELVQPEILRYKVFEPILLLGRSKFNGV  69

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            DMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQ KKEIKDILVRYDRTLLVADPRR
Sbjct  70   DMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQQKKEIKDILVRYDRTLLVADPRR  129

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  130  CEPKKFGGRGARARFQKSYR  149



>emb|CDX92061.1| BnaC03g33630D [Brassica napus]
Length=146

 Score =   262 bits (670),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  534  ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD  355
            ESVQCFGRKKTAVAVTHC+RG GLIK+NG PIEL  PEILR+K FEP+LLLG+HRFAGVD
Sbjct  8    ESVQCFGRKKTAVAVTHCRRGCGLIKLNGCPIELFNPEILRFKIFEPVLLLGKHRFAGVD  67

Query  354  MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC  175
            MRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLLVADPRRC
Sbjct  68   MRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLLVADPRRC  127

Query  174  EPKKFGGRGARARFQKSYR  118
            EPKKFGGRGAR+RFQKSYR
Sbjct  128  EPKKFGGRGARSRFQKSYR  146



>ref|XP_009393541.1| PREDICTED: 40S ribosomal protein S16-like [Musa acuminata subsp. 
malaccensis]
Length=145

 Score =   262 bits (670),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA A V+SVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEIL  KAFEPILLLGR 
Sbjct  1    MATAAVDSVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILGLKAFEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF  VD+RIRV+GGG TSQIYAIRQSIAKALVAF+QKYVDEQSKKEIKDILVRYDRTLLV
Sbjct  61   RFMDVDIRIRVRGGGKTSQIYAIRQSIAKALVAFHQKYVDEQSKKEIKDILVRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_009125004.1| PREDICTED: 40S ribosomal protein S16-3 [Brassica rapa]
 emb|CDY42912.1| BnaC05g47390D [Brassica napus]
Length=146

 Score =   262 bits (669),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>emb|CDY49352.1| BnaA05g33140D [Brassica napus]
Length=146

 Score =   262 bits (669),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K +EP+LLLG+
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFQPEILRFKIYEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>ref|XP_009390299.1| PREDICTED: 40S ribosomal protein S16 [Musa acuminata subsp. malaccensis]
Length=145

 Score =   261 bits (668),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA A VESVQCFGRKKTAVAV HCK GRGLIK+NGVPIEL++PEILR KAFEPILLLGR 
Sbjct  1    MATAAVESVQCFGRKKTAVAVAHCKGGRGLIKVNGVPIELVKPEILRLKAFEPILLLGRQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF GVD+RIRV+GGG TSQIYAIRQSIAKALVA++QKYVDEQSKKEIKDIL RYDRTLLV
Sbjct  61   RFMGVDIRIRVRGGGKTSQIYAIRQSIAKALVAYHQKYVDEQSKKEIKDILGRYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGRGARARFQKSYR  145



>ref|XP_009404058.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=146

 Score =   261 bits (666),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A  +SVQCFGRKKTAVAV HCKRGRGLIK+NGVPIEL++PEIL  KAFEPILLLGR RFA
Sbjct  5    AATDSVQCFGRKKTAVAVAHCKRGRGLIKVNGVPIELVKPEILCLKAFEPILLLGRQRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+RIRV+GGG TSQIYAIRQSIAKALVAF+QKYVDEQSKKEIKDILVRYDRTLLVADP
Sbjct  65   GVDIRIRVRGGGKTSQIYAIRQSIAKALVAFHQKYVDEQSKKEIKDILVRYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGARARFQKSYR
Sbjct  125  RRCEPKKFGGRGARARFQKSYR  146



>ref|XP_009131657.1| PREDICTED: 40S ribosomal protein S16-3-like isoform X1 [Brassica 
rapa]
 ref|XP_009131658.1| PREDICTED: 40S ribosomal protein S16-3-like isoform X2 [Brassica 
rapa]
 emb|CDY51232.1| BnaA03g07060D [Brassica napus]
 emb|CDX70812.1| BnaC03g08960D [Brassica napus]
Length=146

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL  PEILR+K FEP+LLLG+HRFA
Sbjct  5    AAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELFNPEILRFKIFEPVLLLGKHRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLLVADP
Sbjct  65   GVDMRIRVKGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGAR+RFQKSYR
Sbjct  125  RRCEPKKFGGRGARSRFQKSYR  146



>ref|XP_009124006.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score =   260 bits (664),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  +SVQCFGRKKTAVAVTHCK G G+IK+NG PIEL QPEILR+K +EP+LLLG+
Sbjct  1    MATKPAKQSVQCFGRKKTAVAVTHCKPGCGMIKLNGSPIELSQPEILRFKIYEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRVKGGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVKGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPK+FGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKRFGGRGARSRFQKSYR  146



>ref|XP_002884433.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60692.1| 40S ribosomal protein S16 [Arabidopsis lyrata subsp. lyrata]
Length=146

 Score =   260 bits (664),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 137/146 (94%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA+ P  ESVQCFGRKKTAVAVTHCKRG G+IK+NG PIEL QPEILR+K  EPILLLG+
Sbjct  1    MASQPAKESVQCFGRKKTAVAVTHCKRGSGMIKLNGSPIELHQPEILRFKILEPILLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV+GGG+TSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVDMRIRVEGGGNTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCE KKFGG+GAR+RFQKSYR
Sbjct  121  VADPRRCESKKFGGKGARSRFQKSYR  146



>emb|CDY25423.1| BnaC09g39380D [Brassica napus]
Length=146

 Score =   259 bits (663),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG G IK+NG PIEL  PEILR+K FEP+LLLG+
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGQIKLNGCPIELFNPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            +RFAGVDMRIRV GGGHTSQ+YAIRQSI+KALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   NRFAGVDMRIRVNGGGHTSQVYAIRQSISKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>ref|XP_009134755.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL  PEILR+K FEP+LLLG+HRFAGVDM
Sbjct  9    SVQCFGRKKTAVAVTHCKPGCGLIKLNGSPIELFNPEILRFKIFEPVLLLGKHRFAGVDM  68

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLLVADPRRCE
Sbjct  69   RIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLLVADPRRCE  128

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGAR+RFQKSYR
Sbjct  129  PKKFGGRGARSRFQKSYR  146



>emb|CDY70652.1| BnaA03g57330D [Brassica napus]
Length=146

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            SVQCFGRKKTAVAVTHCK G GLIK+NG PIEL  PEILR+K FEP+LLLG+HRFAGVDM
Sbjct  9    SVQCFGRKKTAVAVTHCKPGCGLIKLNGCPIELFNPEILRFKIFEPVLLLGKHRFAGVDM  68

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV GGGHTSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLLVADPRRCE
Sbjct  69   RIRVNGGGHTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLLVADPRRCE  128

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGAR+RFQKSYR
Sbjct  129  PKKFGGRGARSRFQKSYR  146



>ref|XP_009120979.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=146

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG G I +NG PIEL  PEILR+K FEP+LLLG+
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGQIMLNGCPIELFNPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIRV GGG+TSQ+YAIRQSIAKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRVNGGGNTSQVYAIRQSIAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  VADPRRCEPKKFGGRGARSRFQKSYR  146



>sp|Q9XEK7.1|RS16_TORRU RecName: Full=40S ribosomal protein S16 [Syntrichia ruralis]
 gb|AAD23965.1|AF108725_1 ribosomal protein S16 [Syntrichia ruralis]
Length=142

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 138/142 (97%), Gaps = 1/142 (1%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A VESVQCFGRKKTAVAVT+C+RGRGLI++  VPIEL++PEILRYKAFEP+LLLGR +FA
Sbjct  2    AAVESVQCFGRKKTAVAVTYCRRGRGLIRLT-VPIELVEPEILRYKAFEPVLLLGRSKFA  60

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVDMRIRVKGGG+TSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVADP
Sbjct  61   GVDMRIRVKGGGNTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVADP  120

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGGRGAR+RFQKSYR
Sbjct  121  RRCEPKKFGGRGARSRFQKSYR  142



>ref|XP_002994222.1| hypothetical protein SELMODRAFT_138369 [Selaginella moellendorffii]
 gb|EFJ04727.1| hypothetical protein SELMODRAFT_138369 [Selaginella moellendorffii]
Length=144

 Score =   256 bits (654),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            AA ++SVQCFGRKKTAVAVT+CK+GRGLIKING PIEL++PEILR+KA EPILLLGR RF
Sbjct  2    AAAIQSVQCFGRKKTAVAVTYCKKGRGLIKINGCPIELVEPEILRFKAVEPILLLGRERF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            AGVDMRIRV+GGGHTSQIYAIRQSIAKALVAF QK+VDE +KKEIKD LV YDRTLLVAD
Sbjct  62   AGVDMRIRVRGGGHTSQIYAIRQSIAKALVAFTQKFVDEHAKKEIKDRLVSYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGGRGARARFQKSYR
Sbjct  122  PRRCEPKKFGGRGARARFQKSYR  144



>gb|ABW89401.1| 40S ribosomal protein S16, partial [Helianthus annuus]
Length=129

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/129 (95%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = -2

Query  504  TAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGH  325
            TAVAVTHCK GRGLIKINGVPIEL+QPEILRYKAFEPILLLGRH+FAGVDMRIRVKGGGH
Sbjct  1    TAVAVTHCKAGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHKFAGVDMRIRVKGGGH  60

Query  324  TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA  145
            TSQIYAIRQSI+KALVA+YQK+VDE+SKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA
Sbjct  61   TSQIYAIRQSISKALVAYYQKFVDEESKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA  120

Query  144  RARFQKSYR  118
            RARFQKSYR
Sbjct  121  RARFQKSYR  129



>ref|NP_187073.1| 40S ribosomal protein S16-2 [Arabidopsis thaliana]
 sp|Q9M8X9.1|RS162_ARATH RecName: Full=40S ribosomal protein S16-2 [Arabidopsis thaliana]
 gb|AAF26790.1|AC016829_14 putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AAO44026.1| At3g04230 [Arabidopsis thaliana]
 dbj|BAF00141.1| putative 40S ribosomal protein S16 [Arabidopsis thaliana]
 gb|AEE74055.1| 40S ribosomal protein S16-2 [Arabidopsis thaliana]
Length=146

 Score =   252 bits (643),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTA AVT+CKRG G+IK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPAKESVQCFGRKKTATAVTYCKRGSGMIKLNGSPIELYQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGVDMRIR  GGG+TS++YAIRQSIAKALVA+YQKYVDEQSKKEIKDIL+RYDRTLL
Sbjct  61   HRFAGVDMRIRATGGGNTSRVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILMRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADPRRCE KKFGG GARARFQKSYR
Sbjct  121  VADPRRCESKKFGGPGARARFQKSYR  146



>ref|XP_009107873.1| PREDICTED: 40S ribosomal protein S16-3-like [Brassica rapa]
Length=176

 Score =   248 bits (633),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL  PEILR+K FEP+LLLG+
Sbjct  30   MATKPAAESVQCFGRKKTAVAVTHCKRGCGLIKLNGCPIELFNPEILRFKIFEPVLLLGK  89

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFA VDMRIRVKGGGHTSQ+Y IRQS+AKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  90   HRFASVDMRIRVKGGGHTSQVYTIRQSLAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  149

Query  195  VADPRRCEPKKFGGRGARARFQK  127
            VADP RCEPKKFGGRG   R+ +
Sbjct  150  VADPMRCEPKKFGGRGTNGRWNE  172



>emb|CDY24915.1| BnaC03g22570D [Brassica napus]
Length=147

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = -2

Query  552  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL  PEILR+K FEP+LLLG+
Sbjct  1    MATKPAAESVQCFGRKKTAVAVTHCKRGCGLIKLNGCPIELFNPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFA VDMRIRVKGGGHTSQ+Y IRQS+AKALVAFYQKYVDEQSKKE+KDIL+RYDRTLL
Sbjct  61   HRFASVDMRIRVKGGGHTSQVYTIRQSLAKALVAFYQKYVDEQSKKEVKDILIRYDRTLL  120

Query  195  VADPRRCEPKKFGGRGARARFQK  127
            VADP RCEPKKFGGRG   R+ +
Sbjct  121  VADPMRCEPKKFGGRGTNGRWNE  143



>ref|NP_001065632.1| Os11g0127900 [Oryza sativa Japonica Group]
 ref|NP_001066039.1| Os12g0124200 [Oryza sativa Japonica Group]
 sp|Q0IQF7.1|RS16_ORYSJ RecName: Full=40S ribosomal protein S16 [Oryza sativa Japonica 
Group]
 sp|A2ZB00.1|RS16_ORYSI RecName: Full=40S ribosomal protein S16 [Oryza sativa Indica 
Group]
 pdb|3J60|Q Chain Q, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|ABA91285.1| 40S ribosomal protein S16, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABA95713.1| 40S ribosomal protein S16, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27477.1| Os11g0127900 [Oryza sativa Japonica Group]
 dbj|BAF29058.1| Os12g0124200 [Oryza sativa Japonica Group]
 gb|EAY79784.1| hypothetical protein OsI_34940 [Oryza sativa Indica Group]
 gb|EAY82113.1| hypothetical protein OsI_37311 [Oryza sativa Indica Group]
 gb|EAZ17271.1| hypothetical protein OsJ_32790 [Oryza sativa Japonica Group]
 dbj|BAG86780.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87028.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00522.1| unnamed protein product [Oryza sativa Japonica Group]
Length=149

 Score =   245 bits (625),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 133/149 (89%), Gaps = 4/149 (3%)
 Frame = -2

Query  552  MAAA----PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILL  385
            MAAA    P  +VQCFGRKKTAVAV++CK GRGLIK+NGVPIELI+PE+LR KAFEPILL
Sbjct  1    MAAALTRPPPGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPILL  60

Query  384  LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR  205
             GR RF  +DMRIRV+GGG TSQIYAIRQ+IAKALVA+YQKYVDE SKKE+KDI  RYDR
Sbjct  61   AGRSRFKDIDMRIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEASKKEVKDIFARYDR  120

Query  204  TLLVADPRRCEPKKFGGRGARARFQKSYR  118
            TLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  121  TLLVADPRRCEPKKFGGRGARARFQKSYR  149



>gb|AAR87752.1| small subunit ribosomal protein S16 [Capsicum annuum]
Length=123

 Score =   241 bits (616),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 121/122 (99%), Gaps = 0/122 (0%)
 Frame = -2

Query  483  CKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI  304
            CKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI
Sbjct  2    CKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI  61

Query  303  RQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKS  124
            RQSIAKALVAFYQK+VDEQ KKEIKDIL+RYDRTLLVADPRRCEPKKFGGRGAR+RFQKS
Sbjct  62   RQSIAKALVAFYQKFVDEQQKKEIKDILIRYDRTLLVADPRRCEPKKFGGRGARSRFQKS  121

Query  123  YR  118
            YR
Sbjct  122  YR  123



>ref|XP_006662696.1| PREDICTED: 40S ribosomal protein S16-like, partial [Oryza brachyantha]
Length=141

 Score =   241 bits (616),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            P  +VQCFGRKKTAVAV++CK GRGLIK+NGVPIELI+PE+LR KAFEPI+L GR+RF  
Sbjct  1    PAGTVQCFGRKKTAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPIMLAGRNRFKD  60

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            +DMRIRV+GGG TSQIYAIRQ+IAKALVA+ QKYVDE SKKE+KDI  RYDRTLLVADPR
Sbjct  61   IDMRIRVRGGGKTSQIYAIRQAIAKALVAYNQKYVDEASKKEVKDIFARYDRTLLVADPR  120

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCEPKKFGGRGARARFQKSYR
Sbjct  121  RCEPKKFGGRGARARFQKSYR  141



>ref|XP_010252415.1| PREDICTED: 40S ribosomal protein S16-like [Nelumbo nucifera]
Length=138

 Score =   240 bits (612),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  516  GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK  337
            G KKT VAVTH KRGRGLIKING PIEL++ EIL YKAFEPILLLGRHRF+ VDMRIRV+
Sbjct  6    GEKKTVVAVTHYKRGRGLIKINGCPIELVESEILCYKAFEPILLLGRHRFSDVDMRIRVR  65

Query  336  GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG  157
            GGGHTSQIYAIRQSIAKALV +YQKYVD+QSKKEIKDILVRYDRTLLVADPRRCEPKKFG
Sbjct  66   GGGHTSQIYAIRQSIAKALVVYYQKYVDKQSKKEIKDILVRYDRTLLVADPRRCEPKKFG  125

Query  156  GRGARARFQKSYR  118
            GRGARARF+KSYR
Sbjct  126  GRGARARFEKSYR  138



>ref|XP_009404059.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=132

 Score =   239 bits (611),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  504  TAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGH  325
            TAVAV HCKRGRGLIK+NGVPIEL++PEIL  KAFEPILLLGR RFAGVD+RIRV+GGG 
Sbjct  4    TAVAVAHCKRGRGLIKVNGVPIELVKPEILCLKAFEPILLLGRQRFAGVDIRIRVRGGGK  63

Query  324  TSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA  145
            TSQIYAIRQSIAKALVAF+QKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA
Sbjct  64   TSQIYAIRQSIAKALVAFHQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA  123

Query  144  RARFQKSYR  118
            RARFQKSYR
Sbjct  124  RARFQKSYR  132



>gb|AAA33916.1| ribosomal protein S16 [Oryza sativa Indica Group]
 prf||2111468A ribosomal protein S16
Length=149

 Score =   239 bits (611),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 131/149 (88%), Gaps = 4/149 (3%)
 Frame = -2

Query  552  MAAA----PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILL  385
            MAAA    P  +VQCFGRKK AVAV++CK GRGLIK+NGVPIELI+PE+LR KAFEPILL
Sbjct  1    MAAALTRPPPGTVQCFGRKKAAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPILL  60

Query  384  LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR  205
             GR RF  +DMRIRV+GGG TSQIYAIRQ+IAKALVA+YQKYVDE SKKE+KDI  RYDR
Sbjct  61   AGRSRFKDIDMRIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEASKKEVKDIFARYDR  120

Query  204  TLLVADPRRCEPKKFGGRGARARFQKSYR  118
            TLLVADPRRCEPKKFGGR ARARFQKSYR
Sbjct  121  TLLVADPRRCEPKKFGGRRARARFQKSYR  149



>gb|EXX61063.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61064.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61065.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX61066.1| ribosomal 40S subunit protein S16A [Rhizophagus irregularis DAOM 
197198w]
Length=142

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             ESVQ +GRKKTA AV HCKRG+GLIKING PI L++PEILR+K +EPIL+LG+ +FAGV
Sbjct  3    TESVQTYGRKKTATAVAHCKRGKGLIKINGSPIHLVEPEILRFKVYEPILILGQEKFAGV  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+R+RVKGGGHTSQ+YAIRQ+IAKA+VAFYQKYVDE  KKEIKD L+ YDR+LLVADPRR
Sbjct  63   DIRVRVKGGGHTSQVYAIRQAIAKAIVAFYQKYVDEAQKKEIKDTLIHYDRSLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGG GARAR+QKSYR
Sbjct  123  CEPKKFGGPGARARYQKSYR  142



>ref|XP_002500989.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62247.1| predicted protein [Micromonas sp. RCC299]
Length=142

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             +SVQ FGRKKTAVAV HCK G+GLI+ NG PIELIQPE L++KA EPI+LLGR RFA +
Sbjct  3    TQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKFKAMEPIILLGRQRFANL  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGH SQ+YA+RQ+IAKA+VA+YQKYVDEQSKKE+KD L+ YDRTLLVADPRR
Sbjct  63   DLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKELKDALLTYDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
             EPKKFGGRGARARFQKSYR
Sbjct  123  MEPKKFGGRGARARFQKSYR  142



>ref|NP_001134097.1| 40S ribosomal protein S16 [Salmo salar]
 gb|ACH70747.1| ribosomal protein S16 [Salmo salar]
 gb|ACN11417.1| 40S ribosomal protein S16 [Salmo salar]
Length=146

 Score =   238 bits (606),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDESSKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AFK11567.1| Rps16 protein [Callorhinchus milii]
Length=165

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -2

Query  588  FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  409
            F    R++R T  A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+Y
Sbjct  9    FAVGEREQRRTMPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQY  68

Query  408  KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIK  229
            K  EP+LLLG+ RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIK
Sbjct  69   KLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIK  128

Query  228  DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            DIL++YDRTLLVADPRRCE KKFGG GARAR+QKSYR
Sbjct  129  DILIQYDRTLLVADPRRCEAKKFGGPGARARYQKSYR  165



>ref|XP_007232866.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Astyanax 
mexicanus]
 ref|XP_007232867.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Astyanax 
mexicanus]
Length=146

 Score =   237 bits (605),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+IQP  L+YK  EPILLLG+ R
Sbjct  3    AKGPIQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIQPATLQYKLLEPILLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+RIRVKGGGH +Q+YAIRQ+I+KALVA+YQK+VDE SKKEIKDILV+YDRTLLVA
Sbjct  63   FAGVDIRIRVKGGGHVAQVYAIRQAISKALVAYYQKFVDEASKKEIKDILVQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_003056886.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58531.1| predicted protein [Micromonas pusilla CCMP1545]
Length=142

 Score =   237 bits (605),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             +SVQ FGRKKTAVAV HCK G+G+IK NG PIELIQPE LR KA EP+LLLG+ RFA +
Sbjct  3    TQSVQTFGRKKTAVAVVHCKAGKGIIKFNGAPIELIQPETLRIKAMEPVLLLGKQRFANL  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGH SQ+YA+RQ+IAKA+VA+YQKYVDEQSKKE+KD L+ YDRTLLVADPRR
Sbjct  63   DLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKELKDALLTYDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
             EPKKFGGRGARARFQKSYR
Sbjct  123  MEPKKFGGRGARARFQKSYR  142



>ref|XP_010885525.1| PREDICTED: 40S ribosomal protein S16 [Esox lucius]
 gb|ACN10073.1| 40S ribosomal protein S16 [Salmo salar]
 gb|ACN12420.1| 40S ribosomal protein S16 [Salmo salar]
 gb|ACO08056.1| 40S ribosomal protein S16 [Oncorhynchus mykiss]
 gb|ACO08152.1| 40S ribosomal protein S16 [Oncorhynchus mykiss]
 gb|ACO14024.1| 40S ribosomal protein S16 [Esox lucius]
 emb|CDQ73016.1| unnamed protein product [Oncorhynchus mykiss]
Length=146

 Score =   237 bits (604),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_007010573.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
 gb|EOY19383.1| Ribosomal protein S5 domain 2-like superfamily protein [Theobroma 
cacao]
Length=149

 Score =   237 bits (605),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  555  RMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            R+  A +ESVQC   KKTA  VT+C R  GLIKING  IEL++PEIL +KA EPILLLGR
Sbjct  4    RVEKASIESVQCCSHKKTAEVVTYCNRASGLIKINGCAIELVEPEILHFKAVEPILLLGR  63

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
             RFAGV+MRIRVKG GH SQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  64   QRFAGVNMRIRVKGNGHISQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  123

Query  195  VADPRRCEPKKFGGRGARARFQKSYR  118
            VADP+R EPKKFGGRGARARFQ  YR
Sbjct  124  VADPKRYEPKKFGGRGARARFQNRYR  149



>gb|KFO64775.1| 40S ribosomal protein S16, partial [Corvus brachyrhynchos]
Length=154

 Score =   237 bits (604),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = -2

Query  561  TTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLL  382
            T   A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLL
Sbjct  7    TAMPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLL  66

Query  381  GRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT  202
            G+ RFAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRT
Sbjct  67   GKERFAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRT  126

Query  201  LLVADPRRCEPKKFGGRGARARFQKSYR  118
            LLVADPRRCE KKFGG GARAR+QKSYR
Sbjct  127  LLVADPRRCESKKFGGPGARARYQKSYR  154



>ref|XP_003221173.1| PREDICTED: 40S ribosomal protein S16 [Anolis carolinensis]
 ref|XP_004271348.1| PREDICTED: 40S ribosomal protein S16 isoform 1 [Orcinus orca]
 ref|XP_004319947.1| PREDICTED: 40S ribosomal protein S16 isoform 2 [Tursiops truncatus]
 ref|XP_005308552.1| PREDICTED: 40S ribosomal protein S16 [Chrysemys picta bellii]
 ref|XP_005350229.1| PREDICTED: 40S ribosomal protein S16-like [Microtus ochrogaster]
 ref|XP_005371345.1| PREDICTED: 40S ribosomal protein S16 [Microtus ochrogaster]
 ref|XP_005336474.1| PREDICTED: 40S ribosomal protein S16 [Ictidomys tridecemlineatus]
 ref|XP_006118546.1| PREDICTED: 40S ribosomal protein S16-like [Pelodiscus sinensis]
 ref|XP_007422327.1| PREDICTED: 40S ribosomal protein S16-like [Python bivittatus]
 ref|XP_008852184.1| PREDICTED: 40S ribosomal protein S16 [Nannospalax galili]
 gb|ETE65562.1| 40S ribosomal protein S16 [Ophiophagus hannah]
Length=146

 Score =   236 bits (603),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|ACR24967.1| ribosomal protein S16 [Lepidochitona cinerea]
Length=152

 Score =   236 bits (603),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ +GRKKTA AV HCKRG GLIK+NG P++L++P+ILRYK  EP+LLLG+ RFA
Sbjct  11   GPLQSVQLYGRKKTATAVAHCKRGNGLIKVNGRPLDLLEPQILRYKLQEPLLLLGKERFA  70

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDR+LLVADP
Sbjct  71   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRSLLVADP  130

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGG GARAR+QKSYR
Sbjct  131  RRCEPKKFGGPGARARYQKSYR  152



>gb|ACM08724.1| 40S ribosomal protein S16 [Salmo salar]
Length=146

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI++ALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISEALVAYYQKYVDESSKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_003915560.1| PREDICTED: 40S ribosomal protein S16 [Papio anubis]
Length=150

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFA
Sbjct  9    GPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFA  68

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADP
Sbjct  69   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADP  128

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCE KKFGG GARAR+QKSYR
Sbjct  129  RRCESKKFGGPGARARYQKSYR  150



>ref|XP_006064132.1| PREDICTED: 40S ribosomal protein S16-like [Bubalus bubalis]
Length=168

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct  28   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG  87

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct  88   VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR  147

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCE KKFGG GARAR+QKSYR
Sbjct  148  RCESKKFGGPGARARYQKSYR  168



>gb|ACG26490.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG29547.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG32405.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG35014.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG41061.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG48541.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACN25584.1| unknown [Zea mays]
 tpg|DAA59219.1| TPA: 40S ribosomal protein S16 [Zea mays]
Length=149

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEVKDIFTRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>gb|AAX29081.1| ribosomal protein S16 [synthetic construct]
Length=147

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_008608456.1| 40S ribosomal protein S16 [Saprolegnia diclina VS20]
 gb|EQC38129.1| 40S ribosomal protein S16 [Saprolegnia diclina VS20]
 gb|KDO21785.1| 40S ribosomal protein S16 [Saprolegnia parasitica CBS 223.65]
 gb|KDO21891.1| 40S ribosomal protein S16 [Saprolegnia parasitica CBS 223.65]
Length=146

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A+ +ESVQ FGRKK A AV +CKRG GLIK+NG PIEL++PEILR K +EP+LLLG+ RF
Sbjct  4    ASKIESVQVFGRKKNATAVAYCKRGHGLIKVNGCPIELVEPEILRTKTYEPVLLLGQQRF  63

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
            A VD+R+RVKGGGHTSQIYAIRQ+IAKA+VA+YQKYVDE SKKEIKDIL+ YDRTLLVAD
Sbjct  64   ANVDIRVRVKGGGHTSQIYAIRQAIAKAIVAYYQKYVDEASKKEIKDILLDYDRTLLVAD  123

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCE KKFGG  ARARFQKSYR
Sbjct  124  PRRCEAKKFGGPSARARFQKSYR  146



>ref|XP_002441754.1| hypothetical protein SORBIDRAFT_08g001870 [Sorghum bicolor]
 gb|EES15592.1| hypothetical protein SORBIDRAFT_08g001870 [Sorghum bicolor]
Length=149

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEVKDIFARYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|NP_001011.1| 40S ribosomal protein S16 [Homo sapiens]
 ref|NP_001028796.1| 40S ribosomal protein S16 [Bos taurus]
 ref|NP_038675.2| 40S ribosomal protein S16 [Mus musculus]
 ref|NP_001131092.1| 40S ribosomal protein S16 [Sus scrofa]
 ref|NP_001162617.1| 40S ribosomal protein S16 [Rattus norvegicus]
 ref|NP_001252707.1| 40S ribosomal protein S16 [Macaca mulatta]
 ref|NP_001270980.1| uncharacterized protein LOC101865856 [Macaca fascicularis]
 ref|NP_001291828.1| ribosomal protein S16 [Ailuropoda melanoleuca]
 ref|XP_512651.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Pan troglodytes]
 ref|XP_001363137.1| PREDICTED: 40S ribosomal protein S16 [Monodelphis domestica]
 ref|XP_001498092.1| PREDICTED: 40S ribosomal protein S16 [Equus caballus]
 ref|XP_002711497.1| PREDICTED: 40S ribosomal protein S16 [Oryctolagus cuniculus]
 ref|XP_002762144.1| PREDICTED: 40S ribosomal protein S16 [Callithrix jacchus]
 ref|XP_002823246.1| PREDICTED: 40S ribosomal protein S16 [Pongo abelii]
 ref|XP_003355952.1| PREDICTED: 40S ribosomal protein S16-like isoform 1 [Sus scrofa]
 ref|XP_003467308.1| PREDICTED: 40S ribosomal protein S16 [Cavia porcellus]
 ref|XP_003802177.1| PREDICTED: 40S ribosomal protein S16 [Otolemur garnettii]
 ref|XP_003812284.1| PREDICTED: 40S ribosomal protein S16 [Pan paniscus]
 ref|XP_003943186.1| PREDICTED: 40S ribosomal protein S16 [Saimiri boliviensis boliviensis]
 ref|XP_003997859.1| PREDICTED: 40S ribosomal protein S16 [Felis catus]
 ref|XP_004396438.1| PREDICTED: 40S ribosomal protein S16 [Odobenus rosmarus divergens]
 ref|XP_004441578.1| PREDICTED: 40S ribosomal protein S16 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004441579.1| PREDICTED: 40S ribosomal protein S16 isoform 3 [Ceratotherium 
simum simum]
 ref|XP_004481508.1| PREDICTED: 40S ribosomal protein S16 isoform 2 [Dasypus novemcinctus]
 ref|XP_004617433.1| PREDICTED: 40S ribosomal protein S16 [Sorex araneus]
 ref|XP_004710374.1| PREDICTED: 40S ribosomal protein S16 [Echinops telfairi]
 ref|XP_004690677.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Condylura cristata]
 ref|XP_004690679.1| PREDICTED: 40S ribosomal protein S16 isoform X3 [Condylura cristata]
 ref|XP_004776214.1| PREDICTED: 40S ribosomal protein S16 [Mustela putorius furo]
 ref|XP_004810275.1| PREDICTED: 40S ribosomal protein S16 [Mustela putorius furo]
 ref|XP_004894728.1| PREDICTED: 40S ribosomal protein S16 [Heterocephalus glaber]
 ref|XP_004859172.1| PREDICTED: 40S ribosomal protein S16 [Heterocephalus glaber]
 ref|XP_005086277.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Mesocricetus 
auratus]
 ref|XP_005399828.1| PREDICTED: 40S ribosomal protein S16 [Chinchilla lanigera]
 ref|XP_005616648.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Canis lupus 
familiaris]
 ref|XP_005890614.1| PREDICTED: 40S ribosomal protein S16 [Bos mutus]
 ref|XP_005963533.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Pantholops hodgsonii]
 ref|XP_006096774.1| PREDICTED: 40S ribosomal protein S16 [Myotis lucifugus]
 ref|XP_006215096.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Vicugna pacos]
 ref|XP_006140441.1| PREDICTED: 40S ribosomal protein S16 [Tupaia chinensis]
 ref|XP_006743459.1| PREDICTED: 40S ribosomal protein S16 [Leptonychotes weddellii]
 ref|XP_006901150.1| PREDICTED: 40S ribosomal protein S16 [Elephantulus edwardii]
 ref|XP_006871497.1| PREDICTED: 40S ribosomal protein S16 [Chrysochloris asiatica]
 ref|XP_006905456.1| PREDICTED: 40S ribosomal protein S16 [Pteropus alecto]
 ref|XP_006986357.1| PREDICTED: 40S ribosomal protein S16 [Peromyscus maniculatus 
bairdii]
 ref|XP_007096963.1| PREDICTED: 40S ribosomal protein S16 [Panthera tigris altaica]
 ref|XP_007114549.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Physeter catodon]
 ref|XP_007114550.1| PREDICTED: 40S ribosomal protein S16 isoform X3 [Physeter catodon]
 ref|XP_006068715.1| PREDICTED: 40S ribosomal protein S16 [Bubalus bubalis]
 ref|XP_007180041.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007451844.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Lipotes vexillifer]
 ref|XP_007524048.1| PREDICTED: 40S ribosomal protein S16 [Erinaceus europaeus]
 ref|XP_007618266.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Cricetulus griseus]
 ref|XP_007956659.1| PREDICTED: 40S ribosomal protein S16 [Orycteropus afer afer]
 ref|XP_007994973.1| PREDICTED: 40S ribosomal protein S16 [Chlorocebus sabaeus]
 ref|XP_008137830.1| PREDICTED: 40S ribosomal protein S16 [Eptesicus fuscus]
 ref|XP_008530310.1| PREDICTED: 40S ribosomal protein S16 [Equus przewalskii]
 ref|XP_008580382.1| PREDICTED: 40S ribosomal protein S16 [Galeopterus variegatus]
 ref|XP_008686920.1| PREDICTED: 40S ribosomal protein S16 [Ursus maritimus]
 ref|XP_010612813.1| PREDICTED: 40S ribosomal protein S16 [Fukomys damarensis]
 ref|XP_010847519.1| PREDICTED: 40S ribosomal protein S16 [Bison bison bison]
 ref|XP_010945532.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Camelus bactrianus]
 ref|XP_010983472.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Camelus dromedarius]
 ref|XP_011370539.1| PREDICTED: 40S ribosomal protein S16 [Pteropus vampyrus]
 sp|P62249.2|RS16_HUMAN RecName: Full=40S ribosomal protein S16 [Homo sapiens]
 sp|P62250.2|RS16_RAT RecName: Full=40S ribosomal protein S16 [Rattus norvegicus]
 sp|P14131.4|RS16_MOUSE RecName: Full=40S ribosomal protein S16 [Mus musculus]
 sp|Q29201.4|RS16_PIG RecName: Full=40S ribosomal protein S16 [Sus scrofa]
 sp|Q3T0X6.3|RS16_BOVIN RecName: Full=40S ribosomal protein S16 [Bos taurus]
 pdb|2ZKQ|II Chain i, Structure Of A Mammalian Ribosomal 40s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3A|Q Chain Q, Structure Of The Human 40s Ribosomal Proteins
 pdb|4KZX|Q Chain Q, Rabbit 40s Ribosomal Subunit In Complex With Eif1.
 pdb|4KZY|Q Chain Q, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|Q Chain Q, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 pdb|4CXC|Q Chain Q, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UQ4|Q Chain Q, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4UQ5|Q Chain Q, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4W23|Q Chain Q, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Small Ribosomal Subunit)
 pdb|4W28|Q Chain Q, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Small Ribosomal Subunit)
 pdb|4D5L|Q Chain Q, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 pdb|4D61|Q Chain Q, Cryo-em Structures Of Ribosomal 80s Complexes With Termination 
Factors And Cricket Paralysis Virus Ires Reveal The 
Ires In The Translocated State
 emb|CAA35662.1| unnamed protein product [Rattus rattus]
 gb|AAA60583.1| RPS16 [Homo sapiens]
 dbj|BAB27062.1| unnamed protein product [Mus musculus]
 dbj|BAB27083.1| unnamed protein product [Mus musculus]
 dbj|BAB27368.1| unnamed protein product [Mus musculus]
 dbj|BAB31702.1| unnamed protein product [Mus musculus]
 gb|AAH04324.1| Ribosomal protein S16 [Homo sapiens]
 gb|AAH07977.1| Ribosomal protein S16 [Homo sapiens]
 dbj|BAB79479.1| ribosomal protein S16 [Homo sapiens]
 dbj|BAC39077.1| unnamed protein product [Mus musculus]
 dbj|BAC40341.1| unnamed protein product [Mus musculus]
 dbj|BAC40524.1| unnamed protein product [Mus musculus]
 gb|AAX32501.1| ribosomal protein S16 [synthetic construct]
 dbj|BAE41081.1| unnamed protein product [Mus musculus]
 dbj|BAE29871.1| unnamed protein product [Mus musculus]
 dbj|BAE40167.1| unnamed protein product [Mus musculus]
 gb|AAI02216.1| Ribosomal protein S16 [Bos taurus]
 dbj|BAE88395.1| unnamed protein product [Macaca fascicularis]
 gb|EAW56894.1| ribosomal protein S16, isoform CRA_c [Homo sapiens]
 gb|ABM84375.1| ribosomal protein S16 [synthetic construct]
 gb|ABM87218.1| ribosomal protein S16 [synthetic construct]
 gb|AAI15674.1| Rps16 protein [Mus musculus]
 gb|AAI15675.1| Rps16 protein [Mus musculus]
 gb|EDL19519.1| mCG123443 [Mus musculus]
 gb|EDL24144.1| mCG129846 [Mus musculus]
 gb|EDM07900.1| rCG54255, isoform CRA_a [Rattus norvegicus]
 dbj|BAG37882.1| unnamed protein product [Homo sapiens]
 gb|ACI96265.1| ribosomal protein S16 [Sus scrofa]
 gb|ACZ43777.1| ribosomal protein S16 [Ailuropoda melanoleuca]
 gb|ACZ43778.1| ribosomal protein S16 [Ailuropoda melanoleuca]
 tpg|DAA19908.1| TPA: 40S ribosomal protein S16 [Bos taurus]
 gb|EHB09398.1| 40S ribosomal protein S16 [Heterocephalus glaber]
 gb|EHH59572.1| hypothetical protein EGM_09712 [Macaca fascicularis]
 gb|AFJ05116.1| ribosomal protein S16 [Ursus thibetanus mupinensis]
 gb|ELK18202.1| 40S ribosomal protein S16 [Pteropus alecto]
 gb|ELW72405.1| 40S ribosomal protein S16 [Tupaia chinensis]
 gb|EPQ09338.1| 40S ribosomal protein S16 [Myotis brandtii]
 gb|ERE41893.1| 40S ribosomal protein S16-like protein [Cricetulus griseus]
 gb|AIC49647.1| RPS16, partial [synthetic construct]
 gb|AIC63162.1| RPS16, partial [synthetic construct]
 gb|KFO19037.1| 40S ribosomal protein S16 [Fukomys damarensis]
Length=146

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_008893682.1| 40S ribosomal protein S16 [Phytophthora parasitica INRA-310]
 gb|ETI44660.1| 40S ribosomal protein S16 [Phytophthora parasitica P1569]
 gb|ETK84645.1| 40S ribosomal protein S16 [Phytophthora parasitica]
 gb|ETL38081.1| 40S ribosomal protein S16 [Phytophthora parasitica]
 gb|ETM44510.1| 40S ribosomal protein S16 [Phytophthora parasitica]
 gb|ETN21978.1| 40S ribosomal protein S16 [Phytophthora parasitica INRA-310]
 gb|ETO73309.1| 40S ribosomal protein S16 [Phytophthora parasitica P1976]
 gb|ETP14469.1| 40S ribosomal protein S16 [Phytophthora parasitica CJ01A1]
Length=163

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +ESVQ FGRKK A AV +CKRG GLIK+NG PIEL++PEILR K +EP+LLLG+ RFA V
Sbjct  24   IESVQVFGRKKNATAVAYCKRGHGLIKVNGTPIELVEPEILRVKTYEPVLLLGQQRFANV  83

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGHT+QIYAIRQ+IAKA+VA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  84   DIRIRVKGGGHTAQIYAIRQAIAKAIVAYYQKYVDEASKKEIKDILLAYDRTLLVADPRR  143

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGG  ARARFQKSYR
Sbjct  144  CEAKKFGGSSARARFQKSYR  163



>gb|AAH82286.1| Rps16 protein, partial [Mus musculus]
Length=157

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  14   SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  73

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  74   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  133

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  134  DPRRCESKKFGGPGARARYQKSYR  157



>gb|AAI59439.1| Rps16 protein [Rattus norvegicus]
Length=160

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFA
Sbjct  19   GPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFA  78

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADP
Sbjct  79   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADP  138

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCE KKFGG GARAR+QKSYR
Sbjct  139  RRCESKKFGGPGARARYQKSYR  160



>ref|XP_004670475.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Jaculus jaculus]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>gb|AAH64030.1| Rps16 protein, partial [Rattus norvegicus]
Length=161

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFA
Sbjct  20   GPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFA  79

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADP
Sbjct  80   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADP  139

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCE KKFGG GARAR+QKSYR
Sbjct  140  RRCESKKFGGPGARARYQKSYR  161



>gb|AAH84715.1| Rps16 protein, partial [Rattus norvegicus]
Length=159

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  16   SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  75

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  76   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  135

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  136  DPRRCESKKFGGPGARARYQKSYR  159



>ref|NP_001232350.1| putative ribosomal protein S16 [Taeniopygia guttata]
 ref|XP_416113.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Gallus gallus]
 ref|XP_003202153.1| PREDICTED: 40S ribosomal protein S16 [Meleagris gallopavo]
 ref|XP_004937643.1| PREDICTED: 40S ribosomal protein S16 isoform X3 [Gallus gallus]
 ref|XP_005147969.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005147970.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Melopsittacus 
undulatus]
 ref|XP_005236767.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Falco peregrinus]
 ref|XP_005236768.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Falco peregrinus]
 ref|XP_005441516.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Falco cherrug]
 ref|XP_005441517.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Falco cherrug]
 ref|XP_005441518.1| PREDICTED: 40S ribosomal protein S16-like isoform X3 [Falco cherrug]
 ref|XP_005519448.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005519449.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Pseudopodoces 
humilis]
 ref|XP_005519450.1| PREDICTED: 40S ribosomal protein S16-like isoform X3 [Pseudopodoces 
humilis]
 ref|XP_005519451.1| PREDICTED: 40S ribosomal protein S16-like isoform X4 [Pseudopodoces 
humilis]
 ref|XP_006268737.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Alligator 
mississippiensis]
 ref|XP_006268738.1| PREDICTED: 40S ribosomal protein S16-like isoform X2 [Alligator 
mississippiensis]
 ref|XP_008639342.1| PREDICTED: 40S ribosomal protein S16 [Corvus brachyrhynchos]
 ref|XP_008639343.1| PREDICTED: 40S ribosomal protein S16 [Corvus brachyrhynchos]
 ref|XP_009084950.1| PREDICTED: 40S ribosomal protein S16 [Serinus canaria]
 ref|XP_009908805.1| PREDICTED: 40S ribosomal protein S16 [Picoides pubescens]
 ref|XP_010187363.1| PREDICTED: 40S ribosomal protein S16 [Mesitornis unicolor]
 ref|XP_010187364.1| PREDICTED: 40S ribosomal protein S16 [Mesitornis unicolor]
 ref|XP_010560130.1| PREDICTED: 40S ribosomal protein S16 [Haliaeetus leucocephalus]
 ref|XP_010560131.1| PREDICTED: 40S ribosomal protein S16 [Haliaeetus leucocephalus]
 ref|XP_010560132.1| PREDICTED: 40S ribosomal protein S16 [Haliaeetus leucocephalus]
 gb|ACH43816.1| putative ribosomal protein S16 [Taeniopygia guttata]
 gb|ACH43817.1| putative ribosomal protein S16 [Taeniopygia guttata]
 gb|ACH43818.1| putative ribosomal protein S16 [Taeniopygia guttata]
 gb|ACH43819.1| putative ribosomal protein S16 [Taeniopygia guttata]
 gb|ACH43820.1| putative ribosomal protein S16 [Taeniopygia guttata]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>sp|Q90YQ7.1|RS16_ICTPU RecName: Full=40S ribosomal protein S16 [Ictalurus punctatus]
 gb|AAK95199.1|AF402825_1 40S ribosomal protein S16 [Ictalurus punctatus]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQVYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>dbj|BAF45905.1| ribosomal protein S16 [Solea senegalensis]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKSLVAYYQKYVDESSKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|KFV62939.1| 40S ribosomal protein S16, partial [Picoides pubescens]
Length=152

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  9    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  68

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  69   FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  128

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  129  DPRRCESKKFGGPGARARYQKSYR  152



>gb|ACO09841.1| 40S ribosomal protein S16 [Osmerus mordax]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLQEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|KHN16514.1| 40S ribosomal protein S16, partial [Glycine soja]
Length=120

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  477  RGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQ  298
            RGRGLIKING PIEL++PEILR+KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQ
Sbjct  1    RGRGLIKINGCPIELVEPEILRFKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQ  60

Query  297  SIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            SIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  61   SIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  120



>ref|XP_003452097.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_005800022.1| PREDICTED: 40S ribosomal protein S16-like [Xiphophorus maculatus]
 ref|XP_008274700.1| PREDICTED: 40S ribosomal protein S16 [Stegastes partitus]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMVEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_004083248.1| PREDICTED: 40S ribosomal protein S16 [Oryzias latipes]
Length=146

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMVEPSTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQVYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>dbj|BAK02478.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=149

 Score =   235 bits (600),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NG PIELI+PE+LR KAFEPI+L GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGAPIELIRPEMLRLKAFEPIMLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AKALVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAVAKALVAYYQKYVDEAAKKEVKDIFARYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|XP_004714191.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Echinops 
telfairi]
Length=146

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+IQP  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIQPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVD+ SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDKASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_009531521.1| hypothetical protein PHYSODRAFT_355047 [Phytophthora sojae]
 gb|EGZ14092.1| hypothetical protein PHYSODRAFT_355047 [Phytophthora sojae]
Length=144

 Score =   235 bits (599),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +ESVQ FGRKK A AV +CKRG GLIK+NG PIEL++PEILR K +EP+LLLG+ RFA V
Sbjct  5    IESVQVFGRKKNATAVAYCKRGHGLIKVNGTPIELVEPEILRVKTYEPVLLLGQQRFANV  64

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGHT+QIYAIRQ+IAKA+VA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  65   DIRIRVKGGGHTAQIYAIRQAIAKAIVAYYQKYVDEASKKEIKDILLAYDRTLLVADPRR  124

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGG  ARARFQKSYR
Sbjct  125  CEAKKFGGASARARFQKSYR  144



>ref|XP_002450189.1| hypothetical protein SORBIDRAFT_05g001680 [Sorghum bicolor]
 gb|EES09177.1| hypothetical protein SORBIDRAFT_05g001680 [Sorghum bicolor]
Length=148

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  11   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  70

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  71   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEVKDIFSRYDRTLLVADPRRCE  130

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  131  PKKFGGRGARARFQKSYR  148



>ref|NP_001187219.1| 40S ribosomal protein S16 [Ictalurus punctatus]
 gb|ADO28449.1| 40S ribosomal protein s16 [Ictalurus punctatus]
Length=149

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E I+P  L+YK  EP+LLLG+ R
Sbjct  6    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLLGKER  65

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  66   FAGVDIRVRVKGGGHVAQVYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  125

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  126  DPRRCESKKFGGPGARARYQKSYR  149



>gb|EMT04029.1| 40S ribosomal protein S16 [Aegilops tauschii]
Length=149

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NG PIELI+PE+LR KAFEPI+L GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGAPIELIRPEMLRLKAFEPIMLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AKALVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAVAKALVAYYQKYVDEAAKKEVKDIFARYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|XP_008398658.1| PREDICTED: 40S ribosomal protein S16 [Poecilia reticulata]
Length=146

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMVEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEI+DIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIRDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AAH90618.1| Rps16 protein [Mus musculus]
Length=172

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFA
Sbjct  31   GPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFA  90

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADP
Sbjct  91   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADP  150

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCE KKFGG GARAR+QKSYR
Sbjct  151  RRCESKKFGGPGARARYQKSYR  172



>ref|XP_008313605.1| PREDICTED: 40S ribosomal protein S16 [Cynoglossus semilaevis]
 ref|XP_008313606.1| PREDICTED: 40S ribosomal protein S16 [Cynoglossus semilaevis]
Length=146

 Score =   235 bits (599),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AFM90848.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=165

 Score =   235 bits (600),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = -2

Query  588  FLYSPRQRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY  409
            F    R++R T  A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+Y
Sbjct  9    FAVGEREQRRTMPAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQY  68

Query  408  KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIK  229
            K  EP+LLLG+ RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIK
Sbjct  69   KLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIK  128

Query  228  DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
             IL++YDRTLLVADPRRCE KKFGG GARAR+QKSYR
Sbjct  129  GILIQYDRTLLVADPRRCEAKKFGGPGARARYQKSYR  165



>ref|NP_001278474.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG36094.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG36215.1| 40S ribosomal protein S16 [Zea mays]
 tpg|DAA39287.1| TPA: 40S ribosomal protein S16 [Zea mays]
Length=148

 Score =   234 bits (598),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            + QCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  11   TAQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  70

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKEIKDI  RYDRTLLVADPRRCE
Sbjct  71   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEIKDIFTRYDRTLLVADPRRCE  130

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  131  PKKFGGRGARARFQKSYR  148



>ref|XP_002899087.1| 40S ribosomal protein S16 [Phytophthora infestans T30-4]
 gb|EEY62451.1| 40S ribosomal protein S16 [Phytophthora infestans T30-4]
Length=158

 Score =   235 bits (599),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +ESVQ FGRKK A AV +CKRG GLIK+NG PIEL++PEILR K +EP+LLLG+ RFA V
Sbjct  19   IESVQVFGRKKNATAVAYCKRGHGLIKVNGTPIELVEPEILRVKTYEPVLLLGQQRFANV  78

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGHT+QIYAIRQ+IAKA+VA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  79   DIRIRVKGGGHTAQIYAIRQAIAKAIVAYYQKYVDEASKKEIKDILLAYDRTLLVADPRR  138

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGG  ARARFQKSYR
Sbjct  139  CEAKKFGGGSARARFQKSYR  158



>gb|ETL91183.1| 40S ribosomal protein S16 [Phytophthora parasitica]
 gb|ETP42550.1| 40S ribosomal protein S16 [Phytophthora parasitica P10297]
Length=163

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +ESVQ FGRKK A AV +CKRG GLIK+NG PIEL++PEILR K +EP+LLLG+ RFA V
Sbjct  24   IESVQVFGRKKNATAVAYCKRGHGLIKVNGTPIELVEPEILRVKTYEPVLLLGQQRFANV  83

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGGHT+QIYAIRQ+IAKA+VA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  84   DIRIRVKGGGHTAQIYAIRQAIAKAIVAYYQKYVDEASKKEIKDILLAYDRTLLVADPRR  143

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGG  ARARFQKSYR
Sbjct  144  CEAKKFGGSSARARFQKSYR  163



>gb|ACM08397.1| 40S ribosomal protein S16 [Salmo salar]
Length=146

 Score =   234 bits (598),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGV +R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVGIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDESSKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|KFQ38885.1| 40S ribosomal protein S16, partial [Mesitornis unicolor]
Length=164

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  21   AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  80

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  81   FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  140

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  141  DPRRCESKKFGGPGARARYQKSYR  164



>ref|XP_006633603.1| PREDICTED: 40S ribosomal protein S16-like [Lepisosteus oculatus]
Length=146

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_004548484.1| PREDICTED: 40S ribosomal protein S16-like [Maylandia zebra]
 ref|XP_005740915.1| PREDICTED: 40S ribosomal protein S16-like [Pundamilia nyererei]
 ref|XP_005923574.1| PREDICTED: 40S ribosomal protein S16-like [Haplochromis burtoni]
 ref|XP_006780925.1| PREDICTED: 40S ribosomal protein S16-like [Neolamprologus brichardi]
Length=146

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMVEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|NP_001011146.1| ribosomal protein S16 [Xenopus (Silurana) tropicalis]
 gb|AAH84534.1| ribosomal protein S16 [Xenopus (Silurana) tropicalis]
 gb|AAI06274.1| Rps16 protein [Xenopus laevis]
 emb|CAJ83293.1| ribosomal protein S16 [Xenopus (Silurana) tropicalis]
 gb|AAI28924.1| Rps16 protein [Xenopus laevis]
Length=146

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_010379207.1| PREDICTED: 40S ribosomal protein S16 [Rhinopithecus roxellana]
Length=146

 Score =   234 bits (597),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YD+TLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDQTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|ACM09220.1| 40S ribosomal protein S16 [Salmo salar]
Length=146

 Score =   234 bits (596),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK   P+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLGPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>sp|Q98TR7.1|RS16_HETFO RecName: Full=40S ribosomal protein S16 [Heteropneustes fossilis]
 gb|AAK11731.1| ribosomal protein S16 [Heteropneustes fossilis]
Length=146

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQVYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|ACO51844.1| 40S ribosomal protein S16 [Rana catesbeiana]
Length=146

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEIIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|EDL15855.1| mCG3370 [Mus musculus]
Length=146

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            ++  P++SVQ FGRKKTA A  HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ 
Sbjct  2    LSKGPLQSVQVFGRKKTATAEAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKE  61

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL+ YDRTLLV
Sbjct  62   RFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIHYDRTLLV  121

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCE KKFGG GARAR+QKSYR
Sbjct  122  ADPRRCESKKFGGPGARARYQKSYR  146



>dbj|BAK02829.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS51991.1| 40S ribosomal protein S16 [Triticum urartu]
 gb|EMT17257.1| 40S ribosomal protein S16 [Aegilops tauschii]
Length=149

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIY+IRQ+IAK+LVA+YQKYVDE +KKE+K+I  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYSIRQAIAKSLVAYYQKYVDEAAKKEVKEIFGRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|XP_006677977.1| hypothetical protein BATDEDRAFT_33120 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81289.1| hypothetical protein BATDEDRAFT_33120 [Batrachochytrium dendrobatidis 
JAM81]
Length=144

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  546  AAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF  367
            A   E+VQCFGRKKTA AV HCKRG GLIKING P+EL++PEILR K +EPI LLG+ RF
Sbjct  2    ANMTEAVQCFGRKKTATAVAHCKRGTGLIKINGSPLELVEPEILRAKVYEPIYLLGKERF  61

Query  366  AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD  187
              VD+R+RV GGG  SQIYAIRQ+IAKA+VAFYQK++DE SKKEIK+IL+RYDRTLLVAD
Sbjct  62   EMVDIRVRVNGGGQVSQIYAIRQAIAKAIVAFYQKFIDESSKKEIKEILIRYDRTLLVAD  121

Query  186  PRRCEPKKFGGRGARARFQKSYR  118
            PRRCEPKKFGG GARAR+QKSYR
Sbjct  122  PRRCEPKKFGGAGARARYQKSYR  144



>ref|XP_004341583.1| ribosomal protein S9, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19497.1| ribosomal protein S9, putative [Acanthamoeba castellanii str. 
Neff]
Length=150

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A AP +SVQ FGRKKTAVAV   K GRGLIKING PIEL++PE+LRYK FEPILLLG  +
Sbjct  7    ATAPKKSVQTFGRKKTAVAVAFVKAGRGLIKINGSPIELVEPEVLRYKVFEPILLLGTDK  66

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            F+GVD+RIRVKGGGH SQ+YAIRQ++AKA+VA+YQKYVDE +KKEIK++L+ YDR+LLVA
Sbjct  67   FSGVDIRIRVKGGGHVSQVYAIRQALAKAIVAWYQKYVDEAAKKEIKEVLLTYDRSLLVA  126

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGG  ARAR+QKSYR
Sbjct  127  DPRRCEPKKFGGPAARARYQKSYR  150



>dbj|BAJ85048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=149

 Score =   234 bits (596),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIY+IRQ+IAK+LVA+YQKYVDE +KKE+K+I  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGRTSQIYSIRQAIAKSLVAYYQKYVDEAAKKEVKEIFGRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>emb|CEF98090.1| Ribosomal protein S9, conserved site [Ostreococcus tauri]
Length=143

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            SVQ FGRKKTAVAV HCKRG+GLI++NGVPI+LIQP+ LR KA EPILLLG+ RFA +D+
Sbjct  6    SVQTFGRKKTAVAVAHCKRGKGLIRLNGVPIDLIQPDTLRLKAVEPILLLGKERFANLDI  65

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRVKGGGH SQ+YA+RQ+IAKALVA+YQK++DE SKKEIKD+L+ YDRTLLVADPRR E
Sbjct  66   RIRVKGGGHVSQMYAVRQAIAKALVAYYQKFIDEASKKEIKDLLLAYDRTLLVADPRRME  125

Query  171  PKKFGGRGARARFQKSYR  118
            PKK GGRGARARFQKSYR
Sbjct  126  PKKAGGRGARARFQKSYR  143



>ref|XP_007555348.1| PREDICTED: 40S ribosomal protein S16 [Poecilia formosa]
Length=146

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMVEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEI+DIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIRDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|NP_001078601.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
 gb|AED92547.1| 40S ribosomal protein S16-3 [Arabidopsis thaliana]
Length=144

 Score =   233 bits (595),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  552  MAAAP-VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR  376
            MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct  1    MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGK  60

Query  375  HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL  196
            HRFAGV+MRIRV GGGHTSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct  61   HRFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL  120

Query  195  VADPRRCEPKKF  160
            VADPRRCE  +F
Sbjct  121  VADPRRCELFRF  132



>ref|XP_003688797.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Mus musculus]
 ref|XP_006542949.1| PREDICTED: 40S ribosomal protein S16 isoform X2 [Mus musculus]
Length=165

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            ++  P++SVQ FGRKKTA A  HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ 
Sbjct  21   LSKGPLQSVQVFGRKKTATAEAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKE  80

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL+ YDRTLLV
Sbjct  81   RFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIHYDRTLLV  140

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCE KKFGG GARAR+QKSYR
Sbjct  141  ADPRRCESKKFGGPGARARYQKSYR  165



>ref|NP_001279691.1| ribosomal protein S16 [Callorhinchus milii]
 ref|XP_007903125.1| PREDICTED: 40S ribosomal protein S16 [Callorhinchus milii]
 gb|AFM85848.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85879.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85883.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85925.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85970.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85985.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM85997.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86033.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86111.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86116.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86246.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86262.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86267.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86303.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86410.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86449.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86525.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86545.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86590.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86607.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86648.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86651.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86778.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86872.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86895.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM86951.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM87152.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM87718.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM87839.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM88181.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM88932.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM89876.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM89918.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90382.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90387.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90402.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90516.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90526.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90639.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90727.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90732.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90800.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90822.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
 gb|AFM90922.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>ref|XP_006178002.1| PREDICTED: 40S ribosomal protein S16 [Camelus ferus]
Length=146

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GAR R+QKSYR
Sbjct  123  DPRRCESKKFGGPGARDRYQKSYR  146



>gb|ACD65104.1| putative 40S ribosomal protein RPS16 [Novocrania anomala]
Length=146

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P++SVQ FGRKKTA AV HCKRG GLIK+NG P++LI+P++LR K  EPILLLG+ RFA
Sbjct  5    GPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDLIEPQLLRAKLQEPILLLGKDRFA  64

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+RIRVKGGGH +QIYAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL +YDR+LLVADP
Sbjct  65   GVDIRIRVKGGGHVAQIYAIRQAISKSLVAYYQKYVDEASKKEIKDILTQYDRSLLVADP  124

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGG GARAR+QKSYR
Sbjct  125  RRCEPKKFGGPGARARYQKSYR  146



>gb|AFR11277.1| ribosomal protein S16 [Zea mays]
Length=148

 Score =   233 bits (595),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            + QCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE+LR KA+EPILL GR RF  +DM
Sbjct  11   TAQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEMLRLKAYEPILLAGRSRFKDIDM  70

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKEIKDI  RYDRTLLVADPRRCE
Sbjct  71   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEIKDIFTRYDRTLLVADPRRCE  130

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  131  PKKFGGRGARARFQKSYR  148



>gb|ACO08300.1| 40S ribosomal protein S16 [Oncorhynchus mykiss]
Length=146

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRR E KKFGG GARAR+QKSYR
Sbjct  123  DPRRYESKKFGGPGARARYQKSYR  146



>ref|XP_005995898.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Latimeria 
chalumnae]
Length=202

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  59   AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  118

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  119  FAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  178

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  179  DPRRCEAKKFGGPGARARYQKSYR  202



>ref|XP_005868880.1| PREDICTED: LOW QUALITY PROTEIN: ribosomal protein S16 [Myotis 
brandtii]
Length=229

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct  89   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG  148

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct  149  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR  208

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCE KKFGG GARAR+QKSYR
Sbjct  209  RCESKKFGGPGARARYQKSYR  229



>ref|XP_003420822.1| PREDICTED: 40S ribosomal protein S16 [Loxodonta africana]
Length=146

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQCISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_004978481.1| PREDICTED: 40S ribosomal protein S16-like [Setaria italica]
Length=149

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NGVPIELI+PE LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGVPIELIRPEGLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ+IAKALV++YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAIAKALVSYYQKYVDEAAKKEVKDIFGRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|XP_004977429.1| PREDICTED: 40S ribosomal protein S16-like [Setaria italica]
Length=149

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRGLIK+NG PIELI+PE LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGLIKVNGAPIELIRPEGLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ+IAKALVA+YQKYVDE +KKE+KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEAAKKEVKDIFGRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>gb|EPB82886.1| 40S ribosomal protein [Mucor circinelloides f. circinelloides 
1006PhL]
 gb|EPB88336.1| 40S ribosomal protein [Mucor circinelloides f. circinelloides 
1006PhL]
 dbj|GAN09195.1| 40S ribosomal protein S16 [Mucor ambiguus]
 dbj|GAN03518.1| 40S ribosomal protein S16 [Mucor ambiguus]
 emb|CEP15361.1| hypothetical protein [Parasitella parasitica]
 emb|CEP13785.1| hypothetical protein [Parasitella parasitica]
 emb|CEP11789.1| hypothetical protein [Parasitella parasitica]
Length=140

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E+VQ FGRKKTA AV HCKRG GLI+ING PIEL++PEIL++K +E ILLLG  RFA  
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGHGLIRINGSPIELLEPEILKFKVYEVILLLGEERFANT  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRV GGGHTSQ+YAIRQ++AKA+VAFYQK+VDE +KKEIK+ILV+YDRTLLVADPRR
Sbjct  61   DIRIRVNGGGHTSQVYAIRQALAKAIVAFYQKFVDEAAKKEIKEILVQYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGG GARARFQKSYR
Sbjct  121  CEPKKFGGPGARARFQKSYR  140



>ref|XP_009039660.1| hypothetical protein AURANDRAFT_30567 [Aureococcus anophagefferens]
 gb|EGB05526.1| hypothetical protein AURANDRAFT_30567 [Aureococcus anophagefferens]
Length=143

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            + ++SVQ FGRKKTA AV +CK+GRGLIK+NG PIEL++PEILR K FEP+LLLG+HRFA
Sbjct  2    SAIQSVQVFGRKKTATAVAYCKQGRGLIKVNGCPIELLEPEILRLKTFEPVLLLGQHRFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
             VD+RIRVKGGG T+QIYAIRQSIAKALVA+YQKYVDE SK EI+DIL+ YDRTLLVAD 
Sbjct  62   NVDIRIRVKGGGFTAQIYAIRQSIAKALVAYYQKYVDEASKTEIRDILMSYDRTLLVADA  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCE KKFGG GARAR+QKSYR
Sbjct  122  RRCESKKFGGPGARARYQKSYR  143



>ref|XP_001417833.1| Ribosomal protein S16, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96126.1| Ribosomal protein S16, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=139

 Score =   232 bits (592),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            SVQ FGRKKTAVAV H KRG+GLI++NGVPI+L+QP+ LR KA EPILLLG+ RFA VD+
Sbjct  2    SVQTFGRKKTAVAVAHTKRGKGLIRLNGVPIDLVQPDTLRLKAVEPILLLGKERFANVDI  61

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRVKGGGH SQ+YA+RQ+IAK+LVA+YQKYVDE SKKEIKD+L+ YDRTLLVADPRR E
Sbjct  62   RIRVKGGGHVSQMYAVRQAIAKSLVAYYQKYVDEASKKEIKDLLLAYDRTLLVADPRRME  121

Query  171  PKKFGGRGARARFQKSYR  118
            PKK GGRGARARFQKSYR
Sbjct  122  PKKAGGRGARARFQKSYR  139



>ref|XP_003577865.1| PREDICTED: 40S ribosomal protein S16 [Brachypodium distachyon]
Length=149

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV +CK GRGLIK+NG PIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYCKPGRGLIKVNGAPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ+IAK LVA++QKYVDE +KKE+K+I  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAIAKGLVAYFQKYVDEAAKKEVKEIFGRYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|XP_006021181.1| PREDICTED: 40S ribosomal protein S16-like [Alligator sinensis]
Length=186

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = -2

Query  564  RTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILL  385
            R  + AA  V SVQ FG+KKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LL
Sbjct  38   RGLKAAALAVLSVQNFGQKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLL  97

Query  384  LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR  205
            LG+ RFAGVD+R+RVKGGGH +QIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDR
Sbjct  98   LGKERFAGVDIRVRVKGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDR  157

Query  204  TLLVADPRRCEPKKFGGRGARARFQKSYR  118
            TLLVADPRRCE KKFGG GARAR+QKSYR
Sbjct  158  TLLVADPRRCESKKFGGPGARARYQKSYR  186



>ref|XP_005362618.1| PREDICTED: 40S ribosomal protein S16-like [Microtus ochrogaster]
Length=164

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ F RKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFARKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKK+IKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKQIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_006772017.1| PREDICTED: 40S ribosomal protein S16 [Myotis davidii]
Length=146

 Score =   232 bits (592),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK   P LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKVLAPXLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AFM86674.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI++ALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISRALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>ref|XP_005908688.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Bos mutus]
 gb|ELR46963.1| 40S ribosomal protein S16 [Bos mutus]
Length=146

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FA VD+R+RV+GGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FASVDIRVRVRGGGHIAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_005646504.1| 40S ribosomal protein S16 [Coccomyxa subellipsoidea C-169]
 gb|EIE21960.1| 40S ribosomal protein S16 [Coccomyxa subellipsoidea C-169]
Length=145

 Score =   232 bits (591),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            MA    +SVQ FGRKK AVAV + KRG GL+K+NG P+EL+QP+ LR+K  EP+LLLG+ 
Sbjct  1    MAEKETQSVQTFGRKKNAVAVAYVKRGTGLLKLNGSPLELVQPDTLRWKVMEPVLLLGKQ  60

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RF GVD+RIR  GGGH SQIYAIRQ+IAK LVAFYQKYVDEQ+K+EIKDIL+ YDRTLLV
Sbjct  61   RFEGVDIRIRASGGGHVSQIYAIRQAIAKGLVAFYQKYVDEQAKREIKDILLTYDRTLLV  120

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCEPKKFGG GARARFQKSYR
Sbjct  121  ADPRRCEPKKFGGPGARARFQKSYR  145



>ref|XP_011450742.1| PREDICTED: 40S ribosomal protein S16 [Crassostrea gigas]
 gb|EKC25047.1| 40S ribosomal protein S16 [Crassostrea gigas]
Length=149

 Score =   232 bits (592),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
             P +SVQ FGRKKTA AV HCKRG GLIK+NG P+E ++P+ILRYK  EPILLLG+ +FA
Sbjct  8    GPQQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEQVEPQILRYKLQEPILLLGKEKFA  67

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RV+GGGH +Q+YAIRQ+I+K+LVA+YQKYVDE SKKEIKD+L+ YDRTLLVADP
Sbjct  68   GVDIRVRVRGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDVLISYDRTLLVADP  127

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGG GARAR+QKSYR
Sbjct  128  RRCEPKKFGGPGARARYQKSYR  149



>gb|AFM90796.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGR+KTA AV HCKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGREKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>ref|XP_004060764.1| PREDICTED: 40S ribosomal protein S16 [Gorilla gorilla gorilla]
Length=146

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCK G GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKCGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>ref|XP_005109349.1| PREDICTED: 40S ribosomal protein S16 [Aplysia californica]
Length=146

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P+++VQ FGRKKTA AV HCKRG GLIK+NG P+E ++PEILR K  EP+LLLG+ R
Sbjct  3    AKGPLQAVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEQMEPEILRIKLQEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQ+I+KA+V++YQKYVDE SKKEIKDIL++YDR+LLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQAISKAIVSYYQKYVDEASKKEIKDILIQYDRSLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGG GARAR+QKSYR
Sbjct  123  DPRRCEPKKFGGPGARARYQKSYR  146



>ref|XP_004647957.1| PREDICTED: 40S ribosomal protein S16-like isoform X1 [Octodon 
degus]
Length=146

 Score =   232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+   L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIELRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AFM86626.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   232 bits (591),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  552  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            +A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ 
Sbjct  2    LAKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKE  61

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLL 
Sbjct  62   RFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLD  121

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCE KKFGG GARAR+QKSYR
Sbjct  122  ADPRRCEAKKFGGPGARARYQKSYR  146



>gb|AFM87781.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   231 bits (590),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKD L++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDTLIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>ref|XP_004605794.1| PREDICTED: 40S ribosomal protein S16-like [Sorex araneus]
Length=184

 Score =   233 bits (594),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -2

Query  579  SPRQRRTTRM----AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILR  412
            S R  R++R+    +  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+
Sbjct  27   SHRAVRSSRLHSLPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQ  86

Query  411  YKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEI  232
            YK  EP+LLLG+ RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEI
Sbjct  87   YKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEI  146

Query  231  KDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            KDIL+ YD TLLVADPRRCE KKFGG GARAR+QKSYR
Sbjct  147  KDILILYDWTLLVADPRRCESKKFGGPGARARYQKSYR  184



>ref|XP_005572789.1| PREDICTED: 40S ribosomal protein S16-like, partial [Macaca fascicularis]
Length=143

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            +P++SVQ FGRK TA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFA
Sbjct  2    SPLQSVQVFGRKNTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADP
Sbjct  62   GVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADP  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            R CE KKFGG GARAR+QKSYR
Sbjct  122  RCCESKKFGGPGARARYQKSYR  143



>emb|CCI50246.1| unnamed protein product [Albugo candida]
Length=144

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            VESVQ FGRKK A AV +CK G GLIK+NG PI+L++PEILR K +EP+LLLG+ RFA V
Sbjct  5    VESVQVFGRKKNATAVAYCKGGNGLIKVNGCPIDLVEPEILRVKTYEPVLLLGQQRFANV  64

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGG T+QIYAIRQ+IAKALVA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  65   DIRIRVKGGGRTAQIYAIRQAIAKALVAYYQKYVDEASKKEIKDILMAYDRTLLVADPRR  124

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGGR ARARFQKSYR
Sbjct  125  CEAKKFGGRSARARFQKSYR  144



>ref|XP_005616647.1| PREDICTED: 40S ribosomal protein S16 isoform X1 [Canis lupus 
familiaris]
Length=147

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  549  AAAPVESVQCFGRK-KTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH  373
            +  P++SVQ FGRK KTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ 
Sbjct  3    SKGPLQSVQVFGRKVKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKE  62

Query  372  RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV  193
            RFAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLV
Sbjct  63   RFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLV  122

Query  192  ADPRRCEPKKFGGRGARARFQKSYR  118
            ADPRRCE KKFGG GARAR+QKSYR
Sbjct  123  ADPRRCESKKFGGPGARARYQKSYR  147



>gb|ELU16265.1| hypothetical protein CAPTEDRAFT_153161 [Capitella teleta]
Length=147

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            AP++SVQ FGRKKTA AV HCK G+GLIK+NG P+  ++P++LRYK  EP+LLLG+ RFA
Sbjct  6    APLQSVQVFGRKKTATAVAHCKSGQGLIKVNGRPLNQLEPQMLRYKVQEPLLLLGKERFA  65

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RVKGGG  SQ+YAIRQ+I+KALVA+YQKYVDE SKKEIKD LV YDRTLLVADP
Sbjct  66   GVDIRVRVKGGGRVSQVYAIRQAISKALVAYYQKYVDEASKKEIKDTLVAYDRTLLVADP  125

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RRCEPKKFGG GARAR+QKSYR
Sbjct  126  RRCEPKKFGGPGARARYQKSYR  147



>sp|P16149.1|RS16_LUPPO RecName: Full=40S ribosomal protein S16 [Lupinus polyphyllus]
 emb|CAA36068.1| unnamed protein product [Lupinus polyphyllus]
Length=145

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  468  GLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIA  289
            GLIKING PIEL++PEILR+KAFEPILLLG+ RFAGVDMRIRVKGGGHTSQIYAIRQSIA
Sbjct  29   GLIKINGSPIELVEPEILRFKAFEPILLLGKSRFAGVDMRIRVKGGGHTSQIYAIRQSIA  88

Query  288  KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  118
            KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct  89   KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR  145



>emb|CCA24817.1| 40S ribosomal protein S16 putative [Albugo laibachii Nc14]
Length=144

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            VESVQ FGRKK A AV +CK G GLIK+NG PI+L++PEILR K +EP+LLLG+ RFA V
Sbjct  5    VESVQVFGRKKNATAVAYCKGGNGLIKVNGCPIDLVEPEILRVKTYEPVLLLGQQRFANV  64

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+R+RVKGGG T+QIYAIRQ+IAKALVA+YQKYVDE SKKEIKDIL+ YDRTLLVADPRR
Sbjct  65   DIRVRVKGGGRTAQIYAIRQAIAKALVAYYQKYVDEASKKEIKDILMAYDRTLLVADPRR  124

Query  177  CEPKKFGGRGARARFQKSYR  118
            CE KKFGGR ARARFQKSYR
Sbjct  125  CEAKKFGGRSARARFQKSYR  144



>gb|AAY66897.1| ribosomal protein S16 [Ixodes scapularis]
Length=148

 Score =   231 bits (588),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  558  TRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLG  379
            T  A   ++SVQ  GRKKTA AV +CKRG GL+K+NG P+E I+P  LRYK  EPILLLG
Sbjct  2    TAAAKEAIQSVQVLGRKKTATAVAYCKRGNGLLKVNGRPLENIEPLTLRYKLLEPILLLG  61

Query  378  RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL  199
            + RFAGVD+RIRVKGGG+ +QIYAIRQ+I+KALVA+YQKYVDEQSKKEIKD L++YDRTL
Sbjct  62   KERFAGVDIRIRVKGGGNVAQIYAIRQAISKALVAYYQKYVDEQSKKEIKDTLIQYDRTL  121

Query  198  LVADPRRCEPKKFGGRGARARFQKSYR  118
            LVADPRRCEPKKFGG GARAR+QKSYR
Sbjct  122  LVADPRRCEPKKFGGPGARARYQKSYR  148



>ref|XP_003972741.1| PREDICTED: 40S ribosomal protein S16-like isoform 1 [Takifugu 
rubripes]
 ref|XP_003972742.1| PREDICTED: 40S ribosomal protein S16-like isoform 2 [Takifugu 
rubripes]
 emb|CAG04137.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=146

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV HCKRG GL+K+NG P+E+++P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVAHCKRGNGLLKVNGKPLEMLEPATLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGG  +Q+YAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGRVAQVYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCESKKFGGPGARARYQKSYR  146



>gb|AAX62440.1| ribosomal protein S16 [Lysiphlebus testaceipes]
Length=148

 Score =   230 bits (587),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            P++SVQ FGRKKTA AV +CKRGRGL+K+NG P+E ++P++L+YK  EPILLLG+ +FAG
Sbjct  8    PIQSVQVFGRKKTATAVAYCKRGRGLLKVNGRPLEQVEPKVLQYKLQEPILLLGKEKFAG  67

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            VDMR+R  GGGH +Q+YAIRQ+I+KALVA+YQKYVDE SKKE+KDIL++YDRTLLVADPR
Sbjct  68   VDMRVRCAGGGHVAQVYAIRQAISKALVAYYQKYVDEASKKEVKDILIQYDRTLLVADPR  127

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCEPKKFGG GARAR+QKSYR
Sbjct  128  RCEPKKFGGPGARARYQKSYR  148



>gb|ADV40078.1| ribosomal protein S16 [Latrodectus hesperus]
Length=148

 Score =   230 bits (587),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = -2

Query  552  MAAAPVESVQC---FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLL  382
            M  A  E++ C   FGRKKTA AV +CK G GL+K+NG P+EL++P++L+YK  EPILLL
Sbjct  1    MEGAQKETINCVQVFGRKKTATAVAYCKTGNGLLKVNGRPLELLEPQMLKYKLLEPILLL  60

Query  381  GRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT  202
            G+ RFAGVD+R+RVKGGGH SQIYAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDR+
Sbjct  61   GKERFAGVDIRVRVKGGGHVSQIYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRS  120

Query  201  LLVADPRRCEPKKFGGRGARARFQKSYR  118
            LLVADPRRCEPKKFGG GARAR+QKSYR
Sbjct  121  LLVADPRRCEPKKFGGPGARARYQKSYR  148



>gb|AFM90407.1| 40S ribosomal protein S16-like protein [Callorhinchus milii]
Length=146

 Score =   230 bits (586),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            A  P++SVQ FGRKKTA AV  CKRG GLIK+NG P++ I+P  L+YK  EP+LLLG+ R
Sbjct  3    AKGPLQSVQVFGRKKTATAVARCKRGNGLIKVNGRPLDQIEPRTLQYKLLEPVLLLGKER  62

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  63   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  122

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  123  DPRRCEAKKFGGPGARARYQKSYR  146



>ref|NP_001150980.1| 40S ribosomal protein S16 [Zea mays]
 gb|ACG41163.1| 40S ribosomal protein S16 [Zea mays]
 gb|AFW55887.1| 40S ribosomal protein S16 [Zea mays]
Length=149

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            +VQCFGRKKTAVAV + K GRG+IK+NGVPIEL++PE+LR KA EP+LL GR RF  +DM
Sbjct  12   TVQCFGRKKTAVAVAYTKPGRGMIKVNGVPIELLRPEMLRLKAMEPVLLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQIYAIRQ++AK LVA+YQKYVDE +KKEIKDI +RY+RTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQIYAIRQAVAKGLVAYYQKYVDEAAKKEIKDIFMRYERTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>ref|NP_611685.1| ribosomal protein S16, isoform A [Drosophila melanogaster]
 ref|NP_001286731.1| ribosomal protein S16, isoform B [Drosophila melanogaster]
 ref|XP_001974507.1| GG21057 [Drosophila erecta]
 ref|XP_002039923.1| GM15924 [Drosophila sechellia]
 ref|XP_002092092.1| GE13998 [Drosophila yakuba]
 ref|XP_002082634.1| GD11679 [Drosophila simulans]
 sp|Q9W237.1|RS16_DROME RecName: Full=40S ribosomal protein S16 [Drosophila melanogaster]
 pdb|3J38|Q Chain Q, Structure Of The D. Melanogaster 40s Ribosomal Proteins
 gb|AAF46862.1| ribosomal protein S16, isoform A [Drosophila melanogaster]
 gb|AAL48142.1| RH07540p [Drosophila melanogaster]
 gb|AAR09824.1| similar to Drosophila melanogaster CG4046, partial [Drosophila 
yakuba]
 gb|AAR10088.1| similar to Drosophila melanogaster CG4046, partial [Drosophila 
yakuba]
 gb|EDV54907.1| GG21057 [Drosophila erecta]
 gb|EDW56788.1| GM15924 [Drosophila sechellia]
 gb|EDW91804.1| GE13998 [Drosophila yakuba]
 gb|EDX08219.1| GD11679 [Drosophila simulans]
 gb|ACL87137.1| RpS16-PA, partial [synthetic construct]
 gb|AHN56526.1| ribosomal protein S16, isoform B [Drosophila melanogaster]
Length=148

 Score =   230 bits (586),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            PV++VQ FGRKKTA AV +CKRG GL+K+NG P+E I+P++L+YK  EP+LLLG+ +FAG
Sbjct  8    PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAG  67

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            VD+R+RV GGGH +QIYAIRQ+I+KALVAFYQKYVDE SKKEIKDILV+YDRTLLV DPR
Sbjct  68   VDIRVRVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPR  127

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCEPKKFGG GARAR+QKSYR
Sbjct  128  RCEPKKFGGPGARARYQKSYR  148



>tpe|CBF70472.1| TPA: 40S ribosomal protein S16 (Broad) [Aspergillus nidulans 
FGSC A4]
Length=143

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  543  APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA  364
            A V SVQCFG+KKTA AV HCK+G+GLIK+NG P++L+QPEILR+KA+EP+L++G  +FA
Sbjct  2    ASVPSVQCFGKKKTATAVAHCKQGKGLIKVNGQPLQLVQPEILRFKAYEPVLIVGADKFA  61

Query  363  GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP  184
            GVD+R+RV GGGHTSQ+YAIRQ+IAK+LVA+YQKYVDE SK ++K   V+YDRTLLVAD 
Sbjct  62   GVDIRVRVTGGGHTSQVYAIRQAIAKSLVAYYQKYVDEHSKNQLKQAFVQYDRTLLVADN  121

Query  183  RRCEPKKFGGRGARARFQKSYR  118
            RR EPKKFGGRGARAR+QKSYR
Sbjct  122  RRAEPKKFGGRGARARYQKSYR  143



>ref|XP_001360809.1| GA17915 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002016468.1| GL11589 [Drosophila persimilis]
 ref|XP_002068681.1| GK17896 [Drosophila willistoni]
 gb|EAL25384.1| GA17915 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW32358.1| GL11589 [Drosophila persimilis]
 gb|EDW79667.1| GK17896 [Drosophila willistoni]
Length=148

 Score =   229 bits (585),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  540  PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG  361
            PV++VQ FGRKKTA AV +CKRG GL+K+NG P+E I+P++L+YK  EP+LLLG+ +FAG
Sbjct  8    PVQAVQVFGRKKTATAVAYCKRGSGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAG  67

Query  360  VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR  181
            VD+R+RV GGGH +QIYAIRQ+I+KALVAFYQKYVDE SKKEIKDILV+YDRTLLV DPR
Sbjct  68   VDIRVRVNGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPR  127

Query  180  RCEPKKFGGRGARARFQKSYR  118
            RCEPKKFGG GARAR+QKSYR
Sbjct  128  RCEPKKFGGPGARARYQKSYR  148



>gb|EAW56893.1| ribosomal protein S16, isoform CRA_b [Homo sapiens]
Length=145

 Score =   229 bits (585),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRK TA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRK-TATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKER  61

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  62   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  121

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  122  DPRRCESKKFGGPGARARYQKSYR  145



>ref|XP_003579002.1| PREDICTED: 40S ribosomal protein S16-like [Brachypodium distachyon]
Length=149

 Score =   229 bits (585),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  531  SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM  352
            SVQCFGRKKTAVAV + K GRGLIK+NG PIELI+PE+LR KAFEPILL GR RF  +DM
Sbjct  12   SVQCFGRKKTAVAVAYTKPGRGLIKVNGAPIELIRPEMLRLKAFEPILLAGRSRFKDIDM  71

Query  351  RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE  172
            RIRV+GGG TSQ+YAIRQ+IAK LV++ QKYVDE +KKE KDI  RYDRTLLVADPRRCE
Sbjct  72   RIRVRGGGKTSQMYAIRQAIAKGLVSYLQKYVDEAAKKEAKDIFARYDRTLLVADPRRCE  131

Query  171  PKKFGGRGARARFQKSYR  118
            PKKFGGRGARARFQKSYR
Sbjct  132  PKKFGGRGARARFQKSYR  149



>gb|AAA03646.1| 16S ribosomal protein [Mus musculus]
Length=145

 Score =   229 bits (584),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            +  P++SVQ FGRKKT +AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct  3    SKGPLQSVQVFGRKKT-LAVAHCKRGNGLIKVNGRPLEMIEPRALQYKLLEPVLLLGKER  61

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct  62   FAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA  121

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCE KKFGG GARAR+QKSYR
Sbjct  122  DPRRCESKKFGGPGARARYQKSYR  145



>gb|EIE79686.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
 gb|EIE87914.1| 40S ribosomal protein S16 [Rhizopus delemar RA 99-880]
 emb|CEG79844.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEG74055.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEG63589.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEJ02528.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEI97109.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
 emb|CEI88407.1| Putative 40S ribosomal protein S16 [Rhizopus microsporus]
Length=140

 Score =   229 bits (583),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            +E+VQ FGRKKTA AV HCKRGRGLI+ING P+EL++PEIL++K +E ILLLG  RFA V
Sbjct  1    MEAVQTFGRKKTATAVAHCKRGRGLIRINGSPLELLEPEILKFKVYEVILLLGEERFANV  60

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIR  GGGH SQ+YAIRQ++AKA+VAFYQKYVDE +KKEIK+ILV+YDRTLLVADPRR
Sbjct  61   DIRIRTHGGGHVSQVYAIRQALAKAIVAFYQKYVDEAAKKEIKEILVQYDRTLLVADPRR  120

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKF G GARAR+QKSYR
Sbjct  121  CEPKKFAGPGARARYQKSYR  140



>ref|XP_002949171.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ49664.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=142

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
             +SVQ FGRKKTAVAV +CK+G GLIK+NG P+EL++PE LR+K FEPIL++GR +   +
Sbjct  3    TQSVQTFGRKKTAVAVAYCKQGNGLIKLNGQPLELVKPEALRFKVFEPILVIGRQKVKNL  62

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+R+RVKGGGH SQIYA+RQ+IAKA+VAFYQKYVDEQSK++IKD L+++DRTLLVADPRR
Sbjct  63   DIRLRVKGGGHVSQIYALRQAIAKAVVAFYQKYVDEQSKQQIKDALLQFDRTLLVADPRR  122

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGGRGARARFQKSYR
Sbjct  123  CEPKKFGGRGARARFQKSYR  142



>gb|ABW23146.1| ribosomal protein rps16 [Arenicola marina]
Length=147

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  549  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR  370
            ++ P +SVQ +GRKKT+ AV HCKRG GL+K+NG P++ ++PE+LR+K  EP+LLLG+ R
Sbjct  4    SSVPSQSVQVYGRKKTSTAVAHCKRGNGLLKVNGRPLDQLEPELLRFKLQEPVLLLGKER  63

Query  369  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA  190
            FAGVD+R+RVKGGGH +Q+YAIRQ+I+KALVA+YQKYVDE SKKEIKDIL+ YDRTLLVA
Sbjct  64   FAGVDIRVRVKGGGHVAQVYAIRQAISKALVAYYQKYVDEASKKEIKDILIAYDRTLLVA  123

Query  189  DPRRCEPKKFGGRGARARFQKSYR  118
            DPRRCEPKKFGG G RAR+QKSYR
Sbjct  124  DPRRCEPKKFGGPGPRARYQKSYR  147



>gb|ABI52717.1| ribosomal protein S16 [Argas monolakensis]
Length=152

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  537  VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV  358
            + +VQ FGRKKTA AV +CKRGRGL+K+NG P+E I+P  LRYK  EPILLLG+ RFAGV
Sbjct  13   LPTVQVFGRKKTATAVAYCKRGRGLLKVNGRPLENIEPLTLRYKLLEPILLLGKERFAGV  72

Query  357  DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR  178
            D+RIRVKGGG+ +Q+YA+RQ+++KALVA+YQKYVDEQSKKEIKDIL++YDRTLLVADPRR
Sbjct  73   DIRIRVKGGGNVAQMYAVRQALSKALVAYYQKYVDEQSKKEIKDILIQYDRTLLVADPRR  132

Query  177  CEPKKFGGRGARARFQKSYR  118
            CEPKKFGG GARAR+QKSYR
Sbjct  133  CEPKKFGGPGARARYQKSYR  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250