BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007O08

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   239   3e-72   Citrus sinensis [apfelsine]
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    237   5e-72   Citrus sinensis [apfelsine]
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    237   6e-72   Vitis vinifera
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   237   6e-72   Citrus sinensis [apfelsine]
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    237   7e-72   Vitis vinifera
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    237   7e-72   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   237   8e-72   Citrus sinensis [apfelsine]
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   237   9e-72   Citrus sinensis [apfelsine]
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             236   2e-71   Citrus clementina [clementine]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             236   2e-71   Citrus clementina [clementine]
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             236   2e-71   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    235   2e-71   
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          233   2e-70   Eucalyptus grandis [rose gum]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   233   2e-70   Citrus sinensis [apfelsine]
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                234   2e-70   Morus notabilis
ref|XP_002529115.1|  uv excision repair protein rad23, putative         232   6e-70   Ricinus communis
ref|NP_001242098.1|  uncharacterized protein LOC100813881               231   9e-70   
ref|NP_001240201.1|  uncharacterized protein LOC100809066               231   1e-69   Glycine max [soybeans]
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    231   1e-69   
gb|KHG17760.1|  Putative DNA repair RAD23-3 -like protein               225   1e-69   Gossypium arboreum [tree cotton]
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    231   1e-69   
gb|ACU18529.1|  unknown                                                 230   1e-69   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    231   1e-69   
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             229   2e-69   
gb|KJB79994.1|  hypothetical protein B456_013G076500                    230   2e-69   Gossypium raimondii
gb|KJB79998.1|  hypothetical protein B456_013G076800                    229   3e-69   Gossypium raimondii
gb|KJB80000.1|  hypothetical protein B456_013G076800                    229   4e-69   Gossypium raimondii
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    230   4e-69   Glycine max [soybeans]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         229   6e-69   Jatropha curcas
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    229   6e-69   Populus euphratica
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    231   6e-69   Glycine max [soybeans]
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    231   7e-69   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     229   7e-69   Glycine soja [wild soybean]
gb|KJB79996.1|  hypothetical protein B456_013G076600                    227   7e-69   Gossypium raimondii
ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    229   9e-69   Nicotiana tomentosiformis
gb|KJB80005.1|  hypothetical protein B456_013G076900                    228   1e-68   Gossypium raimondii
gb|KJB79995.1|  hypothetical protein B456_013G076600                    228   1e-68   Gossypium raimondii
gb|KJB80004.1|  hypothetical protein B456_013G076900                    228   1e-68   Gossypium raimondii
emb|CDP19777.1|  unnamed protein product                                228   2e-68   Coffea canephora [robusta coffee]
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    227   2e-68   
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    227   3e-68   Populus euphratica
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               228   3e-68   Glycine max [soybeans]
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    227   3e-68   Populus euphratica
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     227   4e-68   Glycine soja [wild soybean]
ref|XP_011035054.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    225   4e-68   Populus euphratica
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    226   7e-68   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   8e-68   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    226   8e-68   Populus euphratica
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               226   1e-67   Prunus mume [ume]
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             226   1e-67   Phaseolus vulgaris [French bean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             226   1e-67   Phaseolus vulgaris [French bean]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             225   1e-67   Prunus persica
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          225   2e-67   Sesamum indicum [beniseed]
gb|AFK43607.1|  unknown                                                 220   2e-67   Lotus japonicus
ref|XP_002516727.1|  uv excision repair protein rad23, putative         225   2e-67   Ricinus communis
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          225   2e-67   Populus euphratica
ref|XP_002305813.1|  ubiquitin family protein                           225   2e-67   Populus trichocarpa [western balsam poplar]
emb|CDP02781.1|  unnamed protein product                                224   3e-67   Coffea canephora [robusta coffee]
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          226   3e-67   
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    225   3e-67   Fragaria vesca subsp. vesca
ref|XP_006378490.1|  hypothetical protein POPTR_0010s13610g             223   3e-67   
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               224   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    225   4e-67   Fragaria vesca subsp. vesca
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    224   4e-67   Cicer arietinum [garbanzo]
gb|EPS71284.1|  hypothetical protein M569_03474                         224   4e-67   Genlisea aurea
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             224   4e-67   
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          224   4e-67   
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          224   7e-67   
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    223   8e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    223   8e-67   Nelumbo nucifera [Indian lotus]
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   223   1e-66   Citrus sinensis [apfelsine]
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          223   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               223   2e-66   Solanum lycopersicum
gb|KEH44233.1|  RAD23 UV excision repair family protein                 223   2e-66   Medicago truncatula
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   2e-66   Sesamum indicum [beniseed]
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    225   2e-66   
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    222   2e-66   Nicotiana sylvestris
ref|XP_009622421.1|  PREDICTED: ubiquitin receptor RAD23d-like          216   2e-66   Nicotiana tomentosiformis
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          222   3e-66   Solanum tuberosum [potatoes]
gb|ABD96960.1|  hypothetical protein                                    223   3e-66   Tarenaya spinosa
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             222   3e-66   Prunus persica
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                221   3e-66   Erythranthe guttata [common monkey flower]
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    221   4e-66   Nicotiana sylvestris
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               221   5e-66   
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    221   5e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    221   6e-66   Populus euphratica
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          221   6e-66   
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    221   6e-66   Populus euphratica
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             221   6e-66   Prunus persica
ref|XP_006383464.1|  ubiquitin family protein                           221   6e-66   
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               221   7e-66   Vitis vinifera
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             221   7e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                225   7e-66   
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    221   8e-66   Populus euphratica
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    221   9e-66   Populus euphratica
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          221   9e-66   Citrus sinensis [apfelsine]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               221   1e-65   Nicotiana sylvestris
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                  220   1e-65   Citrus sinensis [apfelsine]
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    219   1e-65   Populus euphratica
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          221   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             221   2e-65   
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             220   2e-65   Citrus clementina [clementine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          220   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    219   4e-65   Nicotiana tomentosiformis
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               220   4e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    219   5e-65   Nicotiana sylvestris
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          218   5e-65   Tarenaya hassleriana [spider flower]
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    217   1e-64   Nicotiana tomentosiformis
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    217   1e-64   Nicotiana sylvestris
gb|ABB02636.1|  RAD23-like                                              217   2e-64   Solanum tuberosum [potatoes]
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             217   3e-64   Capsella rubella
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    217   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    216   4e-64   Solanum lycopersicum
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    216   4e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    216   4e-64   Solanum lycopersicum
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             216   4e-64   Eutrema salsugineum [saltwater cress]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             218   4e-64   Capsella rubella
ref|NP_198663.1|  ubiquitin receptor RAD23d                             216   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408408.1|  hypothetical protein EUTSA_v10020817mg             215   6e-64   
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        216   7e-64   Nicotiana tabacum [American tobacco]
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    215   7e-64   Solanum lycopersicum
gb|AAK59766.1|  unknown protein                                         215   9e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    216   9e-64   Tarenaya hassleriana [spider flower]
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   9e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             215   1e-63   
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          215   1e-63   Amborella trichopoda
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          215   1e-63   Phoenix dactylifera
ref|NP_001274760.1|  uncharacterized protein LOC102577665               215   1e-63   Solanum tuberosum [potatoes]
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    216   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    216   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             216   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_008368492.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   2e-63   
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    214   3e-63   Elaeis guineensis
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    214   3e-63   Elaeis guineensis
dbj|BAC76393.1|  RAD23-like protein                                     213   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               214   3e-63   Brassica rapa
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                215   4e-63   Erythranthe guttata [common monkey flower]
emb|CDX67404.1|  BnaA07g14440D                                          213   5e-63   
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          213   5e-63   Nelumbo nucifera [Indian lotus]
ref|NP_186903.1|  UV excision repair protein RAD23C                     214   5e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58121.1|  BnaCnng32650D                                          213   6e-63   Brassica napus [oilseed rape]
ref|NP_001189793.1|  UV excision repair protein RAD23C                  214   6e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   8e-63   Phoenix dactylifera
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    213   9e-63   
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    214   9e-63   
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    215   9e-63   
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    214   9e-63   Phoenix dactylifera
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    212   9e-63   
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    213   1e-62   Phoenix dactylifera
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    213   1e-62   Phoenix dactylifera
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          212   2e-62   Elaeis guineensis
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    211   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    211   3e-62   Camelina sativa [gold-of-pleasure]
emb|CDY01661.1|  BnaC04g30910D                                          211   3e-62   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               211   3e-62   Brassica rapa
emb|CDX74522.1|  BnaA04g08670D                                          211   3e-62   
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    212   7e-62   Arabis alpina [alpine rockcress]
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    211   8e-62   Arabis alpina [alpine rockcress]
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          211   8e-62   Elaeis guineensis
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    210   1e-61   Arabis alpina [alpine rockcress]
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          209   2e-61   Pyrus x bretschneideri [bai li]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                209   3e-61   Erythranthe guttata [common monkey flower]
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                209   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          210   4e-61   Cucumis melo [Oriental melon]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          207   7e-61   
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       208   1e-60   Cucumis sativus [cucumbers]
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    206   3e-60   Tarenaya hassleriana [spider flower]
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    206   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               206   7e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          206   7e-60   
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          205   8e-60   Pyrus x bretschneideri [bai li]
emb|CDX74251.1|  BnaA03g27960D                                          206   8e-60   
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          205   9e-60   
emb|CDX91998.1|  BnaC03g33000D                                          205   1e-59   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               205   1e-59   Brassica rapa
emb|CAA72741.1|  RAD23, isoform I                                       204   1e-59   Daucus carota [carrots]
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    202   7e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    201   9e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    202   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    202   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    202   2e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    202   2e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN40029.1|  unknown                                                 201   5e-58   Picea sitchensis
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    200   1e-57   Elaeis guineensis
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    200   1e-57   Elaeis guineensis
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          198   7e-57   Oryza brachyantha
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          197   2e-56   
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...    196   4e-56   Setaria italica
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    195   4e-56   Cicer arietinum [garbanzo]
dbj|BAJ98767.1|  predicted protein                                      196   5e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ00429.1|  hypothetical protein OsI_22453                          196   6e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001057334.1|  Os06g0264300                                       195   8e-56   
gb|EMT27109.1|  Putative DNA repair protein RAD23                       194   2e-55   
gb|EMS61794.1|  putative DNA repair protein RAD23                       194   2e-55   Triticum urartu
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          194   4e-55   Brachypodium distachyon [annual false brome]
gb|ACG32894.1|  DNA repair protein RAD23                                193   4e-55   Zea mays [maize]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 192   7e-55   Medicago truncatula
gb|EAZ07072.1|  hypothetical protein OsI_29318                          192   8e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          191   2e-54   Fragaria vesca subsp. vesca
ref|NP_001061854.1|  Os08g0430200                                       191   3e-54   
ref|NP_001149140.1|  LOC100282762                                       191   5e-54   Zea mays [maize]
ref|NP_001266655.1|  DNA repair protein RAD23                           189   2e-53   
ref|NP_001142065.1|  uncharacterized protein LOC100274222               189   2e-53   Zea mays [maize]
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1                189   3e-53   
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein               186   8e-53   Gossypium arboreum [tree cotton]
gb|KJB69952.1|  hypothetical protein B456_011G053200                    186   1e-52   Gossypium raimondii
gb|ABK24371.1|  unknown                                                 186   2e-52   Picea sitchensis
gb|ACH72675.1|  RAD23                                                   186   2e-52   Pinus sylvestris var. mongolica
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...    186   2e-52   
gb|KJB34920.1|  hypothetical protein B456_006G091100                    186   2e-52   Gossypium raimondii
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    186   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_009797066.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    183   2e-52   Nicotiana sylvestris
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    186   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    186   3e-52   Eucalyptus grandis [rose gum]
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    186   3e-52   Eucalyptus grandis [rose gum]
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    185   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    185   4e-52   Eucalyptus grandis [rose gum]
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b               184   5e-52   Fragaria vesca subsp. vesca
gb|KJB69954.1|  hypothetical protein B456_011G053200                    183   5e-52   Gossypium raimondii
gb|KDP41924.1|  hypothetical protein JCGZ_26942                         184   6e-52   Jatropha curcas
ref|XP_006427690.1|  hypothetical protein CICLE_v100258682mg            182   9e-52   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110          184   9e-52   Amborella trichopoda
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like          184   1e-51   Citrus sinensis [apfelsine]
gb|KJB34921.1|  hypothetical protein B456_006G091100                    182   1e-51   Gossypium raimondii
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    183   2e-51   Nicotiana sylvestris
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    183   2e-51   Nicotiana sylvestris
emb|CBI25247.3|  unnamed protein product                                184   2e-51   Vitis vinifera
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b               184   2e-51   Vitis vinifera
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    182   2e-51   Nicotiana tomentosiformis
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    182   2e-51   Nicotiana tomentosiformis
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg             182   3e-51   Prunus persica
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   3e-51   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   3e-51   Prunus mume [ume]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein               182   4e-51   Gossypium arboreum [tree cotton]
ref|XP_008381164.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    180   5e-51   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like          182   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_002303970.1|  DNA repair protein RAD23                           181   1e-50   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like          181   1e-50   Populus euphratica
gb|AFK37577.1|  unknown                                                 181   1e-50   Lotus japonicus
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    181   1e-50   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g             181   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a      180   1e-50   Brassica rapa
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like          180   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    180   3e-50   Nelumbo nucifera [Indian lotus]
emb|CDX81753.1|  BnaC08g38480D                                          179   3e-50   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like          179   5e-50   Solanum tuberosum [potatoes]
ref|NP_001063134.1|  Os09g0407200                                       179   9e-50   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g             179   9e-50   
ref|XP_002299163.1|  DNA repair protein RAD23                           178   1e-49   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like          179   1e-49   Populus euphratica
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       179   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b               178   1e-49   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like          177   3e-49   Sesamum indicum [beniseed]
ref|XP_001763027.1|  predicted protein                                  177   3e-49   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    177   4e-49   Nicotiana sylvestris
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    177   4e-49   Nicotiana sylvestris
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b               177   4e-49   Nicotiana tomentosiformis
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599             176   7e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a      176   1e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB65841.1|  osRAD23                                                 176   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    176   2e-48   Setaria italica
gb|KHF97937.1|  Putative DNA repair RAD23-4 -like protein               166   2e-48   Gossypium arboreum [tree cotton]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...    174   3e-48   Cucumis sativus [cucumbers]
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like          174   3e-48   Cucumis melo [Oriental melon]
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g             174   4e-48   Phaseolus vulgaris [French bean]
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg             174   4e-48   Capsella rubella
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...    174   4e-48   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427              174   6e-48   
gb|EMT30328.1|  Putative DNA repair protein RAD23                       175   8e-48   
gb|AEA86336.1|  putative DNA repair protein                             167   1e-47   Solanum nigrum
gb|ACU20959.1|  unknown                                                 173   1e-47   Glycine max [soybeans]
dbj|BAC76391.1|  RAD23-like protein                                     172   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240038.1|  uncharacterized protein LOC100819019               172   2e-47   Glycine max [soybeans]
ref|NP_173070.1|  DNA repair protein RAD23A                             172   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850982.1|  ubiquitin receptor RAD23b                             172   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein               172   2e-47   Gossypium arboreum [tree cotton]
emb|CDO98260.1|  unnamed protein product                                172   2e-47   
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    172   2e-47   
ref|NP_565216.2|  ubiquitin receptor RAD23b                             172   3e-47   
gb|ABG89119.1|  Rad23-3Ai                                               172   3e-47   
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644              172   3e-47   
ref|XP_002512770.1|  uv excision repair protein rad23, putative         172   3e-47   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg                172   3e-47   
tpg|DAA40043.1|  TPA: hypothetical protein ZEAMMB73_722140              168   3e-47   
gb|EMS50196.1|  putative DNA repair protein RAD23                       176   4e-47   
gb|AEA86337.1|  putative DNA repair protein                             166   4e-47   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g             171   6e-47   
tpg|DAA61380.1|  TPA: hypothetical protein ZEAMMB73_350633              167   6e-47   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                          171   7e-47   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a      171   7e-47   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a      171   8e-47   
gb|ACF79443.1|  unknown                                                 171   9e-47   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...    171   9e-47   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg             170   1e-46   
ref|NP_001149553.1|  LOC100283179                                       171   1e-46   
ref|XP_008462954.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2    170   1e-46   
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...    170   2e-46   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1    170   2e-46   
gb|ACJ83410.1|  unknown                                                 163   2e-46   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                       170   2e-46   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...    170   2e-46   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633              170   2e-46   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...    169   2e-46   
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                     169   2e-46   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                     171   3e-46   
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    169   3e-46   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857             169   4e-46   
emb|CDY35071.1|  BnaA06g10810D                                          169   4e-46   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg             169   5e-46   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1                 170   5e-46   
ref|XP_003637292.1|  RAD23 protein                                      164   5e-46   
dbj|BAC76389.1|  RAD23-like protein                                     168   6e-46   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b               168   6e-46   
dbj|BAC76390.1|  RAD23-like protein                                     168   7e-46   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a      167   2e-45   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b               167   2e-45   
ref|XP_003637291.1|  RAD23 protein                                      167   2e-45   
gb|AAD34676.1|AC006341_4  Similar to gb|Y12014 RAD23 protein isof...    159   3e-45   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...    166   3e-45   
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like          167   3e-45   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...    166   4e-45   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    166   6e-45   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    166   6e-45   
emb|CDY33351.1|  BnaC05g12320D                                          166   6e-45   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg             166   7e-45   
ref|XP_008649304.1|  PREDICTED: ubiquitin receptor RAD23d-like          157   1e-44   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    165   1e-44   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    165   2e-44   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    165   2e-44   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like          164   2e-44   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                    164   2e-44   
gb|AFW87603.1|  hypothetical protein ZEAMMB73_681598                    156   3e-44   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like          161   4e-43   
ref|XP_001780766.1|  predicted protein                                  161   6e-43   
ref|XP_001752264.1|  predicted protein                                  153   7e-43   
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like          159   2e-42   
emb|CAA72742.1|  RAD23 protein, isoform II                              159   2e-42   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...    159   2e-42   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b               158   4e-42   
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    158   7e-42   
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    157   7e-42   
emb|CDX79333.1|  BnaC06g19700D                                          158   8e-42   
ref|XP_006598286.1|  PREDICTED: ubiquitin receptor RAD23b-like          156   8e-42   
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    157   9e-42   
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    157   1e-41   
dbj|BAK04690.1|  predicted protein                                      156   3e-41   
gb|EEC72612.1|  hypothetical protein OsI_06092                          155   4e-41   
ref|NP_001046083.1|  Os02g0179300                                       155   4e-41   
emb|CDX67983.1|  BnaA07g20230D                                          156   6e-41   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2                 154   2e-40   
ref|NP_001148810.1|  LOC100282427                                       154   2e-40   
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   154   2e-40   
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    153   3e-40   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370          153   3e-40   
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...    153   4e-40   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like          151   2e-39   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    150   5e-39   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    150   6e-39   
gb|AAF68123.1|AC010793_18  F20B17.8                                     144   7e-37   
dbj|BAC76395.1|  RAD23-like protein                                     142   2e-36   
ref|NP_974181.1|  ubiquitin receptor RAD23b                             139   3e-35   
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    137   3e-34   
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    137   3e-34   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                     131   1e-31   
dbj|BAJ97496.1|  predicted protein                                      129   3e-31   
gb|ACG24239.1|  hypothetical protein                                    122   5e-31   
gb|EMT03590.1|  Putative DNA repair protein RAD23-1                     125   1e-30   
emb|CAB65692.1|  Rad23 Protein                                          119   1e-30   
gb|KJB69953.1|  hypothetical protein B456_011G053200                    124   7e-30   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                     124   3e-29   
ref|XP_005708114.1|  nucleotide excision repair protein                 123   8e-29   
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                    122   9e-29   
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg                117   5e-27   
gb|KHF98435.1|  Putative DNA repair RAD23-4 -like protein               109   1e-26   
gb|EPS72838.1|  hypothetical protein M569_01918                         115   1e-26   
ref|XP_002432231.1|  uv excision repair protein rad23, putative         115   2e-26   
ref|XP_010210284.1|  PREDICTED: UV excision repair protein RAD23 ...    115   2e-26   
gb|EIE84327.1|  UV excision repair protein Rad23                        115   3e-26   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    115   3e-26   
gb|KGL75456.1|  UV excision repair protein RAD23 B                      115   4e-26   
ref|XP_007884175.1|  PREDICTED: UV excision repair protein RAD23 ...    114   6e-26   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...    114   1e-25   
ref|XP_010074164.1|  PREDICTED: UV excision repair protein RAD23 ...    112   2e-25   
dbj|BAM18172.1|  UV excision repair protein rad23                       111   2e-25   
emb|CDQ83149.1|  unnamed protein product                                112   2e-25   
emb|CDQ90828.1|  unnamed protein product                                112   2e-25   
gb|KFU98476.1|  UV excision repair protein RAD23 B                      112   2e-25   
ref|XP_003081625.1|  Nucleotide excision repair factor NEF2, RAD2...    110   3e-25   
ref|XP_010873253.1|  PREDICTED: UV excision repair protein RAD23 ...    112   3e-25   
emb|CEF99377.1|  UBA-like                                               111   6e-25   
ref|XP_010306604.1|  PREDICTED: UV excision repair protein RAD23 ...    106   9e-25   
ref|XP_009933661.1|  PREDICTED: UV excision repair protein RAD23 ...    110   1e-24   
ref|XP_002444377.1|  hypothetical protein SORBIDRAFT_07g020960          106   1e-24   
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    110   1e-24   
ref|XP_006627060.1|  PREDICTED: UV excision repair protein RAD23 ...    110   1e-24   
ref|XP_003739932.1|  PREDICTED: UV excision repair protein RAD23 ...    110   1e-24   
ref|XP_002503857.1|  predicted protein                                  110   1e-24   
dbj|BAM19254.1|  UV excision repair protein rad23                       110   1e-24   
ref|XP_010284737.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-24   
gb|KDO46128.1|  hypothetical protein CISIN_1g0198172mg                  103   1e-24   
ref|XP_010161922.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-24   
ref|XP_009977358.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-24   
gb|KJB80001.1|  hypothetical protein B456_013G076800                    109   2e-24   
ref|XP_009958718.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-24   
ref|XP_005818125.1|  Rad23 nucleotide excision repair protein bin...    109   3e-24   
gb|KFV93588.1|  UV excision repair protein RAD23 B                      107   3e-24   
ref|XP_005646102.1|  UV excision repair protein Rad23                   109   3e-24   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...    109   3e-24   
ref|XP_010150954.1|  PREDICTED: UV excision repair protein RAD23 ...    107   3e-24   
ref|XP_005240425.1|  PREDICTED: UV excision repair protein RAD23 ...    109   3e-24   
ref|XP_002114015.1|  hypothetical protein TRIADDRAFT_58050              109   3e-24   
ref|XP_005502851.1|  PREDICTED: UV excision repair protein RAD23 ...    108   4e-24   
gb|KFP28504.1|  UV excision repair protein RAD23 B                      108   4e-24   
ref|XP_009819016.1|  PREDICTED: UV excision repair protein RAD23 ...    108   4e-24   
ref|XP_005062233.1|  PREDICTED: UV excision repair protein RAD23 ...    108   4e-24   
ref|XP_010208101.1|  PREDICTED: UV excision repair protein RAD23 ...    108   4e-24   
gb|KFV42406.1|  UV excision repair protein RAD23 B                      108   4e-24   
ref|XP_009096530.1|  PREDICTED: UV excision repair protein RAD23 ...    108   4e-24   
ref|XP_005428092.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
gb|EMC77210.1|  UV excision repair protein RAD23 like protein B         108   5e-24   
ref|XP_011400685.1|  putative ubiquitin receptor RAD23a                 107   5e-24   
ref|XP_008639793.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    108   5e-24   
ref|XP_009873289.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
gb|KFV48041.1|  UV excision repair protein RAD23 B                      108   5e-24   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
ref|XP_005446959.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
ref|XP_010125653.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
ref|XP_010403980.1|  PREDICTED: UV excision repair protein RAD23 ...    108   5e-24   
gb|KFP54135.1|  UV excision repair protein RAD23 B                      108   5e-24   
gb|KFP78669.1|  UV excision repair protein RAD23 B                      108   6e-24   
ref|XP_010403981.1|  PREDICTED: UV excision repair protein RAD23 ...    108   6e-24   
gb|KFQ93153.1|  UV excision repair protein RAD23 B                      108   6e-24   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...    108   6e-24   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...    108   6e-24   
ref|XP_007875448.1|  UV excision repair protein Rad23                   108   6e-24   
gb|KFP45297.1|  UV excision repair protein RAD23 B                      108   6e-24   
ref|XP_009475490.1|  PREDICTED: UV excision repair protein RAD23 ...    108   6e-24   
ref|XP_009284591.1|  PREDICTED: UV excision repair protein RAD23 ...    108   7e-24   
ref|XP_009643344.1|  PREDICTED: UV excision repair protein RAD23 ...    108   7e-24   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...    108   7e-24   
ref|XP_009996457.1|  PREDICTED: UV excision repair protein RAD23 ...    108   8e-24   
ref|XP_003396747.1|  PREDICTED: UV excision repair protein RAD23 ...    108   8e-24   
gb|KFM01514.1|  UV excision repair protein RAD23 B                      108   8e-24   
gb|KFP09954.1|  UV excision repair protein RAD23 B                      108   8e-24   
ref|XP_008921937.1|  PREDICTED: UV excision repair protein RAD23 ...    107   9e-24   
ref|XP_010143171.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
gb|KFU90019.1|  UV excision repair protein RAD23 B                      108   1e-23   
ref|XP_009886968.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
ref|XP_009501627.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
gb|KFW80798.1|  UV excision repair protein RAD23 B                      108   1e-23   
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          107   1e-23   
ref|XP_001366912.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    107   1e-23   
ref|XP_010011187.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
ref|XP_008495758.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
gb|KGL96224.1|  UV excision repair protein RAD23 B                      107   1e-23   
ref|XP_009704807.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
ref|XP_009964886.1|  PREDICTED: UV excision repair protein RAD23 ...    109   1e-23   
ref|XP_005013373.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...    108   1e-23   
gb|KFW73791.1|  UV excision repair protein RAD23 B                      107   1e-23   
gb|KFQ43918.1|  UV excision repair protein RAD23 B                      107   1e-23   
gb|KFP03775.1|  UV excision repair protein RAD23 B                      107   1e-23   
ref|XP_006631678.1|  PREDICTED: UV excision repair protein RAD23 ...    107   1e-23   
ref|XP_001625753.1|  predicted protein                                  107   1e-23   
ref|XP_010724307.1|  PREDICTED: UV excision repair protein RAD23 ...    106   1e-23   
gb|AFM90454.1|  UV excision repair protein RAD23-like B isoform 5       107   1e-23   
ref|XP_003964320.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
ref|XP_009070739.1|  PREDICTED: UV excision repair protein RAD23 ...    105   2e-23   
ref|XP_009905224.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
gb|KFP68145.1|  UV excision repair protein RAD23 B                      107   2e-23   
ref|XP_009579770.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
gb|KFV72415.1|  UV excision repair protein RAD23 B                      107   2e-23   
ref|XP_003705649.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
ref|XP_009563003.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
gb|AFM90973.1|  UV excision repair protein RAD23-like protein B i...    107   2e-23   
ref|NP_001279327.1|  UV excision repair protein RAD23 homolog B-like    107   2e-23   
gb|AFK10816.1|  UV excision repair protein RAD23-like protein           107   2e-23   
gb|KFO78985.1|  UV excision repair protein RAD23 B                      107   2e-23   
gb|KFW08178.1|  UV excision repair protein RAD23 B                      107   2e-23   
gb|KFP78177.1|  UV excision repair protein RAD23 B                      105   2e-23   
emb|CAF91196.1|  unnamed protein product                                106   2e-23   
ref|XP_003424606.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
ref|XP_009685841.1|  PREDICTED: UV excision repair protein RAD23 ...    107   2e-23   
gb|KFP93964.1|  UV excision repair protein RAD23 B                      107   2e-23   
ref|XP_002172209.1|  Rad23 Rhp23                                        107   2e-23   
emb|CEJ00468.1|  Putative UV excision repair protein Rad23              103   2e-23   
ref|XP_010566855.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-23   
ref|XP_009915463.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-23   
gb|KFM76006.1|  UV excision repair protein RAD23-like protein           102   2e-23   
ref|XP_011307626.1|  PREDICTED: UV excision repair protein RAD23 ...    106   2e-23   
gb|KFV87804.1|  UV excision repair protein RAD23 B                      107   3e-23   
ref|XP_008938608.1|  PREDICTED: UV excision repair protein RAD23 ...    106   3e-23   
ref|XP_005994200.1|  PREDICTED: UV excision repair protein RAD23 ...    106   3e-23   
gb|ERL95011.1|  hypothetical protein D910_12282                         108   3e-23   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...    106   4e-23   
gb|KFQ29720.1|  UV excision repair protein RAD23 B                      106   4e-23   



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 119/125 (95%), Gaps = 2/125 (2%)
 Frame = -3

Query  628  FLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE  449
            F LLF  QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGE
Sbjct  308  FRLLF--QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGE  365

Query  448  GNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  269
            GN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM
Sbjct  366  GNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHM  425

Query  268  HEFED  254
            HEFED
Sbjct  426  HEFED  430



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  280  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  339

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  340  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQL
Sbjct  280  QFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQL  339

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  340  AAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  286  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  345

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  346  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/118 (97%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGNILGQL
Sbjct  281  QFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNILGQL  340

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQAV VTPEEREAI RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  341  AAAMPQAVTVTPEEREAIARLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  279  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  338

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  339  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  285  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  344

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  345  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  402



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  286  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  345

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  346  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  403



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  284  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  344  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  283  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  342

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  343  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  400



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  284  QFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  344  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  401



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP EGGEGNILGQL
Sbjct  268  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPAEGGEGNILGQL  327

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  328  AEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHEFED  385



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP+EGGEGNILGQL
Sbjct  284  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPLEGGEGNILGQL  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+SMPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HE+ED
Sbjct  344  ASSMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEYED  401



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LG
Sbjct  278  SQQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLG  337

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  338  QLASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  397



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEGN+LGQL
Sbjct  302  QFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGNLLGQL  361

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            +A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF+D
Sbjct  362  SAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDD  419



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEPVEGGEGNI+GQL
Sbjct  292  QFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQTDFLRLINEPVEGGEGNIMGQL  351

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQAV VTPEEREAIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  352  AAAMPQAVTVTPEEREAIERLEAMGFDRGLVLEVFFACNKNEELAANYLLDHMHEFED  409



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  283  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  342

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  343  AGTMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  400



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  275  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  334

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  335  ASAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  392



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  265  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  324

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  325  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>gb|KHG17760.1| Putative DNA repair RAD23-3 -like protein [Gossypium arboreum]
Length=222

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG  446
             L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEG
Sbjct  99   FLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEG  158

Query  445  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  266
            NILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH
Sbjct  159  NILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMH  218

Query  265  EFED  254
            +F+D
Sbjct  219  DFQD  222



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  266  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  325

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  326  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  383



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  265  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  324

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  325  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  284  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  344  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  401



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/116 (96%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE GEGN+LGQL
Sbjct  218  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVESGEGNVLGQL  277

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            AA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  278  AAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  333



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG  446
             L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEG
Sbjct  261  FLRNSPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEG  320

Query  445  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  266
            NILGQLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH
Sbjct  321  NILGQLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMH  380

Query  265  EFED  254
            +F+D
Sbjct  381  DFQD  384



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILG
Sbjct  265  SPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILG  324

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  325  QLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILG
Sbjct  263  SPQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILG  322

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  323  QLAEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  382



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EGGEGNILGQ+
Sbjct  284  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGGEGNILGQM  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+ MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  344  ASGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  401



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 126/155 (81%), Gaps = 3/155 (2%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA-RNKGKH*LANAFLLLFCSQ-FQALRAMVQANPQILQPMLQEL  539
            P S    A  L   P    + G +  A     L  SQ FQALR MVQANPQILQPMLQEL
Sbjct  229  PTSGGPNANPLDLFPQGLPSMGSNASAGTLDFLRNSQQFQALRTMVQANPQILQPMLQEL  288

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEA
Sbjct  289  GKQNPHLMRLIQEHQADFLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEA  347

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  348  MGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  382



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/116 (95%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMR IQEHQ DFLRLINEPVE GEGN+LGQL
Sbjct  263  QFQALRAMVQANPQILQPMLQELGKQNPHLMRFIQEHQDDFLRLINEPVESGEGNVLGQL  322

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            AA+MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  323  AAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  378



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  351  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  410

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  411  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  468



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  352  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  411

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  412  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  469



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNILGQL
Sbjct  299  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQVDFLRLINEPVEGGEGNILGQL  358

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEER+AIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  359  AGAMPQAVTVTPEERQAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  416



>gb|KJB79996.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=340

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQL
Sbjct  223  QFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQL  282

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  283  AEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  340



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  267  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  326

Query  460  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  281
            EGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYL
Sbjct  327  EGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYL  386

Query  280  LDHMHEFED  254
            LDHMHEFE+
Sbjct  387  LDHMHEFEE  395



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQAL+AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQL
Sbjct  268  QFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQL  327

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  328  AEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  385



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+L+RLIQEHQ DFLRLINEP EGGEGNILGQL
Sbjct  267  QFQALRAMVQANPQILQPMLQELGKQNPNLVRLIQEHQGDFLRLINEPAEGGEGNILGQL  326

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  327  AEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQAL+AMVQANPQILQPMLQELGKQNP+LMRLIQEHQ DFLRLINEP EGGEGNILGQL
Sbjct  267  QFQALQAMVQANPQILQPMLQELGKQNPNLMRLIQEHQGDFLRLINEPAEGGEGNILGQL  326

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAVQVTPEEREAIERLEAMGFDRA VL+VFFACNKNEELAANYLLDHMH+F+D
Sbjct  327  AEAMPQAVQVTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD  384



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEP+
Sbjct  262  ANTLEFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPI  321

Query  460  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  281
            EGGEGNILGQLA +MPQ +QVT EEREAI RLE MGFDRA VLEVFFACNKNEELAANYL
Sbjct  322  EGGEGNILGQLAGAMPQTIQVTAEEREAIRRLEEMGFDRATVLEVFFACNKNEELAANYL  381

Query  280  LDHMHEFED  254
            LDHMHEFE+
Sbjct  382  LDHMHEFEE  390



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  249  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  308

Query  460  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  281
            EGGEGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANYL
Sbjct  309  EGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANYL  368

Query  280  LDHMHEFED  254
            LDHMHEFE+
Sbjct  369  LDHMHEFEE  377



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  250  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  309

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  310  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  368

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  369  NEELAANYLLDHMHEFDE  386



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EG EGNILGQ+
Sbjct  290  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQM  349

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  350  ASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  407



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  249  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  308

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  309  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  367

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  368  NEELAANYLLDHMHEFDE  385



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP EG EGNILGQ+
Sbjct  292  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPAEGAEGNILGQM  351

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  352  ASAMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFEE  409



>ref|XP_011035054.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X6 [Populus 
euphratica]
Length=337

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  201  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  260

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  261  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  319

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  320  NEELAANYLLDHMHEFDE  337



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  237  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  296

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  297  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  355

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  356  NEELAANYLLDHMHEFDE  373



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  255  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  314

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  315  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  373

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  374  NEELAANYLLDHMHEFDE  391



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = -3

Query  667  HARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQAD  488
            H R        N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQAD
Sbjct  254  HHRTGSNAGTGNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQAD  313

Query  487  FLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNK  308
            FLRLINEPVEG EGN+LGQLA++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNK
Sbjct  314  FLRLINEPVEG-EGNVLGQLASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNK  372

Query  307  NEELAANYLLDHMHEFED  254
            NEELAANYLLDHMHEF++
Sbjct  373  NEELAANYLLDHMHEFDE  390



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVE
Sbjct  258  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVE  317

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            GGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  318  GGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  377

Query  277  DHMHEFED  254
            DHMHEFE+
Sbjct  378  DHMHEFEE  385



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGEGNILGQL
Sbjct  284  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQL  343

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  344  AGGMPQAVSVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  401



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEPVEGGEGNILGQL
Sbjct  282  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPVEGGEGNILGQL  341

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A  MPQAV VT EER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  342  AGGMPQAVTVTAEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVE
Sbjct  258  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVE  317

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            GGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  318  GGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  377

Query  277  DHMHEFED  254
            DHMHEFE+
Sbjct  378  DHMHEFEE  385



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = -3

Query  706  SHALRACHLSFLPHA-RNKGKH*LANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGK  533
            S    A  L   P    N G +  A     L  SQ FQALRAMVQANPQILQPMLQELGK
Sbjct  229  SGGPNANPLDLFPQGLPNMGSNASAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGK  288

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  353
            QNP L+RLIQEHQADFLRLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMG
Sbjct  289  QNPQLVRLIQEHQADFLRLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMG  347

Query  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            FDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  348  FDRALVLEVFFACNKNEELAANYLLDHMHEFDD  380



>gb|AFK43607.1| unknown [Lotus japonicus]
Length=228

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQ+HQ DFLRLINEPVEGGEGNILGQ 
Sbjct  109  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQDHQVDFLRLINEPVEGGEGNILGQP  168

Query  427  A-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A A+MPQAV VTPEEREAIERLEAMGFDRA VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  169  AGAAMPQAVSVTPEEREAIERLEAMGFDRATVLEVYFACNKNEELAANYLLDHMHEFDE  227



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA-RNKGKH*LANAFLLLFCSQ-FQALRAMVQANPQILQPMLQEL  539
            P S    A  L   P      G    A     L  SQ FQALRAMVQANPQILQPMLQEL
Sbjct  228  PTSGGANANPLDLFPQGLPTIGSTTSAGTLDFLRNSQQFQALRAMVQANPQILQPMLQEL  287

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNPHLMRLIQEHQADFLRLINEPVEG +GN+LGQLA+++PQ+V VTPEEREAIERLEA
Sbjct  288  GKQNPHLMRLIQEHQADFLRLINEPVEG-DGNLLGQLASAVPQSVSVTPEEREAIERLEA  346

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRA+VLEVFFACNKNEELAANYLLDHMH+FE+
Sbjct  347  MGFDRAIVLEVFFACNKNEELAANYLLDHMHDFEE  381



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGNI G L
Sbjct  271  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNISGPL  330

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  331  AAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  388



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 116/118 (98%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEG EGN+LGQL
Sbjct  269  QFQALRAMVQANPQILQPMLQELGKQNPYLMRLIQEHQADFLRLINEPVEG-EGNVLGQL  327

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  328  ASAMPQAVTVTPEEREAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHMHEFDE  385



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGNILGQL
Sbjct  271  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNILGQL  329

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQAV VTPEEREAIERLEAMGFD ALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  330  AEAMPQAVTVTPEEREAIERLEAMGFDPALVLEVFFACNKNEELAANYLLDHMHEFDE  387



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  637  ANAFLLLFCS-QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  S QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPV
Sbjct  305  ANTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPV  364

Query  460  EGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  281
            EGG GNIL QLA +MPQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL
Sbjct  365  EGGAGNILEQLAGAMPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYL  424

Query  280  LDHMHEFED  254
            LDH+HEFE+
Sbjct  425  LDHIHEFEE  433



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LG
Sbjct  282  SPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGEGDVLG  341

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  342  QLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHMHEFED  401



>ref|XP_006378490.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|ERP56287.1| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=352

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G L
Sbjct  235  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPL  294

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  295  AAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  352



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVE
Sbjct  264  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVE  323

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            GGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  324  GGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  383

Query  277  DHMHEFED  254
            DHMHEFE+
Sbjct  384  DHMHEFEE  391



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMVQANP ILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LG
Sbjct  281  SPQFQALRAMVQANPHILQPMLQELGKQNPQLVRLIQQHQADFLRLINEPVEGGEGDVLG  340

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QL A+MPQA+ VTPEEREAIERLEAMGFDRALVLEVF ACN+NEELAANYLLDHMHEFED
Sbjct  341  QLDAAMPQAITVTPEEREAIERLEAMGFDRALVLEVFVACNRNEELAANYLLDHMHEFED  400



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGEGN+LGQ+
Sbjct  282  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGEGNLLGQM  341

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A  MPQAV VTPEER+AIERLEAMGFDRA+VLEV+FACNKNEELAANYLLDH+HEF++
Sbjct  342  AGGMPQAVTVTPEERQAIERLEAMGFDRAIVLEVYFACNKNEELAANYLLDHIHEFDE  399



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEGGEG++LG
Sbjct  270  TPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEGGEGDLLG  329

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA  MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDH HEFED
Sbjct  330  QLAGGMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHGHEFED  389



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+ G L
Sbjct  279  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQDDFLRLINEPVEGGEGNVSGPL  338

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQ+V VTPEEREAIERL AMGFD ALVLEV+FACNKNEELAANYLLDH+HEFED
Sbjct  339  AAAMPQSVTVTPEEREAIERLGAMGFDPALVLEVYFACNKNEELAANYLLDHIHEFED  396



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVE
Sbjct  260  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVE  319

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            GGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  320  GGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  379

Query  277  DHMHEFED  254
            DHMHEFE+
Sbjct  380  DHMHEFEE  387



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  269  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  328

Query  460  EGGEGN-ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  284
            EGGEGN +LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  329  EGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  388

Query  283  LLDHMHEFED  254
            LLDHMHEFE+
Sbjct  389  LLDHMHEFEE  398



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 3/118 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+
Sbjct  273  QFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQM  332

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  333  A---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  387



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 3/118 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN+ GQ+
Sbjct  272  QFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNLFGQM  331

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFED
Sbjct  332  A---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED  386



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 4/118 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQ    ELGKQNPHLMRLIQEHQ DFLRLINEPVEGGEGN+LGQL
Sbjct  285  QFQALRTMVQANPQILQ----ELGKQNPHLMRLIQEHQTDFLRLINEPVEGGEGNVLGQL  340

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  341  ASAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  398



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 1/121 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NIL  437
              QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG NI+
Sbjct  287  SQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGGNII  346

Query  436  GQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
             QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEF+
Sbjct  347  NQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFD  406

Query  256  D  254
            +
Sbjct  407  E  407



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV
Sbjct  280  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  339

Query  460  EGGEGN-ILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  284
            EGGEGN +LGQLAA+MPQA+ VTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  340  EGGEGNNVLGQLAAAMPQAISVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  399

Query  283  LLDHMHEFED  254
            LLDH+HEFE+
Sbjct  400  LLDHIHEFEE  409



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 116/119 (97%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGN-ILGQ  431
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLI++HQADFLRLINEP+EGGEGN +LGQ
Sbjct  278  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIRDHQADFLRLINEPMEGGEGNNLLGQ  337

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            +AA MPQ+V VTPEER+AIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  338  MAAGMPQSVTVTPEERQAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFDE  396



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 120/136 (88%), Gaps = 2/136 (1%)
 Frame = -3

Query  658  NKGKH*LANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFL  482
            N G +  A     L  SQ FQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFL
Sbjct  246  NMGSNASAGTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFL  305

Query  481  RLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNE  302
            RLINEPVEG EGNILGQLA +MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNE
Sbjct  306  RLINEPVEG-EGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNE  364

Query  301  ELAANYLLDHMHEFED  254
            ELAANYLLDHMHEF++
Sbjct  365  ELAANYLLDHMHEFDE  380



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+LGQL
Sbjct  371  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNLLGQL  429

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQAV VTPEEREAIERLEAMGFDR +VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  430  AAAMPQAVTVTPEEREAIERLEAMGFDRNIVLEVFFACNKNEELAANYLLDHMHEFEE  487



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  266  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  325

Query  460  EGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  284
            EGG EGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  326  EGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  385

Query  283  LLDHMHEFED  254
            LLDH+HEFE+
Sbjct  386  LLDHIHEFEE  395



>ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis]
Length=194

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 124/163 (76%), Gaps = 10/163 (6%)
 Frame = -3

Query  727  SYSTFPISHALRACHLSFLPHA-----RNKGKH*LANAFLLLFCSQFQALRAMVQANPQI  563
            S  T P S    A  L   P        N G     N   L    QFQALRAMVQANPQI
Sbjct  37   SLPTVP-SSGPNANPLDLFPQGLPNVGSNAGS---GNLDFLRNSPQFQALRAMVQANPQI  92

Query  562  LQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEER  383
            LQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN LGQ+A ++PQAV VTPEER
Sbjct  93   LQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNALGQMAGAIPQAVTVTPEER  151

Query  382  EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            EAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  152  EAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE  194



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  706  SHALRACHLSFLPHA-RNKGKH*LA-NAFLLLFCSQFQALRAMVQANPQILQPMLQELGK  533
            S    A  L   P    N G +  A N   L    QFQALRAMVQANPQILQPMLQELGK
Sbjct  239  SSGPNANPLDLFPQGLTNAGSNAGAGNLDFLRNSPQFQALRAMVQANPQILQPMLQELGK  298

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  353
            QNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQ A ++PQAV VTPEEREAIERLEAMG
Sbjct  299  QNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMG  357

Query  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            FDRALVLEV+FACNKNEELAANYLLDHMHEF++
Sbjct  358  FDRALVLEVYFACNKNEELAANYLLDHMHEFDE  390



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 1/121 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NIL  437
              QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG NI+
Sbjct  315  SQQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGGNII  374

Query  436  GQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
             QLA  +PQA+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEF+
Sbjct  375  NQLAGGVPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFD  434

Query  256  D  254
            +
Sbjct  435  E  435



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 2/118 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG  
Sbjct  270  QFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD-  328

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  329  -AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG EGNILGQL
Sbjct  265  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-EGNILGQL  323

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQ V VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  324  AEAMPQTVNVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  381



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = -3

Query  637  ANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            AN    L  SQ FQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPV
Sbjct  248  ANTLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPV  307

Query  460  EGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  284
            EGG EGNILGQLAA+MPQA+QVTPEEREAIERLE MGFD  LVLEVFFACNKNEELAANY
Sbjct  308  EGGGEGNILGQLAAAMPQAIQVTPEEREAIERLEQMGFDHDLVLEVFFACNKNEELAANY  367

Query  283  LLDHMHEFED  254
            LLDH+HEFE+
Sbjct  368  LLDHIHEFEE  377



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  263  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVE  322

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+LGQ A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  323  G-EGNVLGQTAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  381

Query  277  DHMHEFED  254
            DH+HEF++
Sbjct  382  DHLHEFDE  389



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 122/153 (80%), Gaps = 2/153 (1%)
 Frame = -3

Query  706  SHALRACHLSFLPHA-RNKGKH*LANAFLLLFCS-QFQALRAMVQANPQILQPMLQELGK  533
            S    A  L   P    N G H    +   L  S QF+AL+A+VQANPQILQPMLQELGK
Sbjct  239  SSGPNANPLDIFPQGLPNVGSHAGGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGK  298

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMG  353
            QNP +MRLIQEHQ +FLRLINEP EG EGN+LGQLAA MPQA+ VTPEEREAIERLEAMG
Sbjct  299  QNPQIMRLIQEHQGEFLRLINEPAEGTEGNVLGQLAAGMPQALTVTPEEREAIERLEAMG  358

Query  352  FDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            FDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  359  FDRALVLQVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  283  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  341

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  342  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 2/127 (2%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEG
Sbjct  260  NLDFLRGSQQFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEG  319

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
            GEGNILG   A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  320  GEGNILGD--AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLD  377

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  378  HMHEFEE  384



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  282  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  340

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  341  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  398



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 2/118 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGGEGNILG  
Sbjct  270  QFQALRAMVQANPQILQPMLQELGKQNPNLMRLIQQHQADFLRLINEPVEGGEGNILGD-  328

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A++PQ++ VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  329  -AAVPQSISVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFEE  385



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  268  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  326

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  327  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  384



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 119/131 (91%), Gaps = 5/131 (4%)
 Frame = -3

Query  637  ANAFLLLF---CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  467
            A+A  L F     QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE
Sbjct  253  ASAGTLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE  312

Query  466  PVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAAN  287
            PVEG EGN+LGQL  ++PQAV +TPEERE+IERLEAMGFDRALVLEVFFACNKNEELAAN
Sbjct  313  PVEG-EGNVLGQLG-TVPQAVTITPEERESIERLEAMGFDRALVLEVFFACNKNEELAAN  370

Query  286  YLLDHMHEFED  254
            YLLDHMHEFE+
Sbjct  371  YLLDHMHEFEE  381



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  283  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  341

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  342  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  399



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 116/124 (94%), Gaps = 1/124 (1%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG  446
             L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEG EG
Sbjct  426  FLRNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEG-EG  484

Query  445  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  266
            N+LGQL+A+MPQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMH
Sbjct  485  NLLGQLSAAMPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMH  544

Query  265  EFED  254
            EF+D
Sbjct  545  EFDD  548



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  266  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  324

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  325  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  382



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  265  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  323

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  324  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  381



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEGN+  
Sbjct  271  SPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGD  330

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  331  QLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVE
Sbjct  261  GNLDFLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVE  320

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN LGQ+A ++PQAV VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLL
Sbjct  321  G-EGNALGQMAGAIPQAVTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLL  379

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  380  DHMHEFDE  387



>gb|KDO69965.1| hypothetical protein CISIN_1g0163871mg, partial [Citrus sinensis]
Length=367

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG  446
             L    QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEG
Sbjct  244  FLRNSPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEG  303

Query  445  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  266
            N+  QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMH
Sbjct  304  NLGDQLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMH  363

Query  265  EFED  254
            EFED
Sbjct  364  EFED  367



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ DFLRLINEPVEG EGN+LGQL
Sbjct  248  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQPDFLRLINEPVEG-EGNVLGQL  306

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A+++PQ V VTPEEREAI+RL AMGFDRALVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  307  ASAVPQTVTVTPEEREAIDRLVAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE  364



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GNILG
Sbjct  299  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNILG  358

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QLAA MPQ  A+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  359  QLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  418

Query  259  ED  254
            E+
Sbjct  419  EE  420



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  296  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLG  355

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            Q+AA MPQ  A+QVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  356  QMAAGMPQPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  415

Query  259  ED  254
            E+
Sbjct  416  EE  417



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQ LRAMVQANPQ+LQPMLQELGKQNP L+RLIQEHQADFLRLINEPV+GGEGN+  
Sbjct  271  SPQFQVLRAMVQANPQLLQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVQGGEGNLGD  330

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA  MPQ++QVTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  331  QLAGLMPQSIQVTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED  390



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GNILG
Sbjct  298  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNILG  357

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QLAA MPQ  A+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  358  QLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  417

Query  259  ED  254
            E+
Sbjct  418  EE  419



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  257  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  316

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLL
Sbjct  317  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLL  375

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  376  DHMHEFDE  383



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 117/128 (91%), Gaps = 4/128 (3%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--  452
             L    QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG  
Sbjct  295  FLRNSQQFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGE  354

Query  451  EGNILGQLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
             GNILGQLAA MPQ  A+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLL
Sbjct  355  SGNILGQLAAEMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLL  414

Query  277  DHMHEFED  254
            DHMHEFE+
Sbjct  415  DHMHEFEE  422



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  261  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  320

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLL
Sbjct  321  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLL  379

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  380  DHMHEFDE  387



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVEGGEG NI  Q
Sbjct  265  QFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVEGGEGGNISSQ  324

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            L  +MPQA+QVTPEEREAIERLEAMGF+R LVLEVFFACNKNEELAANYLLDHMHEF++
Sbjct  325  LGGAMPQAIQVTPEEREAIERLEAMGFERGLVLEVFFACNKNEELAANYLLDHMHEFDE  383



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  239  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  298

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLL
Sbjct  299  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLL  357

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  358  DHMHEFDE  365



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  243  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  302

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLL
Sbjct  303  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLL  361

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  362  DHMHEFDE  369



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  258  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  317

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEE+AANYLL
Sbjct  318  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEEMAANYLL  376

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  377  DHMHEFDE  384



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  259  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  318

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  319  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  377

Query  274  HMHEFED  254
            HMHEFED
Sbjct  378  HMHEFED  384



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 122/154 (79%), Gaps = 3/154 (2%)
 Frame = -3

Query  706  SHALRACHLSFLPHA-RNKGKH*LANAFLLLFCS-QFQALRAMVQANPQILQPMLQELGK  533
            S    A  L   P    N G H    +   L  S QF+AL+A+VQANPQILQPMLQELGK
Sbjct  239  SSGPNANPLDIFPQGLPNVGSHAGGGSLDFLRNSPQFRALQALVQANPQILQPMLQELGK  298

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQLAASMPQAVQVTPEEREAIERLEAM  356
            QNP +MRLIQEHQ +FLRLINEP EG EG N+LGQLAA MPQA+ VTPEEREAIERLEAM
Sbjct  299  QNPQIMRLIQEHQGEFLRLINEPAEGTEGSNVLGQLAAGMPQALTVTPEEREAIERLEAM  358

Query  355  GFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            GFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  359  GFDRALVLQVFFACNKNEELAANYLLDHMHEFED  392



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  257  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  316

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLL
Sbjct  317  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLL  375

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  376  DHMHEFDE  383



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL
Sbjct  260  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQL  318

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  319  EAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  255  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  314

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLL
Sbjct  315  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLL  373

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  374  DHMHEFDE  381



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL
Sbjct  272  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVIEQL  330

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  331  EAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  306  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLG  365

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
             +AA +PQ  A+QVTPEEREAIERLE MGFDRALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  366  HMAAGIPQPQAIQVTPEEREAIERLEGMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  425

Query  259  ED  254
            E+
Sbjct  426  EE  427



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL
Sbjct  261  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQL  319

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  320  EAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_006408408.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49861.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=372

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ G
Sbjct  251  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFG  310

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QL A MPQ  A+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  311  QLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  370

Query  259  ED  254
            E+
Sbjct  371  EE  372



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  261  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  320

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
              EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLL
Sbjct  321  S-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLL  379

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  380  DHMHEFDE  387



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  239  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  298

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+V+FACNKNEE+AANYLL
Sbjct  299  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVYFACNKNEEMAANYLL  357

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  358  DHMHEFDE  365



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL
Sbjct  261  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQL  319

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLE MGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  320  EAAMPQAVTVTPEEREAIERLEGMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  377



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINEP E
Sbjct  257  GNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINEPAE  316

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL
Sbjct  317  GEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  375

Query  277  DHMHEFED  254
            DH+HEFED
Sbjct  376  DHIHEFED  383



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFL LINEP E
Sbjct  260  GNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLNLINEPAE  319

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G E N+LGQL ++MPQAV VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL
Sbjct  320  GEE-NLLGQLGSAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  378

Query  277  DHMHEFED  254
            DH+HEFED
Sbjct  379  DHIHEFED  386



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL
Sbjct  259  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQL  317

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  318  EAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  375



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG E N++ QL
Sbjct  257  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEGEE-NVMEQL  315

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  316  EAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  373



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            +FQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG E N++ QL
Sbjct  260  KFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEE-NVMEQL  318

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  319  EAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED  376



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQALR M QANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINE P EG EGN+LGQ
Sbjct  271  QFQALRDMFQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEQPAEGAEGNLLGQ  330

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LA++MPQAV VTPEEREAIERLEA+GFDRALVLEVFFACNKNEELAANYLLDHM+EFE+
Sbjct  331  LASAMPQAVTVTPEEREAIERLEALGFDRALVLEVFFACNKNEELAANYLLDHMNEFEE  389



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E ++LG
Sbjct  265  SPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPTEGAESDLLG  324

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  325  QLASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQEHQADFLRLINEPVE
Sbjct  256  GNLDFLSNSPQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQEHQADFLRLINEPVE  315

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+ GQ A ++PQAV VTPEEREAIERLEAMGFDRALVL+VFFAC KNEE+AANYLL
Sbjct  316  G-EGNVPGQPAGAIPQAVTVTPEEREAIERLEAMGFDRALVLQVFFACXKNEEMAANYLL  374

Query  277  DHMHEFED  254
            DHMHEF++
Sbjct  375  DHMHEFDE  382



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EGN LGQL
Sbjct  292  QFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQL  351

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  352  AGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  409



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+A+VQANPQILQPMLQELGKQNP +MRLIQEHQ +FLRLINEP EG EGN LGQL
Sbjct  291  QFRALQALVQANPQILQPMLQELGKQNPQIMRLIQEHQGEFLRLINEPAEGTEGNPLGQL  350

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A  MPQ + VTPEEREAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  351  AGGMPQTLNVTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFED  408



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+ G
Sbjct  295  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLFG  354

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QL A MPQ  A+QVTPEEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  355  QLEAGMPQPQAIQVTPEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  414

Query  259  ED  254
            E+
Sbjct  415  EE  416



>ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=111

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -3

Query  586  MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQA  407
            MVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVEGGEGN+L QL A++PQA
Sbjct  1    MVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVEGGEGNLLEQLGAAVPQA  60

Query  406  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            V VTPEEREAIERLEAMGFDRALVLEV+FACNKNEELAANYLLDHMHEFE+
Sbjct  61   VTVTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE  111



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LG
Sbjct  277  SPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLG  336

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  337  QLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  396



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E N+LG
Sbjct  276  SPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESNLLG  335

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  336  QLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  395



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  216  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLG  275

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            Q+AA MPQ  A+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  276  QMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  335

Query  259  ED  254
            E+
Sbjct  336  EE  337



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  256  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  315

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  316  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  374

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  375  HMHEFEE  381



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 1/118 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRA+VQANPQILQPMLQELGKQNP L+RLIQ+HQADFLRLINEPVEG +GN+LGQL
Sbjct  328  QFQALRAVVQANPQILQPMLQELGKQNPQLVRLIQDHQADFLRLINEPVEG-DGNVLGQL  386

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQ+V VT EEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF+D
Sbjct  387  AEAMPQSVAVTAEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDD  444



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  256  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  315

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  316  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  374

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  375  HMHEFEE  381



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 110/120 (92%), Gaps = 4/120 (3%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALR MVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG EGN+ G
Sbjct  268  SPQFQALRGMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG-EGNLFG  326

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            Q+A   P  VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDH+HEFE+
Sbjct  327  QMA---PATVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE  383



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  298  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLG  357

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            Q+AA MPQ  A+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  358  QMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  417

Query  259  ED  254
            E+
Sbjct  418  EE  419



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  258  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  317

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  318  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  376

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  377  HMHEFEE  383



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  297  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLG  356

Query  433  QLAASMPQ--AVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            Q+AA MPQ  A+QVT EEREAIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEF
Sbjct  357  QMAAGMPQPQAIQVTHEEREAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEF  416

Query  259  ED  254
            E+
Sbjct  417  EE  418



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQL
Sbjct  334  QFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQL  393

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  394  ASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 1/120 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LG
Sbjct  252  SPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLG  310

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  311  QLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  370



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQL
Sbjct  334  QFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQL  393

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  394  ASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  451



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQL
Sbjct  335  QFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQL  394

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  395  ASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  452



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQ+HQA+FLRL+NEP EG E N+LGQL
Sbjct  333  QFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQDHQAEFLRLLNEPAEGAESNLLGQL  392

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A++MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  393  ASAMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  450



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 1/120 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LG
Sbjct  249  SPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLG  307

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  308  QLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  367



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 1/120 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LG
Sbjct  270  SPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLG  328

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  329  QLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  388



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 1/120 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQA +A+VQANPQILQPMLQELGKQNP +MRLI+EHQA+FLRLINEP EG E N+LG
Sbjct  273  SPQFQAFKALVQANPQILQPMLQELGKQNPLVMRLIREHQAEFLRLINEPAEG-ESNLLG  331

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  332  QLAAEMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QF+AL+ +VQANPQILQPMLQELGKQNP +MRLIQEHQA+FLRL+NEP EG E ++LG
Sbjct  265  SPQFRALQTLVQANPQILQPMLQELGKQNPQVMRLIQEHQAEFLRLLNEPAEGAESDLLG  324

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            Q A+ MPQA+ VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  325  QFASPMPQALTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  384



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG
Sbjct  255  NLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEG  314

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  315  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  373

Query  274  HMHEFED  254
            HMHEFED
Sbjct  374  HMHEFED  380



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QF+ALR MVQANPQILQPMLQELGKQNP L+RLIQEHQ DFLRLINEPVEG
Sbjct  253  NLDFLRNSQQFRALRGMVQANPQILQPMLQELGKQNPQLVRLIQEHQTDFLRLINEPVEG  312

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  313  EE-NVMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  371

Query  274  HMHEFED  254
            HMHEFED
Sbjct  372  HMHEFED  378



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  252  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  311

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  312  EE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  370

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  371  HMHEFEE  377



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  252  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  311

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  312  EE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  370

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  371  HMHEFEE  377



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  254  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  313

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N + QL A+MPQAV VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEELAANYLLD
Sbjct  314  EE-NAMEQLEAAMPQAVTVTPEEREAIERLEAMGFDRAMVLEVFFACNKNEELAANYLLD  372

Query  274  HMHEFED  254
            HMHEFE+
Sbjct  373  HMHEFEE  379



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  314  QFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLG  373

Query  433  QLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELAANYLLDH+HEF
Sbjct  374  QLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELAANYLLDHIHEF  433

Query  259  ED  254
            E+
Sbjct  434  EE  435



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 4/122 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG--EGNILG  434
            QFQ LRAMVQANPQ+LQPMLQELGKQNP+LMRLIQ+HQADFLRLINEPVEGG   GN+LG
Sbjct  304  QFQTLRAMVQANPQVLQPMLQELGKQNPNLMRLIQDHQADFLRLINEPVEGGAETGNLLG  363

Query  433  QLAASM--PQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            QLAA M  PQA+QVTPEER+AIERLE MGF+RALVLEVFFACNK+EELAANYLLDH+HEF
Sbjct  364  QLAAGMQQPQAIQVTPEERDAIERLEGMGFERALVLEVFFACNKDEELAANYLLDHIHEF  423

Query  259  ED  254
            E+
Sbjct  424  EE  425



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQA +A+VQANPQIL+PMLQELGKQNP +MRLIQEHQ +FL LINEP EGGE N+LGQL
Sbjct  274  QFQAFKALVQANPQILRPMLQELGKQNPLVMRLIQEHQDEFLCLINEPAEGGESNLLGQL  333

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA+MPQA+ VTPEE EAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED
Sbjct  334  AAAMPQALTVTPEECEAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  391



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = -3

Query  634  NAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEG  455
            N   L    QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADFLRLINEPVEG
Sbjct  266  NLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEG  325

Query  454  GEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLD  275
             E N++ QL A+MPQAV VTPEEREAIERLEAMGF+RA+VLEVFFACNKNEELAANYLLD
Sbjct  326  EE-NVIEQLEAAMPQAVTVTPEEREAIERLEAMGFERAMVLEVFFACNKNEELAANYLLD  384

Query  274  HMHEFED  254
            HMHEF++
Sbjct  385  HMHEFDE  391



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 2/118 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGEGN+LG  
Sbjct  270  QFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGEGNVLGD-  328

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A++PQA+ ++PEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  329  -AAVPQAIAISPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHMHEFED  385



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+EG EG++LGQL
Sbjct  257  QFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPIEGAEGDLLGQL  316

Query  427  A-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
                M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  317  GEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANYLLDHMHEFEE  375



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = -3

Query  637  ANAFLLLFCS-QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPV  461
            ANA   L  + QFQALRAMVQANPQILQPMLQELGKQNP L+RLIQEHQADF+RLINEP+
Sbjct  247  ANALDFLRNNPQFQALRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFVRLINEPI  306

Query  460  EGGEGNILGQLA-ASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANY  284
            EG EG++LGQL    M  A++VTPEERE+IERLEAMGFD+ALVLEVFFACNKNEELAANY
Sbjct  307  EGAEGDLLGQLGEGGMQHAIEVTPEERESIERLEAMGFDQALVLEVFFACNKNEELAANY  366

Query  283  LLDHMHEFED  254
            LLDHMHEFE+
Sbjct  367  LLDHMHEFEE  376



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 121/155 (78%), Gaps = 4/155 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA-RNKGKH*LANAFL--LLFCSQFQALRAMVQANPQILQPMLQE  542
            P S    A  L   P    N G   + +  L  L    QFQALRAMV+ANPQILQPMLQE
Sbjct  265  PSSAGPNANPLDLFPQGLPNIGSGAVGSGSLDFLRNSPQFQALRAMVRANPQILQPMLQE  324

Query  541  LGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLE  362
            LGKQNP L+RLIQ+HQ DFLRLINEP+EG EGNILGQLA +MPQA+ VTPEEREAI+RLE
Sbjct  325  LGKQNPQLIRLIQDHQPDFLRLINEPLEG-EGNILGQLAEAMPQAITVTPEEREAIQRLE  383

Query  361  AMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
             MGFDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  384  DMGFDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  418



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP+L+RLI EHQADFLRLINEP EGGEGN LG  
Sbjct  244  QFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGEHQADFLRLINEPAEGGEGNALGD-  302

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A++PQA+ +TPEEREAIERLEAMGF RA+VL+VFFACNKNEEL ANYLLDHMHEFED
Sbjct  303  -AAVPQAIAITPEEREAIERLEAMGFARAIVLQVFFACNKNEELTANYLLDHMHEFED  359



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALRAMV+ANPQILQPMLQELGKQNP L+RLIQ+HQ DFLRLINEP+EG EGNILG
Sbjct  299  SPQFQALRAMVRANPQILQPMLQELGKQNPQLIRLIQDHQPDFLRLINEPLEG-EGNILG  357

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
            QLA +MPQA+ VTPEEREAI+RLE MGFDR LV+EVFFACNKNEE+AANYLLDH+HEFE
Sbjct  358  QLAEAMPQAITVTPEEREAIQRLEDMGFDRGLVVEVFFACNKNEEMAANYLLDHIHEFE  416



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  E
Sbjct  251  GNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQGE  310

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYLL
Sbjct  311  GEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYLL  369

Query  277  DHMHEFED  254
            DH+HEFED
Sbjct  370  DHIHEFED  377



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNP LMRLIQ+HQADFLRLINE  E
Sbjct  252  GNLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQLMRLIQDHQADFLRLINEQGE  311

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G E N+LGQLA++MPQAV VTPEEREAIERLEAMGF+R + LEVF ACNKNEELAANYLL
Sbjct  312  GEE-NLLGQLASAMPQAVTVTPEEREAIERLEAMGFNRDIALEVFIACNKNEELAANYLL  370

Query  277  DHMHEFED  254
            DH+HEFED
Sbjct  371  DHIHEFED  378



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = -3

Query  691  ACHLSFLPHA-RNKGKH*LANAFLLLFCSQ-FQALRAMVQANPQILQPMLQELGKQNPHL  518
            A  L   P    N G +  A +   L  SQ FQALRAMVQANPQILQPMLQELGKQNP L
Sbjct  256  ASPLDLFPQGLPNVGSNAGAGSLDFLRNSQQFQALRAMVQANPQILQPMLQELGKQNPQL  315

Query  517  MRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRAL  338
            MRLIQ+HQADFLRLINEPVEG EGN+L QL ++MP +V VTPEEREAIERLE MGF RA 
Sbjct  316  MRLIQDHQADFLRLINEPVEG-EGNLLSQLTSAMPASVSVTPEEREAIERLEGMGFRRAT  374

Query  337  VLEVFFACNKNEELAANYLLDHMHEFED  254
            VL+V+FACNKNEELAANYLLDHM EFE+
Sbjct  375  VLQVYFACNKNEELAANYLLDHMDEFEN  402



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NIL  437
              QF+AL+A+VQANPQ LQPMLQELGKQNP ++RLIQEHQ +FLRLINEP EG EG NIL
Sbjct  271  SPQFRALQALVQANPQFLQPMLQELGKQNPQILRLIQEHQGEFLRLINEPAEGTEGGNIL  330

Query  436  GQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
            GQL   MPQA+ VTPEE EAIERLEAMGFDRALVL+VFFACNKNEELAANYLLDHMHEFE
Sbjct  331  GQLPTGMPQALSVTPEEHEAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFE  390

Query  256  D  254
            D
Sbjct  391  D  391



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = -3

Query  658  NKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLR  479
            N G     N   L    QFQALR+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLR
Sbjct  252  NMGAGGAGNLDFLRDNQQFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGAHQADFLR  311

Query  478  LINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEE  299
            LINEP EGGEGN+LG   A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEE
Sbjct  312  LINEPAEGGEGNVLGD--AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEE  369

Query  298  LAANYLLDHMHEFED  254
            LAANYLLDHMHEFED
Sbjct  370  LAANYLLDHMHEFED  384



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 3/120 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G
Sbjct  283  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFG  342

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            +     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  343  E-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP+L+RLI  HQADFLRLINEP EGGEGN+LG  
Sbjct  263  QFQALRSMVQANPQILQPMLQELGKQNPNLVRLIGTHQADFLRLINEPAEGGEGNVLGD-  321

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
             A++PQA+ +T EEREAIERLEAMGF RA+VL+VFFACNKNEELAANYLLDHMHEFED
Sbjct  322  -AAVPQAITITREEREAIERLEAMGFARAIVLQVFFACNKNEELAANYLLDHMHEFED  378



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 3/120 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G
Sbjct  285  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFG  344

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            +     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  345  E-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  403



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 3/120 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGG-EG-NILG  434
            QFQALRAMVQANPQ+LQPMLQELGKQNP+LMRLIQEHQADFLRLINEPVEGG EG N+ G
Sbjct  283  QFQALRAMVQANPQVLQPMLQELGKQNPNLMRLIQEHQADFLRLINEPVEGGAEGANLFG  342

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            +     PQA+QVTPEER+AIERLEAMGF+RALVLEVFFACNKNEELAANYLLDHMHEFE+
Sbjct  343  E-GMPQPQAIQVTPEERDAIERLEAMGFERALVLEVFFACNKNEELAANYLLDHMHEFEE  401



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 5/117 (4%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQ+NPQILQPMLQELGKQNPHLMRLIQEHQADFL+LINEP+EGGE N+LG  
Sbjct  271  QFQALRAMVQSNPQILQPMLQELGKQNPHLMRLIQEHQADFLQLINEPMEGGE-NLLGH-  328

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFE  257
                PQA+ VTPEER+AIERLEAMGFDR LVLEVFFACNKNEELAANYLLDHMHEFE
Sbjct  329  ---GPQAISVTPEERDAIERLEAMGFDRELVLEVFFACNKNEELAANYLLDHMHEFE  382



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  239  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  298

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  299  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  354



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  242  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  301

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  302  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  357



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  258  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  317

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  318  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  373



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  261  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  320

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  321  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  376



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  277  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  336

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  337  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  392



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQ+LQPMLQELGKQNP+L+RLIQEHQ +F +L+NEPVEG EGN+LGQL
Sbjct  280  QFQALRAMVQANPQVLQPMLQELGKQNPNLVRLIQEHQTEFDQLLNEPVEGKEGNLLGQL  339

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
            A +MPQA+QVTPEE   IERLEAMGF+R+ VLE++FACNKNEEL ANYLLDHMHEF
Sbjct  340  AGAMPQAIQVTPEEHATIERLEAMGFERSTVLELYFACNKNEELTANYLLDHMHEF  395



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQADFLRL+NEPVEG EG+   QL
Sbjct  286  QFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQADFLRLVNEPVEGAEGDFFNQL  345

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            A +MPQA+ VTPEEREAIERLEAMGFDRALV+E F AC+KNE+LAANYLL+H  ++ED
Sbjct  346  AGAMPQAINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEQLAANYLLEHAGDYED  403



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 111/144 (77%), Gaps = 26/144 (18%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQ--------------------------PMLQELGKQNPHLMRLI  506
            QF+AL+ +VQANPQILQ                          PMLQELGKQNP +MRLI
Sbjct  279  QFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQELGKQNPQVMRLI  338

Query  505  QEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEV  326
            QEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEV
Sbjct  339  QEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEV  398

Query  325  FFACNKNEELAANYLLDHMHEFED  254
            FFACNKNEELAANYLLDHMHEFED
Sbjct  399  FFACNKNEELAANYLLDHMHEFED  422



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 111/144 (77%), Gaps = 26/144 (18%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQ--------------------------PMLQELGKQNPHLMRLI  506
            QF+AL+ +VQANPQILQ                          PMLQELGKQNP +MRLI
Sbjct  278  QFRALQTLVQANPQILQVASHSLPHKMFLLYFSLTLFSIFFSQPMLQELGKQNPQVMRLI  337

Query  505  QEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEV  326
            QEHQA+FLRL+NEP EG E N+LGQLA +MPQA+ VTPEEREAIERLEAMGFDRALVLEV
Sbjct  338  QEHQAEFLRLLNEPAEGAESNLLGQLAGAMPQALTVTPEEREAIERLEAMGFDRALVLEV  397

Query  325  FFACNKNEELAANYLLDHMHEFED  254
            FFACNKNEELAANYLLDHMHEFED
Sbjct  398  FFACNKNEELAANYLLDHMHEFED  421



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILGQ
Sbjct  289  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGTGGNILGQ  348

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  349  LAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  407



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N   L    QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQ HQADFLRLINEPVE
Sbjct  262  GNLDFLRNSPQFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQAHQADFLRLINEPVE  321

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAA-NYL  281
            GGEGN+L QL A++PQAV VTPEEREAIERLEAMGFDRALV EV+FACNKNEELA+  +L
Sbjct  322  GGEGNLLEQLGAAVPQAVTVTPEEREAIERLEAMGFDRALVPEVYFACNKNEELASIPFL  381

Query  280  LDHMHEFE  257
                H+F 
Sbjct  382  CLGWHKFS  389



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQ
Sbjct  289  QFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGAGGNILGQ  348

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA+MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  349  LAAAMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  407



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -3

Query  625  LLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG  446
             L    QFQALR MVQANPQILQPMLQELGKQNPHLM LIQEHQADFLRLINEP  GGE 
Sbjct  256  FLRNSPQFQALRTMVQANPQILQPMLQELGKQNPHLMELIQEHQADFLRLINEP--GGEE  313

Query  445  NILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMH  266
            N+  QL A++PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH +
Sbjct  314  NLESQLGAAVPQTITITPEEHEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQN  373

Query  265  EFED  254
            EF+D
Sbjct  374  EFDD  377



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG 
Sbjct  294  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGA  353

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA MPQAVQVTPEEREAI+RLE+MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  354  LAAQMPQAVQVTPEEREAIQRLESMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  412



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE--GNILG  434
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G   GNILG
Sbjct  292  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGTAGGNILG  351

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  352  QLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGE--GNILG  434
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  + G   GNILG
Sbjct  292  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGAAGGNILG  351

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QLAA+MPQA+ VTPEEREAI+RLEAMGF+R LVLEVFFACNK+EELAANYLLDH HEFED
Sbjct  352  QLAAAMPQALTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFED  411



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG 
Sbjct  303  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGA  362

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  363  LAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  421



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILG 
Sbjct  304  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAGGNILGA  363

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA MPQAVQVTPEEREAI+RLE MGF+R LVLEVFFACN++EELAANYLLDH HEFE+
Sbjct  364  LAAQMPQAVQVTPEEREAIQRLEGMGFNRELVLEVFFACNRDEELAANYLLDHGHEFEE  422



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINE-PVEGGEGNILGQ  431
            QFQAL A+VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE P  G  GNILGQ
Sbjct  292  QFQALLALVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNETPESGAAGNILGQ  351

Query  430  LAASMPQA-VQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA+MPQA V VTPEERE+I+RLEAMGF+R LVLEVFFACN++EELAANYLLDH HE+ED
Sbjct  352  LAAAMPQAAVTVTPEERESIQRLEAMGFNRELVLEVFFACNRDEELAANYLLDHGHEYED  411



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQ
Sbjct  281  QFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQ  340

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA+MPQ+V VTPEEREAI+RLE MGF+R LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  341  LAAAMPQSVTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 2/120 (2%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALR MVQANPQILQPMLQELGKQNP+LM LIQEHQADFLRLINEP  GGE N+ G
Sbjct  253  SQQFQALRTMVQANPQILQPMLQELGKQNPNLMELIQEHQADFLRLINEP--GGEENLEG  310

Query  433  QLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            QL A  PQ + +TPEE EAI+RLE MGFDR LVLEVFFACNKNE+LAANYLLDH +EF+D
Sbjct  311  QLGALAPQTITITPEENEAIQRLEDMGFDRDLVLEVFFACNKNEDLAANYLLDHQNEFDD  370



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = -3

Query  676  FLPHAR-NKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  500
             LP+A  N G     N  +L   SQF+ L ++VQANPQILQP+LQELGKQNP +++LIQE
Sbjct  261  VLPNASANAGG---GNLDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQE  317

Query  499  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  320
            +QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFF
Sbjct  318  NQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFF  377

Query  319  ACNKNEELAANYLLDHMHEFED  254
            ACNK+E+LAANYLLDHM+EF+D
Sbjct  378  ACNKDEQLAANYLLDHMNEFDD  399



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -3

Query  613  CSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILG  434
              QFQALR MVQANPQILQPML ELGKQNPHLM+LIQ HQADFLRLINEPVEGG    L 
Sbjct  269  SPQFQALRTMVQANPQILQPMLLELGKQNPHLMQLIQAHQADFLRLINEPVEGGGEGNLL  328

Query  433  QL--AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEF  260
                +A+MPQAV VTPEEREAIERLEAMGF+RALVLEV+FACNKNEELAANYLLDHMHEF
Sbjct  329  GQLGSAAMPQAVTVTPEEREAIERLEAMGFERALVLEVYFACNKNEELAANYLLDHMHEF  388

Query  259  ED  254
            E+
Sbjct  389  EE  390



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 4/142 (3%)
 Frame = -3

Query  676  FLPHAR-NKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQE  500
             LP+A  N G     N  +L   SQF+ L ++VQANPQILQP+LQELGKQNP +++LIQE
Sbjct  261  VLPNASANAGG---GNLDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQE  317

Query  499  HQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFF  320
            +QA+FLRLINEP EG EGN+L Q AA MPQ V VTPEE EAI+RLE MGFDR LVLEVFF
Sbjct  318  NQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQRLEQMGFDRDLVLEVFF  377

Query  319  ACNKNEELAANYLLDHMHEFED  254
            ACNK+E LAANYLLDHM+EF+D
Sbjct  378  ACNKDELLAANYLLDHMNEFDD  399



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+F+RL+NE  EGG G NILGQ
Sbjct  281  QFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFVRLVNETPEGGPGGNILGQ  340

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA+MPQ+V VTPEEREAI+RLE MGF+  LVLEVFFACNK+EELAANYLLDH HEF++
Sbjct  341  LAAAMPQSVTVTPEEREAIQRLEGMGFNHELVLEVFFACNKDEELAANYLLDHGHEFDE  399



>ref|NP_001266655.1| DNA repair protein RAD23 [Zea mays]
 gb|ACG37645.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQ
Sbjct  284  QFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQ  343

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  344  LAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|NP_001142065.1| uncharacterized protein LOC100274222 [Zea mays]
 gb|ACF87572.1| unknown [Zea mays]
 gb|AFW87602.1| DNA repair protein RAD23 [Zea mays]
Length=405

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEG-NILGQ  431
            QFQAL  +VQANPQILQPMLQELGKQNP ++RLIQE+QA+FLRL+NE  EGG G NILGQ
Sbjct  284  QFQALLQLVQANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPEGGPGGNILGQ  343

Query  430  LAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LAA++PQ + VTPEEREAI+RLE MGF+R LVLEVFFACNK+EEL ANYLLDH HEF++
Sbjct  344  LAAAVPQTLTVTPEEREAIQRLEGMGFNRELVLEVFFACNKDEELTANYLLDHGHEFDE  402



>ref|XP_010107189.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
 gb|EXC14085.1| Putative DNA repair protein RAD23-1 [Morus notabilis]
Length=421

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 115/159 (72%), Gaps = 3/159 (2%)
 Frame = -3

Query  721  STFPISHALRACHLSFLPHARNKGKH*LANAFLLLFCS---QFQALRAMVQANPQILQPM  551
            +T P S A  +  L+  P     G         L F     QFQ LR+MVQANPQILQPM
Sbjct  263  TTAPASGAPNSAPLNMFPQETLAGAGAGGALGSLDFLRNNQQFQTLRSMVQANPQILQPM  322

Query  550  LQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIE  371
            LQELGKQNP L+RLIQEHQA+FL+LINEP+EG EG+I  Q    MP A+ VTPEE+EAIE
Sbjct  323  LQELGKQNPQLLRLIQEHQAEFLQLINEPLEGSEGDIFDQPEQDMPHAINVTPEEQEAIE  382

Query  370  RLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            RLEAMGFDRALV+E + AC++NEELAANYLL+H  +FED
Sbjct  383  RLEAMGFDRALVIEAYLACDRNEELAANYLLEHAGDFED  421



>gb|KHG09850.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=362

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGKH*LANAFL--LLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P     G     +  L  L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  208  PVSGAPNSSPLNMFPQETLSGAAAGGDGSLDFLRNNQQFQALRSMVQSNPQILQPMLQEL  267

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP AV VTP E+EAIERLEA
Sbjct  268  GKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAVNVTPAEQEAIERLEA  327

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  328  MGFDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGKH*LANAFL--LLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P     G     +  L  L    QFQALR MVQ+NPQILQPMLQEL
Sbjct  208  PVSGAPNSSPLNMFPQETLSGAAAGGDGSLDFLRNNQQFQALRTMVQSNPQILQPMLQEL  267

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q    MP A+ VTP E+EAIERLEA
Sbjct  268  GKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEA  327

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  328  MGFDRALVIEAFLACDRNEELAANYLLENGGDFED  362



>gb|ABK24371.1| unknown [Picea sitchensis]
Length=390

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE  EG   ++LGQ 
Sbjct  276  QFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINEETEG---DLLGQF  332

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  333  AAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>gb|ACH72675.1| RAD23 [Pinus sylvestris var. mongolica]
Length=390

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQANPQILQPMLQEL KQNP LMRLIQ+HQA+FL LINE  +G   ++LGQ 
Sbjct  276  QFQALRTMVQANPQILQPMLQELSKQNPQLMRLIQDHQAEFLHLINEETDG---DLLGQF  332

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC+KNEELAANYLL+H  ++ED
Sbjct  333  AAEMPQSINVTPEEREAIERLEAMGFDRALVIEAFLACDKNEELAANYLLEHAADYED  390



>ref|XP_007024818.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY27440.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=373

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q 
Sbjct  256  QFQALRSMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQA  315

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  316  EQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  373



>gb|KJB34920.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=373

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGK--H*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P     G     L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  219  PVSGAPNSSPLNMFPQETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQEL  278

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEA
Sbjct  279  GKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEA  338

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  339  MGFDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N  +L   SQF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP E
Sbjct  261  GNLDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAE  320

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANYLL
Sbjct  321  GAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLL  380

Query  277  DHMHEFED  254
            DHM+EF+D
Sbjct  381  DHMNEFDD  388



>ref|XP_009797066.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Nicotiana 
sylvestris]
Length=296

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  748  SASIICYSYSTFPISHALRACHLSFLPHARNKGKH*LANAFLLLFC---SQFQALRAMVQ  578
            +++I   +    P+S A  +  L+  P     G    A    L F     QFQALR+MVQ
Sbjct  129  NSAIGTTTVPAAPVSGAPNSAPLNLFPQENVAGVGGAAALGSLDFLRNNQQFQALRSMVQ  188

Query  577  ANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQV  398
            +NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V V
Sbjct  189  SNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSV  248

Query  397  TPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            TP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  249  TPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  296



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  637  ANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVE  458
             N  +L   SQF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+QA+FLRLINEP E
Sbjct  260  GNLDVLRNNSQFRGLLSLVQANPQILQPLLQELGKQNPQILQLIQENQAEFLRLINEPAE  319

Query  457  GGEGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLL  278
            G EGN+L Q  A +PQ V VTP E EAI+RLE MGFDR LVLEVFFACNK+E+LAANYLL
Sbjct  320  GAEGNLLEQFGAGVPQTVAVTPAENEAIQRLEHMGFDRDLVLEVFFACNKDEQLAANYLL  379

Query  277  DHMHEFED  254
            DHM+EF+D
Sbjct  380  DHMNEFDD  387



>ref|XP_010034056.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53927.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=387

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q 
Sbjct  270  QFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQP  329

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  330  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  387



>ref|XP_010034055.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW53928.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=388

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q 
Sbjct  271  QFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQP  330

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  331  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  388



>ref|XP_010034057.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X3 [Eucalyptus 
grandis]
Length=374

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q 
Sbjct  257  QFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQP  316

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  317  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  374



>ref|XP_010034058.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X4 [Eucalyptus 
grandis]
 gb|KCW53926.1| hypothetical protein EUGRSUZ_J03137 [Eucalyptus grandis]
Length=373

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q 
Sbjct  256  QFQALRSMVQANPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLDGSEGDIFDQP  315

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  +FED
Sbjct  316  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDFED  373



>ref|XP_004303217.1| PREDICTED: ubiquitin receptor RAD23b [Fragaria vesca subsp. vesca]
Length=371

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQ LR+MVQANPQILQPMLQEL
Sbjct  217  PVSGAPNSAPLNMFPQEALSGAGAGALGSLDFLRNNHQFQTLRSMVQANPQILQPMLQEL  276

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLEA
Sbjct  277  GKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDMFDQPDQEMPHAINVTPAEQEAIERLEA  336

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  337  MGFDRALVIEAFLACDRNEELAANYLLENAGDFED  371



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR MVQ+NPQILQPMLQELGKQNP L+RLIQEH A+FL+LINEP+EG EG+I  Q 
Sbjct  200  QFQALRTMVQSNPQILQPMLQELGKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDIFDQA  259

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  260  EQEMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENGGDFED  317



>gb|KDP41924.1| hypothetical protein JCGZ_26942 [Jatropha curcas]
Length=352

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP+EG EG+I  Q+
Sbjct  235  QFQALRSMVQANPQILQPMLQELGKQNPQLLRMIQEHNAEFLQLINEPLEGSEGDIFDQV  294

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  295  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  352



>ref|XP_006427690.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
 gb|ESR40930.1| hypothetical protein CICLE_v100258682mg, partial [Citrus clementina]
Length=301

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGK--H*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S    +  L+  P     G     L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  147  PVSGVPNSSPLNMFPQETLSGAPAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQEL  206

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEHQ +FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEA
Sbjct  207  GKQNPQLLRLIQEHQTEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEA  266

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  267  MGFDRALVIEAFLACDRNEELAANYLLENAGDFED  301



>ref|XP_006845449.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
 gb|ERN07124.1| hypothetical protein AMTR_s00019p00116110 [Amborella trichopoda]
Length=370

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQ LR MVQANPQILQPMLQEL KQNP L+RLIQEHQA+FL+LINEP EG EG++ GQ 
Sbjct  253  QFQTLRHMVQANPQILQPMLQELSKQNPQLLRLIQEHQAEFLQLINEPAEGAEGDLFGQA  312

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MPQ++ VTPEEREAIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  313  EQDMPQSITVTPEEREAIERLEAMGFDRALVIEAFLACDRNEELAINYLLENPGDYED  370



>ref|XP_006493449.1| PREDICTED: ubiquitin receptor RAD23b-like [Citrus sinensis]
Length=377

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGK--H*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S    +  L+  P     G     L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  223  PVSGVPNSSPLNMFPQETLSGAPASGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQEL  282

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEHQA+FL+LINEPV+G EG++  Q    MP A+ VTP E+EAI+RLEA
Sbjct  283  GKQNPQLLRLIQEHQAEFLQLINEPVDGSEGDMFDQPEQDMPHAINVTPAEQEAIQRLEA  342

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  343  MGFDRALVIEAFLACDRNEELAANYLLENAGDFED  377



>gb|KJB34921.1| hypothetical protein B456_006G091100 [Gossypium raimondii]
Length=305

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGK--H*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P     G     L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  151  PVSGAPNSSPLNMFPQETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLQEL  210

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEA
Sbjct  211  GKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEA  270

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  271  MGFDRALVIEAFLACDRNEELAANYLLENSGDFED  305



>ref|XP_009797065.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
sylvestris]
Length=367

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  748  SASIICYSYSTFPISHALRACHLSFLPHARNKGKH*LANAFLLLFC---SQFQALRAMVQ  578
            +++I   +    P+S A  +  L+  P     G    A    L F     QFQALR+MVQ
Sbjct  200  NSAIGTTTVPAAPVSGAPNSAPLNLFPQENVAGVGGAAALGSLDFLRNNQQFQALRSMVQ  259

Query  577  ANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQV  398
            +NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V V
Sbjct  260  SNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSV  319

Query  397  TPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            TP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  320  TPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_009797063.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009797064.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
sylvestris]
Length=368

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -3

Query  748  SASIICYSYSTFPISHALRACHLSFLPHARNKGKH*LANAFLLLFC---SQFQALRAMVQ  578
            +++I   +    P+S A  +  L+  P     G    A    L F     QFQALR+MVQ
Sbjct  201  NSAIGTTTVPAAPVSGAPNSAPLNLFPQENVAGVGGAAALGSLDFLRNNQQFQALRSMVQ  260

Query  577  ANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQV  398
            +NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G++  Q    MP  V V
Sbjct  261  SNPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDLFDQPEQDMPHTVSV  320

Query  397  TPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            TP+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  321  TPQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  368



>emb|CBI25247.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q 
Sbjct  282  QFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQP  341

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  342  EQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED  399



>ref|XP_010655132.1| PREDICTED: ubiquitin receptor RAD23b [Vitis vinifera]
Length=411

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHL+RLIQEH A+FL+LINEP+EG EG+I  Q 
Sbjct  294  QFQALRAMVQANPQILQPMLQELGKQNPHLLRLIQEHHAEFLQLINEPLEGSEGDIFDQP  353

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               +P A+ VTP E+EAIERLEAMGFDRALV+E F AC++NEELA NYLL++  ++ED
Sbjct  354  EQELPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEELAVNYLLENAGDYED  411



>ref|XP_009598522.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nicotiana 
tomentosiformis]
Length=366

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  748  SASIICYSYSTFPISHALRACHLSFLPHARNKGKH*LANAFL--LLFCSQFQALRAMVQA  575
            +++I   +    P+S A  +  L+  P     G    A   L  L    QFQALR+MVQ+
Sbjct  200  NSAIGTTTVPAAPVSGAPNSAPLNLFPQENVAGAGGAALGSLDFLRNNQQFQALRSMVQS  259

Query  574  NPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVT  395
            NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VT
Sbjct  260  NPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVT  319

Query  394  PEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            P+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  320  PQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  366



>ref|XP_009598520.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009598521.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  748  SASIICYSYSTFPISHALRACHLSFLPHARNKGKH*LANAFL--LLFCSQFQALRAMVQA  575
            +++I   +    P+S A  +  L+  P     G    A   L  L    QFQALR+MVQ+
Sbjct  201  NSAIGTTTVPAAPVSGAPNSAPLNLFPQENVAGAGGAALGSLDFLRNNQQFQALRSMVQS  260

Query  574  NPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVT  395
            NPQILQPMLQELGKQNP L+R+IQEH  +FL+LINEPV+G +G+I  Q    MP  V VT
Sbjct  261  NPQILQPMLQELGKQNPQLLRMIQEHHQEFLQLINEPVDGSDGDIFDQPEQDMPHTVSVT  320

Query  394  PEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            P+E+EAIERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  321  PQEQEAIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|XP_007215553.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
 gb|EMJ16752.1| hypothetical protein PRUPE_ppa007284mg [Prunus persica]
Length=374

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQANPQILQPMLQEL
Sbjct  217  PVSGAPNSAPLNMFPQETLSGAGAGALGSLAFLRNNRQFQALRSMVQANPQILQPMLQEL  276

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEP+EG EG+I  Q       MP A+ VTP E+EAIER
Sbjct  277  GKQNPQLLRLIQEHHTEFLQLINEPLEGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIER  336

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  337  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  374



>ref|XP_009365249.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
Length=374

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQANPQILQPMLQEL
Sbjct  217  PVSGAPNSAPLNMFPQETLSGAGAGALGSLDFLRNNRQFQALRSMVQANPQILQPMLQEL  276

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEP+EG EG+I  Q       MP A+ VTP E+EAIER
Sbjct  277  GKQNPQLLRLIQEHHTEFLQLINEPLEGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIER  336

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  ++ED
Sbjct  337  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED  374



>ref|XP_008342756.1| PREDICTED: ubiquitin receptor RAD23b-like [Malus domestica]
Length=369

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  212  PVSGAPNSAPLNMFPQETLSGAGAGALGSLDFLRNNRQFQALRSMVQSNPQILQPMLQEL  271

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEPVEG EG+I  Q       +P A+ VTP E+EAIER
Sbjct  272  GKQNPQLLRLIQEHHTEFLQLINEPVEGSEGDIFDQADGPDQDLPHAINVTPAEQEAIER  331

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  332  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  369



>ref|XP_008228865.1| PREDICTED: ubiquitin receptor RAD23b-like [Prunus mume]
Length=374

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQANPQILQPMLQEL
Sbjct  217  PVSGAPNSAPLNMFPQETLSGAGAGALGSLAFLRNNRQFQALRSMVQANPQILQPMLQEL  276

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEP+EG EG+I  Q       MP A+ VTP E+EAIER
Sbjct  277  GKQNPQLLRLIQEHHTEFLQLINEPLEGSEGDIFDQPDGPDQDMPHAINVTPAEQEAIER  336

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  337  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  374



>gb|KHG13236.1| Putative DNA repair RAD23-1 -like protein [Gossypium arboreum]
Length=373

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGK--H*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P     G     L +   L    QFQALR+MVQ+NPQILQPML EL
Sbjct  219  PVSGAPNSSPLNMFPQETLSGAAAGGLGSLDFLRNNQQFQALRSMVQSNPQILQPMLLEL  278

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLEA  359
            GKQNP L+RLIQEH A+FL+LINEP++G EG+I  Q    MP A+ VTP E+EAIERLEA
Sbjct  279  GKQNPQLLRLIQEHHAEFLQLINEPLQGSEGDIFDQAEQEMPHAINVTPAEQEAIERLEA  338

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  339  MGFDRALVIEAFLACDRNEELAANYLLENSGDFED  373



>ref|XP_008381164.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Malus domestica]
Length=315

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQANPQILQPMLQEL
Sbjct  158  PVSGAPNSAPLNMFPQETLSGAGAGALGSLDFLRNNRQFQALRSMVQANPQILQPMLQEL  217

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEP+EG EG I  Q       MP A+ VTP E+EAIER
Sbjct  218  GKQNPQLLRLIQEHHTEFLQLINEPLEGSEGGIFDQPDGPDQDMPHAINVTPAEQEAIER  277

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  ++ED
Sbjct  278  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED  315



>ref|XP_009354240.1| PREDICTED: ubiquitin receptor RAD23b-like [Pyrus x bretschneideri]
 ref|XP_009370969.1| PREDICTED: ubiquitin receptor RAD23b [Pyrus x bretschneideri]
Length=369

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQ+NPQILQPMLQEL
Sbjct  212  PVSGAPNSAPLNMFPQETLSGAGAGALGSLDFLRNNRQFQALRSMVQSNPQILQPMLQEL  271

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEPVEG EG+I  Q       +P A+ VTP E+EAIER
Sbjct  272  GKQNPQLLRLIQEHHTEFLQLINEPVEGSEGDIFDQPDGPDQDLPHAINVTPAEQEAIER  331

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  332  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDFED  369



>ref|XP_002303970.1| DNA repair protein RAD23 [Populus trichocarpa]
 gb|EEE78949.1| DNA repair protein RAD23 [Populus trichocarpa]
Length=358

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q 
Sbjct  241  QFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQP  300

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  301  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  358



>ref|XP_011020549.1| PREDICTED: ubiquitin receptor RAD23b-like [Populus euphratica]
Length=372

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q 
Sbjct  255  QFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQP  314

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  315  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 101/118 (86%), Gaps = 5/118 (4%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALRAMVQANPQILQPMLQELGKQNPHLM+LIQEHQ+DFL LINEP EG E      L
Sbjct  264  QFQALRAMVQANPQILQPMLQELGKQNPHLMQLIQEHQSDFLNLINEP-EGEE----NPL  318

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AA M QA+ VTPEE EAI+RLE MGFDR LVLEVF ACN+NE+LAANYLLDH +EF+D
Sbjct  319  AAGMTQAITVTPEEDEAIQRLEDMGFDRDLVLEVFIACNRNEDLAANYLLDHQNEFDD  376



>ref|XP_008381163.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Malus domestica]
Length=374

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = -3

Query  712  PISHALRACHLSFLPHA--RNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQEL  539
            P+S A  +  L+  P       G   L +   L    QFQALR+MVQANPQILQPMLQEL
Sbjct  217  PVSGAPNSAPLNMFPQETLSGAGAGALGSLDFLRNNRQFQALRSMVQANPQILQPMLQEL  276

Query  538  GKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAA---SMPQAVQVTPEEREAIER  368
            GKQNP L+RLIQEH  +FL+LINEP+EG EG I  Q       MP A+ VTP E+EAIER
Sbjct  277  GKQNPQLLRLIQEHHTEFLQLINEPLEGSEGGIFDQPDGPDQDMPHAINVTPAEQEAIER  336

Query  367  LEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            LEAMGFDRALV+E F AC++NEELAANYLL++  ++ED
Sbjct  337  LEAMGFDRALVIEAFLACDRNEELAANYLLENAGDYED  374



>ref|XP_006385947.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
 gb|ERP63744.1| hypothetical protein POPTR_0003s18540g [Populus trichocarpa]
Length=372

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+R+IQEH A+FL+LINEP++G EG+I  Q 
Sbjct  255  QFQALRSMVQANPQILQPMLQELGKQNPQLLRIIQEHHAEFLQLINEPLDGSEGDIFDQP  314

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               MP A+ VTP E+EAIERLEAMGFDRALV+E F AC++NE+LAANYLL++  +FED
Sbjct  315  DQDMPHAINVTPAEQEAIERLEAMGFDRALVIEAFLACDRNEQLAANYLLENAGDFED  372



>ref|XP_009117771.1| PREDICTED: probable ubiquitin receptor RAD23a [Brassica rapa]
 emb|CDY52848.1| BnaA09g56400D [Brassica napus]
Length=359

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGK  533
            P S    +  L   P     G   L     L    QFQ LR+MV +NPQILQPMLQELGK
Sbjct  205  PTSGGPNSSPLDLFPQEAEAGAGELGTLDFLRGNDQFQQLRSMVNSNPQILQPMLQELGK  264

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEG--NILGQLAASMPQAVQVTPEEREAIERLEA  359
            QNP L+RLIQE+QA+FL+LINEP EG +G  +IL Q    MP AV VTP E+EAI+RLEA
Sbjct  265  QNPQLLRLIQENQAEFLQLINEPYEGSDGEMDILDQPEQEMPHAVNVTPAEQEAIQRLEA  324

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  325  MGFDRALVIEAFLACDRNEELAANYLLENSADFED  359



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -3

Query  718  TFPISHALRACHLSFLPHAR-NKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQE  542
            + P+S A  +  L+  P    N       +   L    QFQALR+MVQANPQILQPMLQE
Sbjct  223  SAPLSGAPNSSPLNLFPQETLNPSAAAGGSLDFLRNSQQFQALRSMVQANPQILQPMLQE  282

Query  541  LGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLE  362
            L KQNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLE
Sbjct  283  LSKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLE  342

Query  361  AMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AMGFDRALV+E F AC++NEELA NYLL++  +FED
Sbjct  343  AMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED  378



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -3

Query  718  TFPISHALRACHLSFLPHAR-NKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQE  542
            T P+S    +  L+  P    N G     +   L    QFQALR+MVQANPQILQPMLQE
Sbjct  232  TAPVSGLPNSSPLNLFPQETLNSGAVGDGSLDFLRNNQQFQALRSMVQANPQILQPMLQE  291

Query  541  LGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQLAASMPQAVQVTPEEREAIERLE  362
            L KQNP L+RLIQEH A+FL+LINEP+EG EG++  Q    MP A+ VTP E+EAIERLE
Sbjct  292  LSKQNPQLLRLIQEHHAEFLQLINEPLEGSEGDLFDQPEQDMPHAISVTPAEQEAIERLE  351

Query  361  AMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            AMGFDRALV+E F AC++NEELA NYLL++  +FED
Sbjct  352  AMGFDRALVIEAFLACDRNEELAVNYLLENAGDFED  387



>emb|CDX81753.1| BnaC08g38480D [Brassica napus]
Length=363

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 109/155 (70%), Gaps = 2/155 (1%)
 Frame = -3

Query  712  PISHALRACHLSFLPHARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGK  533
            P S    +  L   P     G   L     L    QFQ LR+MV +NPQILQPMLQELGK
Sbjct  209  PASGGPNSSPLDLFPQEAEAGAGELGTLDFLRGNDQFQQLRSMVNSNPQILQPMLQELGK  268

Query  532  QNPHLMRLIQEHQADFLRLINEPVEGGEG--NILGQLAASMPQAVQVTPEEREAIERLEA  359
            QNP L+RLIQE+QA+FL+LINEP EG +G  +IL Q    MP AV VTP E+EAI+RLEA
Sbjct  269  QNPQLLRLIQENQAEFLQLINEPYEGSDGEMDILDQPEQEMPHAVNVTPAEQEAIQRLEA  328

Query  358  MGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
            MGFDRALV+E F AC++NEELAANYLL++  +FED
Sbjct  329  MGFDRALVIEAFLACDRNEELAANYLLENSADFED  363



>ref|XP_006341431.1| PREDICTED: ubiquitin receptor RAD23b-like [Solanum tuberosum]
Length=367

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -3

Query  607  QFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQADFLRLINEPVEGGEGNILGQL  428
            QFQALR+MVQANPQILQPMLQELGKQNP L+R IQEH  +FL+LINEPV+G +G++  Q 
Sbjct  250  QFQALRSMVQANPQILQPMLQELGKQNPQLLRSIQEHDQEFLQLINEPVDGSDGDMFDQA  309

Query  427  AASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED  254
               +P  V VTPEE+E IERLEAMGFDRALV+E F AC++NEELAANYLL+H  ++ED
Sbjct  310  EQEIPHTVSVTPEEQEVIERLEAMGFDRALVIEAFLACDRNEELAANYLLEHAGDYED  367



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  673  LPHARNKGKH*LANAFLLLFCSQFQALRAMVQANPQILQPMLQELGKQNPHLMRLIQEHQ  494
            LP+A       L N   L   +QF+ L ++VQANPQILQP+LQELGKQNP +++LIQE+Q
Sbjct  249  LPNASTDAAG-LGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQNPQILQLIQENQ  307

Query  493  ADFLRLINEPVEGG-EGNILGQLAASMPQAVQVTPEEREAIERLEAMGFDRALVLEVFFA  317
            A+FL LINEP EG  E N+L Q   +MPQ + VTPEE EAI RLEAMGFDRALVL+VFFA
Sbjct  308  AEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAMGFDRALVLDVFFA  367

Query  316  CNKNEELAANYLLDHMHEFED  254
            CNK+E+LAANYLLDHM+EF+D
Sbjct  368  CNKDEQLAANYLLDHMNEFDD  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100