BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007M01

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626298.1|  PREDICTED: general transcription factor IIH ...    318   3e-105   Nicotiana tomentosiformis
ref|XP_009776618.1|  PREDICTED: general transcription factor IIH ...    318   4e-105   Nicotiana sylvestris
ref|XP_006347459.1|  PREDICTED: general transcription factor IIH ...    317   1e-104   Solanum tuberosum [potatoes]
ref|XP_004241513.1|  PREDICTED: general transcription factor IIH ...    315   4e-104   Solanum lycopersicum
ref|XP_011101336.1|  PREDICTED: general transcription factor IIH ...    315   8e-104   Sesamum indicum [beniseed]
gb|EYU17663.1|  hypothetical protein MIMGU_mgv1a011002mg                315   8e-104   Erythranthe guttata [common monkey flower]
emb|CDP12389.1|  unnamed protein product                                302   5e-99    Coffea canephora [robusta coffee]
emb|CBI19033.3|  unnamed protein product                                294   9e-96    Vitis vinifera
ref|XP_002284465.2|  PREDICTED: general transcription factor IIH ...    294   9e-96    Vitis vinifera
gb|KDO80687.1|  hypothetical protein CISIN_1g022374mg                   287   4e-94    Citrus sinensis [apfelsine]
ref|XP_010675078.1|  PREDICTED: general transcription factor IIH ...    289   5e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO80684.1|  hypothetical protein CISIN_1g022374mg                   290   5e-94    Citrus sinensis [apfelsine]
ref|XP_006472762.1|  PREDICTED: general transcription factor IIH ...    290   7e-94    Citrus sinensis [apfelsine]
ref|XP_010675067.1|  PREDICTED: general transcription factor IIH ...    290   7e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB59107.1|  hypothetical protein B456_009G245300                    285   3e-93    Gossypium raimondii
gb|KJB59104.1|  hypothetical protein B456_009G245300                    288   3e-93    Gossypium raimondii
ref|XP_007019036.1|  Basal transcription factor complex subunit-r...    286   2e-92    
ref|XP_010999370.1|  PREDICTED: general transcription factor IIH ...    284   1e-91    Populus euphratica
ref|NP_564050.1|  basal transcription factor complex subunit-rela...    283   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892997.1|  hypothetical protein ARALYDRAFT_472054             283   2e-91    
ref|XP_010498221.1|  PREDICTED: general transcription factor IIH ...    283   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002307429.2|  basal transcription factor complex subunit-r...    283   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010459446.1|  PREDICTED: general transcription factor IIH ...    283   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010477011.1|  PREDICTED: general transcription factor IIH ...    282   5e-91    Camelina sativa [gold-of-pleasure]
gb|KDP32789.1|  hypothetical protein JCGZ_12081                         279   7e-90    Jatropha curcas
ref|XP_010273663.1|  PREDICTED: general transcription factor IIH ...    279   9e-90    Nelumbo nucifera [Indian lotus]
ref|XP_006305456.1|  hypothetical protein CARUB_v10009867mg             278   2e-89    Capsella rubella
ref|XP_008219657.1|  PREDICTED: general transcription factor IIH ...    278   2e-89    Prunus mume [ume]
ref|XP_008391898.1|  PREDICTED: general transcription factor IIH ...    278   2e-89    
ref|XP_009363173.1|  PREDICTED: general transcription factor IIH ...    277   3e-89    Pyrus x bretschneideri [bai li]
ref|XP_004152842.1|  PREDICTED: general transcription factor IIH ...    276   1e-88    Cucumis sativus [cucumbers]
gb|KDO80685.1|  hypothetical protein CISIN_1g022374mg                   276   1e-88    Citrus sinensis [apfelsine]
ref|XP_006472763.1|  PREDICTED: general transcription factor IIH ...    276   2e-88    Citrus sinensis [apfelsine]
ref|NP_001131186.1|  hypothetical protein                               275   2e-88    Zea mays [maize]
ref|XP_010065813.1|  PREDICTED: general transcription factor IIH ...    275   2e-88    Eucalyptus grandis [rose gum]
ref|XP_010530197.1|  PREDICTED: general transcription factor IIH ...    275   4e-88    Tarenaya hassleriana [spider flower]
gb|KJB59110.1|  hypothetical protein B456_009G245300                    274   8e-88    Gossypium raimondii
gb|ADE77788.1|  unknown                                                 273   2e-87    Picea sitchensis
ref|XP_006416613.1|  hypothetical protein EUTSA_v10008316mg             272   3e-87    Eutrema salsugineum [saltwater cress]
gb|AES71297.2|  general transcription factor IIH subunit, putative      272   6e-87    Medicago truncatula
ref|XP_003573866.1|  PREDICTED: general transcription factor IIH ...    271   6e-87    Brachypodium distachyon [annual false brome]
ref|XP_008441918.1|  PREDICTED: LOW QUALITY PROTEIN: general tran...    271   7e-87    
ref|XP_004290857.1|  PREDICTED: general transcription factor IIH ...    271   7e-87    Fragaria vesca subsp. vesca
ref|XP_007223251.1|  hypothetical protein PRUPE_ppa009386mg             271   7e-87    
ref|XP_004290858.1|  PREDICTED: general transcription factor IIH ...    271   8e-87    Fragaria vesca subsp. vesca
ref|XP_010999372.1|  PREDICTED: general transcription factor IIH ...    271   8e-87    Populus euphratica
emb|CDY19207.1|  BnaC05g14080D                                          271   1e-86    Brassica napus [oilseed rape]
emb|CDY26168.1|  BnaA06g12490D                                          271   1e-86    Brassica napus [oilseed rape]
ref|XP_009149277.1|  PREDICTED: general transcription factor IIH ...    270   3e-86    Brassica rapa
ref|XP_010999369.1|  PREDICTED: general transcription factor IIH ...    274   3e-86    Populus euphratica
ref|XP_004500559.1|  PREDICTED: general transcription factor IIH ...    269   7e-86    
dbj|BAK06937.1|  predicted protein                                      268   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008802071.1|  PREDICTED: general transcription factor IIH ...    273   2e-85    
ref|XP_008802068.1|  PREDICTED: general transcription factor IIH ...    273   3e-85    
ref|XP_010916569.1|  PREDICTED: general transcription factor IIH ...    267   7e-85    
ref|XP_010273665.1|  PREDICTED: general transcription factor IIH ...    266   8e-85    
ref|XP_008367337.1|  PREDICTED: general transcription factor IIH ...    265   8e-85    
ref|XP_008676482.1|  PREDICTED: hypothetical protein isoform X1         266   8e-85    
emb|CDX96723.1|  BnaA08g22660D                                          265   2e-84    
ref|XP_010916571.1|  PREDICTED: general transcription factor IIH ...    265   2e-84    
ref|XP_007137405.1|  hypothetical protein PHAVU_009G124300g             264   4e-84    Phaseolus vulgaris [French bean]
ref|XP_004952041.1|  PREDICTED: general transcription factor IIH ...    263   7e-84    Setaria italica
ref|XP_009110347.1|  PREDICTED: general transcription factor IIH ...    263   2e-83    Brassica rapa
ref|XP_003523449.1|  PREDICTED: general transcription factor IIH ...    262   3e-83    Glycine max [soybeans]
ref|XP_010916572.1|  PREDICTED: general transcription factor IIH ...    261   5e-83    
ref|NP_001045748.1|  Os02g0125800                                       261   6e-83    
gb|KHN09200.1|  General transcription factor IIH subunit 3              261   6e-83    Glycine soja [wild soybean]
ref|XP_009409176.1|  PREDICTED: general transcription factor IIH ...    260   4e-82    
ref|NP_001242062.1|  uncharacterized protein LOC100776751               259   4e-82    Glycine max [soybeans]
ref|XP_006648269.1|  PREDICTED: general transcription factor IIH ...    259   5e-82    
emb|CDX83854.1|  BnaC08g17910D                                          258   7e-82    
gb|KEH34826.1|  general transcription factor IIH subunit, putative      258   9e-82    Medicago truncatula
gb|KEH34827.1|  general transcription factor IIH subunit, putative      258   1e-81    Medicago truncatula
ref|XP_003601046.1|  General transcription factor IIH subunit           259   1e-81    
ref|XP_010233747.1|  PREDICTED: general transcription factor IIH ...    257   2e-81    
ref|XP_008802070.1|  PREDICTED: general transcription factor IIH ...    259   7e-80    
ref|XP_010916570.1|  PREDICTED: general transcription factor IIH ...    253   2e-79    
ref|XP_010273664.1|  PREDICTED: general transcription factor IIH ...    251   5e-79    Nelumbo nucifera [Indian lotus]
ref|XP_006578973.1|  PREDICTED: general transcription factor IIH ...    249   2e-78    Glycine max [soybeans]
ref|XP_004500558.1|  PREDICTED: general transcription factor IIH ...    250   2e-78    
ref|XP_004952042.1|  PREDICTED: general transcription factor IIH ...    249   2e-78    Setaria italica
ref|XP_006580978.1|  PREDICTED: uncharacterized protein LOC100776...    249   3e-78    Glycine max [soybeans]
ref|XP_001753108.1|  predicted protein                                  245   5e-77    
ref|XP_009409179.1|  PREDICTED: general transcription factor IIH ...    246   8e-77    
ref|XP_002532948.1|  RNA polymerase II transcription factor B sub...    241   2e-75    
ref|XP_006828057.1|  hypothetical protein AMTR_s00008p00264310          240   7e-75    
gb|KJB59106.1|  hypothetical protein B456_009G245300                    212   3e-64    Gossypium raimondii
ref|XP_007019037.1|  Basal transcription factor complex subunit-r...    207   4e-62    
gb|EMT22292.1|  General transcription factor IIH subunit 3              205   2e-61    
ref|XP_010916573.1|  PREDICTED: general transcription factor IIH ...    202   6e-60    
ref|XP_005650835.1|  transcription factor Tfb4                          200   7e-59    Coccomyxa subellipsoidea C-169
gb|EEC72394.1|  hypothetical protein OsI_05675                          195   2e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_006434173.1|  hypothetical protein CICLE_v100020022mg            188   2e-56    
ref|XP_004169281.1|  PREDICTED: general transcription factor IIH ...    184   7e-55    
gb|KHG29334.1|  General transcription factor IIH subunit 3              184   6e-53    Gossypium arboreum [tree cotton]
ref|XP_003283083.1|  hypothetical protein DICPUDRAFT_9126               180   2e-51    Dictyostelium purpureum
ref|XP_005845495.1|  hypothetical protein CHLNCDRAFT_13819              173   1e-50    Chlorella variabilis
ref|XP_001415467.1|  predicted protein                                  171   3e-48    Ostreococcus lucimarinus CCE9901
ref|XP_009823444.1|  hypothetical protein H257_01771                    171   5e-48    Aphanomyces astaci
emb|CEG73089.1|  hypothetical protein RMATCC62417_08534                 171   6e-48    Rhizopus microsporus
gb|KDO30370.1|  hypothetical protein SPRG_05081                         170   1e-47    Saprolegnia parasitica CBS 223.65
ref|XP_008606098.1|  hypothetical protein SDRG_02296                    169   3e-47    Saprolegnia diclina VS20
emb|CDS09653.1|  hypothetical protein LRAMOSA11013                      169   7e-47    Lichtheimia ramosa
ref|XP_004360639.1|  general transcription factor IIH                   167   3e-46    Cavenderia fasciculata
gb|EXX76109.1|  Tfb4p                                                   166   5e-46    Rhizophagus irregularis DAOM 197198w
gb|ESA11069.1|  hypothetical protein GLOINDRAFT_193002                  167   5e-46    
dbj|GAM28580.1|  hypothetical protein SAMD00019534_117560               164   7e-45    Acytostelium subglobosum LB1
ref|XP_008866339.1|  hypothetical protein H310_04008                    162   1e-44    Aphanomyces invadans
ref|XP_003323260.2|  hypothetical protein PGTG_04797                    163   1e-44    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007415046.1|  hypothetical protein MELLADRAFT_110826             162   2e-44    Melampsora larici-populina 98AG31
gb|EPS73731.1|  hypothetical protein M569_01027                         159   4e-44    Genlisea aurea
ref|XP_643618.1|  general transcription factor IIH, polypeptide 3       162   8e-44    Dictyostelium discoideum AX4
gb|KFH63921.1|  hypothetical protein MVEG_09746                         161   9e-44    Mortierella verticillata NRRL 6337
ref|XP_009529831.1|  hypothetical protein PHYSODRAFT_508027             160   9e-44    Phytophthora sojae
ref|XP_002908844.1|  general transcription factor IIH subunit, pu...    160   1e-43    Phytophthora infestans T30-4
gb|ETI47842.1|  hypothetical protein F443_07986                         159   2e-43    Phytophthora parasitica P1569
ref|XP_008904731.1|  hypothetical protein PPTG_10953                    159   2e-43    Phytophthora parasitica INRA-310
emb|CCA24938.1|  general transcription factor IIH subunit putative      159   2e-43    Albugo laibachii Nc14
gb|KEH34828.1|  general transcription factor IIH subunit, putative      157   2e-43    Medicago truncatula
emb|CCI50237.1|  unnamed protein product                                159   2e-43    Albugo candida
gb|ETL94412.1|  hypothetical protein L917_07627                         159   3e-43    Phytophthora parasitica
ref|XP_002676214.1|  predicted protein                                  159   7e-43    Naegleria gruberi strain NEG-M
gb|KCW63476.1|  hypothetical protein EUGRSUZ_G01112                     158   9e-43    Eucalyptus grandis [rose gum]
gb|KIJ19132.1|  hypothetical protein PAXINDRAFT_109674                  154   3e-41    Paxillus involutus ATCC 200175
ref|XP_003074271.1|  basal transcription factor complex subunit-r...    154   4e-41    
emb|CEP17684.1|  hypothetical protein                                   154   6e-41    Parasitella parasitica
gb|EWM26854.1|  general transcription factor iih                        153   3e-40    Nannochloropsis gaditana
gb|EWM26855.1|  general transcription factor iih                        153   3e-40    Nannochloropsis gaditana
gb|EXX76110.1|  Tfb4p                                                   150   4e-40    Rhizophagus irregularis DAOM 197198w
ref|XP_011448626.1|  PREDICTED: general transcription factor IIH ...    150   5e-40    Crassostrea gigas
gb|ETN62327.1|  TFIIH basal transcription factor complex p34 subunit    150   5e-40    Anopheles darlingi [American malaria mosquito]
gb|KDQ21367.1|  hypothetical protein BOTBODRAFT_25802                   151   6e-40    Botryobasidium botryosum FD-172 SS1
ref|XP_001662634.1|  AAEL012523-PA                                      150   6e-40    
dbj|GAA93863.1|  hypothetical protein E5Q_00509                         151   6e-40    Mixia osmundae IAM 14324
ref|XP_005189282.1|  PREDICTED: general transcription factor IIH ...    150   6e-40    Musca domestica
gb|KIK26971.1|  hypothetical protein PISMIDRAFT_675275                  150   9e-40    Pisolithus microcarpus 441
ref|XP_011142778.1|  PREDICTED: general transcription factor IIH ...    149   2e-39    Harpegnathos saltator
ref|XP_011063092.1|  PREDICTED: general transcription factor IIH ...    149   2e-39    Acromyrmex echinatior
ref|XP_010091384.1|  General transcription factor IIH subunit 3         147   2e-39    
gb|KIO09913.1|  hypothetical protein M404DRAFT_130737                   149   5e-39    Pisolithus tinctorius Marx 270
ref|XP_002003554.1|  GI21952                                            147   7e-39    Drosophila mojavensis
ref|XP_010220468.1|  PREDICTED: general transcription factor IIH ...    147   7e-39    Tinamus guttatus
ref|XP_011160004.1|  PREDICTED: general transcription factor IIH ...    147   7e-39    Solenopsis invicta [imported red fire ant]
ref|XP_001968252.1|  GG24611                                            147   7e-39    Drosophila erecta
ref|XP_005100664.1|  PREDICTED: general transcription factor IIH ...    147   9e-39    Aplysia californica
ref|XP_001988455.1|  GH10566                                            147   1e-38    Drosophila grimshawi
gb|KIM45246.1|  hypothetical protein M413DRAFT_39084                    147   1e-38    Hebeloma cylindrosporum h7
ref|XP_009641428.1|  PREDICTED: general transcription factor IIH ...    146   1e-38    Egretta garzetta
ref|XP_010015384.1|  PREDICTED: general transcription factor IIH ...    146   1e-38    Nestor notabilis
ref|XP_005498319.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Columba livia [carrier pigeon]
ref|XP_007489992.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Monodelphis domestica
ref|XP_009995910.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Chaetura pelagica
ref|XP_002052933.1|  GJ17829                                            146   2e-38    
gb|KFB35291.1|  hypothetical protein ZHAS_00001517                      150   2e-38    Anopheles sinensis
ref|XP_008491568.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    
ref|XP_010718381.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Meleagris gallopavo [common turkey]
ref|XP_011178395.1|  PREDICTED: general transcription factor IIH ...    146   2e-38    
ref|XP_010159847.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Eurypyga helias
ref|XP_005016337.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    
ref|XP_009664928.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Struthio camelus australis
ref|XP_010197275.1|  PREDICTED: general transcription factor IIH ...    145   2e-38    Colius striatus
ref|XP_316918.4|  AGAP008522-PA                                         145   3e-38    Anopheles gambiae str. PEST
ref|XP_007844054.1|  rna polymerase ii transcription factor b sub...    146   3e-38    
ref|XP_011331600.1|  PREDICTED: general transcription factor IIH ...    145   3e-38    
gb|KIM69186.1|  hypothetical protein SCLCIDRAFT_13298                   146   4e-38    Scleroderma citrinum Foug A
gb|KJA20721.1|  hypothetical protein HYPSUDRAFT_118008                  145   4e-38    Hypholoma sublateritium FD-334 SS-4
ref|XP_001842028.1|  TFIIH basal transcription factor complex p34...    145   4e-38    Culex quinquefasciatus
ref|XP_001375408.3|  PREDICTED: general transcription factor IIH ...    146   4e-38    Monodelphis domestica
ref|XP_011314254.1|  PREDICTED: general transcription factor IIH ...    145   4e-38    Fopius arisanus
ref|XP_009866840.1|  PREDICTED: general transcription factor IIH ...    144   5e-38    Apaloderma vittatum
dbj|GAN02372.1|  tfb4-domain-containing protein                         145   5e-38    Mucor ambiguus
ref|XP_011207828.1|  PREDICTED: general transcription factor IIH ...    145   5e-38    Bactrocera dorsalis [papaya fruit fly]
ref|NP_001264448.1|  general transcription factor IIH subunit 3         145   5e-38    Gallus gallus [bantam]
ref|XP_003761131.1|  PREDICTED: general transcription factor IIH ...    145   5e-38    
ref|XP_001357006.2|  GA18615                                            145   5e-38    Drosophila pseudoobscura pseudoobscura
ref|XP_009705558.1|  PREDICTED: general transcription factor IIH ...    144   5e-38    Cariama cristata
ref|XP_004526613.1|  PREDICTED: general transcription factor IIH ...    145   5e-38    Ceratitis capitata [medfly]
ref|XP_002189370.2|  PREDICTED: general transcription factor IIH ...    144   5e-38    
ref|XP_009483660.1|  PREDICTED: general transcription factor IIH ...    144   6e-38    Pelecanus crispus
ref|XP_003397229.1|  PREDICTED: general transcription factor IIH ...    145   6e-38    Bombus terrestris [large earth bumblebee]
ref|XP_010777418.1|  PREDICTED: general transcription factor IIH ...    145   6e-38    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003488130.1|  PREDICTED: general transcription factor IIH ...    145   6e-38    Bombus impatiens
ref|XP_009984347.1|  PREDICTED: general transcription factor IIH ...    144   6e-38    Tauraco erythrolophus
ref|XP_005298780.1|  PREDICTED: general transcription factor IIH ...    145   6e-38    Chrysemys picta bellii
ref|XP_010137832.1|  PREDICTED: general transcription factor IIH ...    144   7e-38    Buceros rhinoceros silvestris
ref|XP_009955352.1|  PREDICTED: general transcription factor IIH ...    144   7e-38    Leptosomus discolor
ref|XP_009878559.1|  PREDICTED: general transcription factor IIH ...    144   7e-38    Charadrius vociferus
ref|XP_005231215.1|  PREDICTED: general transcription factor IIH ...    144   7e-38    Falco peregrinus [peregrine]
ref|XP_008941414.1|  PREDICTED: general transcription factor IIH ...    143   7e-38    Merops nubicus
ref|XP_009319434.1|  PREDICTED: general transcription factor IIH ...    144   7e-38    Pygoscelis adeliae
ref|XP_010602612.1|  PREDICTED: general transcription factor IIH ...    145   7e-38    Fukomys damarensis [Damara mole rat]
ref|XP_011260725.1|  PREDICTED: general transcription factor IIH ...    144   8e-38    Camponotus floridanus
ref|XP_010285864.1|  PREDICTED: general transcription factor IIH ...    144   8e-38    Phaethon lepturus
ref|XP_007767079.1|  transcription factor Tfb4                          145   8e-38    Coniophora puteana RWD-64-598 SS2
ref|XP_007665097.1|  PREDICTED: general transcription factor IIH ...    144   9e-38    
ref|XP_003462950.1|  PREDICTED: general transcription factor IIH ...    145   9e-38    Cavia porcellus [guinea pig]
ref|XP_009930792.1|  PREDICTED: general transcription factor IIH ...    144   9e-38    Opisthocomus hoazin [hoatzin]
ref|XP_010170724.1|  PREDICTED: general transcription factor IIH ...    144   9e-38    Antrostomus carolinensis
ref|XP_006910038.1|  PREDICTED: general transcription factor IIH ...    144   9e-38    Pteropus alecto
ref|XP_007381488.1|  transcription factor Tfb4                          145   9e-38    Punctularia strigosozonata HHB-11173 SS5
ref|XP_010305484.1|  PREDICTED: general transcription factor IIH ...    144   9e-38    Balearica regulorum gibbericeps
ref|XP_008924891.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    
ref|XP_009471282.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Nipponia nippon
ref|XP_009282205.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Aptenodytes forsteri
ref|XP_004636025.1|  PREDICTED: general transcription factor IIH ...    145   1e-37    
ref|XP_009572811.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Fulmarus glacialis
ref|XP_005524288.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    
ref|XP_002077716.1|  GD22925                                            144   1e-37    Drosophila simulans
ref|XP_006619790.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Apis dorsata [rock honeybee]
ref|XP_006119740.1|  PREDICTED: general transcription factor IIH ...    145   1e-37    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009501525.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Phalacrocorax carbo [common cormorant]
ref|XP_791329.2|  PREDICTED: general transcription factor IIH sub...    145   1e-37    
ref|XP_394705.3|  PREDICTED: general transcription factor IIH sub...    144   1e-37    Apis mellifera [bee]
ref|XP_008632244.1|  PREDICTED: general transcription factor IIH ...    143   1e-37    Corvus brachyrhynchos
ref|XP_009907858.1|  PREDICTED: general transcription factor IIH ...    143   1e-37    Picoides pubescens
ref|XP_001877780.1|  predicted protein                                  145   1e-37    Laccaria bicolor S238N-H82
ref|XP_003698948.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Apis florea [dwarf honeybee]
gb|KIK09917.1|  hypothetical protein K443DRAFT_127299                   145   1e-37    Laccaria amethystina LaAM-08-1
ref|XP_002041670.1|  GM16625                                            144   1e-37    Drosophila sechellia
ref|XP_005424057.1|  PREDICTED: general transcription factor IIH ...    143   1e-37    Geospiza fortis
ref|NP_001120625.1|  general transcription factor IIH, polypeptid...    141   1e-37    Xenopus tropicalis [western clawed frog]
ref|XP_009071590.1|  PREDICTED: general transcription factor IIH ...    143   1e-37    Acanthisitta chloris
ref|XP_007424720.1|  PREDICTED: general transcription factor IIH ...    144   1e-37    Python bivittatus
ref|XP_010189243.1|  PREDICTED: general transcription factor IIH ...    143   1e-37    Mesitornis unicolor
ref|XP_009920938.1|  PREDICTED: general transcription factor IIH ...    143   2e-37    Haliaeetus albicilla
ref|XP_007424719.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    
gb|EPB87532.1|  hypothetical protein HMPREF1544_05623                   144   2e-37    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_010082753.1|  PREDICTED: general transcription factor IIH ...    143   2e-37    Pterocles gutturalis
gb|AAH31030.1|  Unknown (protein for IMAGE:4724313)                     142   2e-37    Homo sapiens [man]
ref|XP_005055218.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    Ficedula albicollis
gb|ERL91675.1|  hypothetical protein D910_09003                         144   2e-37    Dendroctonus ponderosae
gb|KIK40166.1|  hypothetical protein CY34DRAFT_807469                   144   2e-37    Suillus luteus UH-Slu-Lm8-n1
gb|ENN73317.1|  hypothetical protein YQE_10080                          144   2e-37    Dendroctonus ponderosae
ref|XP_005055217.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    Ficedula albicollis
ref|XP_006015174.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    
ref|XP_002020665.1|  GL15043                                            144   2e-37    
ref|XP_006883001.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004844017.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    Heterocephalus glaber [naked mole rat]
ref|XP_010580545.1|  PREDICTED: general transcription factor IIH ...    144   2e-37    Haliaeetus leucocephalus
ref|XP_007872653.1|  hypothetical protein PNEG_00752                    144   2e-37    Pneumocystis murina B123
ref|XP_003703450.1|  PREDICTED: general transcription factor IIH ...    143   2e-37    Megachile rotundata
ref|XP_010366703.1|  PREDICTED: general transcription factor IIH ...    142   3e-37    
ref|XP_002087508.1|  GE15755                                            143   3e-37    Drosophila yakuba
gb|EPS97727.1|  hypothetical protein FOMPIDRAFT_147470                  144   3e-37    Fomitopsis pinicola FP-58527 SS1
gb|KFV01969.1|  General transcription factor IIH subunit 3              143   3e-37    Tauraco erythrolophus
ref|XP_001961833.1|  GF14734                                            143   3e-37    
gb|KFP60150.1|  General transcription factor IIH subunit 3              143   3e-37    Cariama cristata
gb|EFZ18109.1|  hypothetical protein SINV_08150                         144   3e-37    
gb|KIY74425.1|  Tfb4-domain-containing protein                          144   3e-37    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_010122015.1|  PREDICTED: general transcription factor IIH ...    144   3e-37    Chlamydotis macqueenii
gb|KDR75209.1|  hypothetical protein GALMADRAFT_249181                  144   3e-37    Galerina marginata CBS 339.88
ref|XP_010366702.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    
ref|XP_006091016.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    
ref|XP_004324975.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|KIK67218.1|  hypothetical protein GYMLUDRAFT_37291                   144   3e-37    Gymnopus luxurians FD-317 M1
ref|NP_608574.2|  TFB4 ortholog                                         143   3e-37    Drosophila melanogaster
gb|AEE63109.1|  unknown                                                 143   3e-37    Dendroctonus ponderosae
ref|XP_004276707.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    Orcinus orca [Orca]
ref|XP_007125217.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    
ref|XP_011224857.1|  PREDICTED: general transcription factor IIH ...    143   3e-37    
gb|KFO13197.1|  General transcription factor IIH subunit 3              143   3e-37    Balearica regulorum gibbericeps
ref|XP_002913183.1|  PREDICTED: general transcription factor IIH ...    143   4e-37    Ailuropoda melanoleuca
ref|XP_005886346.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Myotis brandtii
ref|XP_007936307.1|  PREDICTED: general transcription factor IIH ...    143   4e-37    Orycteropus afer afer
ref|XP_006149292.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Tupaia chinensis
gb|EFB19395.1|  hypothetical protein PANDA_000941                       142   4e-37    Ailuropoda melanoleuca
ref|XP_009960746.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Tyto alba [Schleiereule]
ref|XP_004882330.1|  PREDICTED: general transcription factor IIH ...    143   4e-37    
ref|XP_005691410.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    
ref|XP_009569581.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Cuculus canorus
ref|XP_003314057.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Pan troglodytes
ref|XP_005217860.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Bos taurus [bovine]
ref|XP_004753156.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Mustela putorius furo [black ferret]
ref|XP_008548256.1|  PREDICTED: general transcription factor IIH ...    142   4e-37    Microplitis demolitor
ref|XP_006894691.1|  PREDICTED: general transcription factor IIH ...    143   4e-37    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ELR49840.1|  General transcription factor IIH subunit 3              143   4e-37    Bos mutus
ref|NP_001258796.1|  general transcription factor IIH subunit 3 i...    142   5e-37    Homo sapiens [man]
ref|XP_009246658.1|  PREDICTED: general transcription factor IIH ...    142   5e-37    
ref|XP_008962733.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    Pan paniscus [bonobo]
emb|CAA82909.1|  basic transcription factor 2, 35 kD subunit            143   5e-37    
ref|XP_008837507.1|  PREDICTED: general transcription factor IIH ...    142   5e-37    
ref|XP_006209539.1|  PREDICTED: LOW QUALITY PROTEIN: general tran...    143   5e-37    
ref|XP_006106318.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
ref|XP_005691408.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
ref|XP_001170519.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
ref|NP_001507.2|  general transcription factor IIH subunit 3 isof...    143   5e-37    
ref|XP_007905981.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
ref|NP_001073057.1|  general transcription factor IIH subunit 3         143   5e-37    
gb|AAH39726.1|  GTF2H3 protein                                          142   5e-37    
gb|KIJ23291.1|  hypothetical protein M422DRAFT_62431                    143   5e-37    
ref|XP_004753155.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
gb|KGL82408.1|  General transcription factor IIH subunit 3              142   5e-37    
ref|XP_004089523.1|  PREDICTED: general transcription factor IIH ...    142   5e-37    
ref|XP_005491561.1|  PREDICTED: general transcription factor IIH ...    143   5e-37    
ref|XP_005491560.1|  PREDICTED: general transcription factor IIH ...    143   6e-37    
ref|XP_003907393.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_004430121.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_003907392.1|  PREDICTED: general transcription factor IIH ...    143   6e-37    
ref|XP_003276282.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_002120803.1|  PREDICTED: general transcription factor IIH ...    143   6e-37    
ref|XP_004395978.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
gb|ABZ92424.1|  general transcription factor IIH, polypeptide 3, ...    142   6e-37    
ref|XP_005955361.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_010968027.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_005329606.1|  PREDICTED: general transcription factor IIH ...    142   6e-37    
ref|XP_008837506.1|  PREDICTED: general transcription factor IIH ...    142   7e-37    
ref|XP_003796077.1|  PREDICTED: general transcription factor IIH ...    142   7e-37    
gb|EHH21308.1|  hypothetical protein EGK_04329                          142   7e-37    
ref|XP_004459321.1|  PREDICTED: general transcription factor IIH ...    141   7e-37    
ref|XP_004430120.1|  PREDICTED: general transcription factor IIH ...    142   7e-37    
ref|XP_009546973.1|  hypothetical protein HETIRDRAFT_61922              143   7e-37    
ref|XP_005670638.1|  PREDICTED: general transcription factor IIH ...    141   7e-37    
ref|XP_001194121.1|  PREDICTED: general transcription factor IIH ...    144   7e-37    
ref|XP_003420327.1|  PREDICTED: general transcription factor IIH ...    142   8e-37    
ref|XP_004611079.1|  PREDICTED: general transcription factor IIH ...    142   8e-37    
ref|XP_006178270.1|  PREDICTED: general transcription factor IIH ...    142   8e-37    
ref|XP_534644.1|  PREDICTED: general transcription factor IIH sub...    142   8e-37    
gb|KFO83783.1|  General transcription factor IIH subunit 3              142   8e-37    
ref|XP_002723381.1|  PREDICTED: general transcription factor IIH ...    142   8e-37    
ref|XP_011286010.1|  PREDICTED: general transcription factor IIH ...    141   9e-37    
ref|XP_001927574.1|  PREDICTED: general transcription factor IIH ...    142   9e-37    
ref|XP_010598113.1|  PREDICTED: general transcription factor IIH ...    142   9e-37    
ref|XP_007539837.1|  PREDICTED: general transcription factor IIH ...    141   9e-37    
ref|XP_011286009.1|  PREDICTED: general transcription factor IIH ...    142   9e-37    
ref|XP_004385051.1|  PREDICTED: general transcription factor IIH ...    142   9e-37    
ref|XP_005403081.1|  PREDICTED: general transcription factor IIH ...    142   9e-37    
ref|XP_004668551.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
ref|XP_004595405.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
gb|AAL48665.1|  RE13149p                                                142   1e-36    
ref|XP_001498402.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
emb|CEF96615.1|  TFIIH subunit Tfb4/p34                                 142   1e-36    
emb|CAG08435.1|  unnamed protein product                                142   1e-36    
ref|XP_007079592.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
ref|XP_005988993.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
gb|KFQ19242.1|  General transcription factor IIH subunit 3              140   1e-36    
ref|XP_004690880.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
ref|XP_008055530.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
ref|XP_008687020.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
ref|XP_007058424.1|  PREDICTED: LOW QUALITY PROTEIN: general tran...    142   1e-36    
ref|XP_008687019.1|  PREDICTED: general transcription factor IIH ...    142   1e-36    
gb|EHB01484.1|  General transcription factor IIH subunit 3              142   1e-36    
gb|EMC86947.1|  General transcription factor IIH subunit 3              141   1e-36    
gb|KFQ67414.1|  General transcription factor IIH subunit 3              141   2e-36    
ref|NP_852075.1|  general transcription factor IIH subunit 3            141   2e-36    
gb|ELK23655.1|  General transcription factor IIH subunit 3              140   2e-36    
ref|XP_002066792.1|  GK24367                                            141   2e-36    
ref|XP_009003116.1|  PREDICTED: general transcription factor IIH ...    140   2e-36    
ref|XP_007548061.1|  PREDICTED: general transcription factor IIH ...    140   2e-36    
ref|XP_006640301.1|  PREDICTED: general transcription factor IIH ...    140   2e-36    
ref|XP_006970743.1|  PREDICTED: general transcription factor IIH ...    141   2e-36    
ref|XP_009051917.1|  hypothetical protein LOTGIDRAFT_159336             141   2e-36    
ref|XP_002753188.1|  PREDICTED: general transcription factor IIH ...    141   2e-36    
gb|KFZ49609.1|  General transcription factor IIH subunit 3              139   2e-36    
ref|XP_006768812.1|  PREDICTED: general transcription factor IIH ...    140   2e-36    
ref|XP_008292653.1|  PREDICTED: general transcription factor IIH ...    141   2e-36    
gb|KDE03618.1|  hypothetical protein MVLG_05913                         142   3e-36    
gb|EMS20446.1|  transcription initiation factor TFIIH subunit 3         142   3e-36    
ref|XP_005344427.1|  PREDICTED: general transcription factor IIH ...    141   3e-36    
ref|XP_007191325.1|  PREDICTED: general transcription factor IIH ...    141   3e-36    
gb|KII92795.1|  hypothetical protein PLICRDRAFT_37587                   141   3e-36    
ref|NP_001121894.1|  uncharacterized protein LOC100151595               140   3e-36    
gb|EAW98427.1|  general transcription factor IIH, polypeptide 3, ...    140   3e-36    
ref|XP_006772586.1|  PREDICTED: general transcription factor IIH ...    140   3e-36    
gb|KFO59397.1|  General transcription factor IIH subunit 3              140   3e-36    
gb|KDQ27713.1|  hypothetical protein PLEOSDRAFT_1042223                 142   3e-36    
ref|XP_008416766.1|  PREDICTED: general transcription factor IIH ...    140   3e-36    
ref|XP_008214631.1|  PREDICTED: general transcription factor IIH ...    139   4e-36    
gb|KFQ52763.1|  General transcription factor IIH subunit 3              140   4e-36    
gb|KFV77274.1|  General transcription factor IIH subunit 3              140   4e-36    
ref|XP_004072398.1|  PREDICTED: general transcription factor IIH ...    140   5e-36    
ref|XP_005795020.1|  PREDICTED: general transcription factor IIH ...    140   5e-36    
gb|KFR08297.1|  General transcription factor IIH subunit 3              140   6e-36    
gb|EHJ75440.1|  putative transcription factor TFIIH-subunit             139   6e-36    
gb|KFM10703.1|  General transcription factor IIH subunit 3              140   6e-36    
gb|KFW65124.1|  General transcription factor IIH subunit 3              140   6e-36    
gb|KFV90801.1|  General transcription factor IIH subunit 3              140   6e-36    
gb|KFW83247.1|  General transcription factor IIH subunit 3              140   6e-36    
gb|KIL65959.1|  hypothetical protein M378DRAFT_161605                   141   6e-36    
gb|KFQ79915.1|  General transcription factor IIH subunit 3              140   6e-36    
ref|XP_007307766.1|  Tfb4-domain-containing protein                     142   6e-36    
gb|KFW96402.1|  General transcription factor IIH subunit 3              140   7e-36    
ref|NP_001019407.1|  general transcription factor IIH subunit 3         140   7e-36    
ref|XP_005080673.1|  PREDICTED: general transcription factor IIH ...    139   8e-36    
ref|XP_007328321.1|  hypothetical protein AGABI1DRAFT_119282            140   9e-36    
ref|XP_006460814.1|  hypothetical protein AGABI2DRAFT_204058            140   9e-36    
gb|KFQ00692.1|  General transcription factor IIH subunit 3              139   1e-35    
gb|KIJ67969.1|  hypothetical protein HYDPIDRAFT_25422                   140   1e-35    
gb|KFQ91842.1|  General transcription factor IIH subunit 3              139   1e-35    
ref|XP_008214630.1|  PREDICTED: general transcription factor IIH ...    138   1e-35    
ref|XP_003507864.1|  PREDICTED: general transcription factor IIH ...    139   1e-35    
ref|NP_001002564.1|  general transcription factor IIH subunit 3         139   1e-35    
ref|XP_001603853.2|  PREDICTED: general transcription factor IIH ...    139   1e-35    
gb|EGW04848.1|  General transcription factor IIH subunit 3              139   1e-35    
ref|XP_007646595.1|  PREDICTED: general transcription factor IIH ...    139   1e-35    
ref|XP_003974931.1|  PREDICTED: general transcription factor IIH ...    139   1e-35    
ref|XP_007397183.1|  hypothetical protein PHACADRAFT_258371             140   1e-35    
ref|XP_010730807.1|  PREDICTED: general transcription factor IIH ...    139   2e-35    
gb|KFV39142.1|  General transcription factor IIH subunit 3              138   2e-35    
gb|KFP19531.1|  General transcription factor IIH subunit 3              139   2e-35    
ref|XP_005722146.1|  PREDICTED: general transcription factor IIH ...    139   2e-35    
ref|XP_002175478.1|  transcription factor TFIIH complex subunit Tfb4    138   2e-35    
ref|XP_002159513.2|  PREDICTED: general transcription factor IIH ...    138   2e-35    
ref|XP_003451739.1|  PREDICTED: general transcription factor IIH ...    138   3e-35    
ref|XP_975136.3|  PREDICTED: general transcription factor IIH sub...    136   3e-35    
gb|EOB03711.1|  General transcription factor IIH subunit 3              138   3e-35    
ref|XP_007238324.1|  PREDICTED: general transcription factor IIH ...    138   3e-35    
gb|EFA09618.1|  hypothetical protein TcasGA2_TC011739                   136   3e-35    
gb|EMD37890.1|  hypothetical protein CERSUDRAFT_136815                  138   4e-35    
ref|XP_009180240.1|  PREDICTED: general transcription factor IIH ...    137   4e-35    
ref|XP_007361953.1|  transcription factor Tfb4                          138   4e-35    
gb|KFP36706.1|  General transcription factor IIH subunit 3              137   4e-35    
gb|KGL89386.1|  General transcription factor IIH subunit 3              137   4e-35    
gb|KIM91931.1|  hypothetical protein PILCRDRAFT_101                     138   4e-35    
ref|XP_004544741.1|  PREDICTED: general transcription factor IIH ...    137   5e-35    
gb|KIP01601.1|  hypothetical protein PHLGIDRAFT_96856                   139   5e-35    
gb|KFV41284.1|  General transcription factor IIH subunit 3              137   5e-35    
gb|AAF25986.1|AC013354_5  F15H18.15                                     141   5e-35    
ref|XP_006789771.1|  PREDICTED: general transcription factor IIH ...    137   5e-35    
gb|KFO95753.1|  General transcription factor IIH subunit 3              137   5e-35    
gb|KFP27765.1|  General transcription factor IIH subunit 3              137   6e-35    
ref|XP_009268162.1|  General transcription factor IIH subunit 3         136   6e-35    
ref|XP_009920936.1|  PREDICTED: general transcription factor IIH ...    136   9e-35    
gb|KDO80686.1|  hypothetical protein CISIN_1g022374mg                   134   9e-35    
ref|XP_008034520.1|  transcription factor Tfb4                          137   1e-34    
ref|XP_004349146.1|  general transcription factor IIH                   138   1e-34    
ref|XP_010598116.1|  PREDICTED: general transcription factor IIH ...    135   1e-34    
ref|XP_010580544.1|  PREDICTED: general transcription factor IIH ...    136   1e-34    
gb|KFV76806.1|  General transcription factor IIH subunit 3              136   1e-34    
gb|KFQ51959.1|  General transcription factor IIH subunit 3              136   2e-34    
ref|XP_010895613.1|  PREDICTED: general transcription factor IIH ...    136   2e-34    
ref|XP_010598114.1|  PREDICTED: general transcription factor IIH ...    136   2e-34    
ref|XP_010598112.1|  PREDICTED: general transcription factor IIH ...    136   2e-34    
gb|KDN42507.1|  transcription factor Tfb4                               138   2e-34    
ref|XP_008161724.1|  PREDICTED: general transcription factor IIH ...    132   2e-34    
gb|KIY44472.1|  Tfb4-domain-containing protein                          137   3e-34    
ref|XP_010366704.1|  PREDICTED: general transcription factor IIH ...    131   3e-34    
ref|XP_007515292.1|  predicted protein                                  136   4e-34    
gb|ELK26416.1|  General transcription factor IIH subunit 3              134   4e-34    
gb|KFU89562.1|  General transcription factor IIH subunit 3              134   4e-34    
gb|KIJ68068.1|  hypothetical protein HYDPIDRAFT_173748                  134   5e-34    
emb|CEI90060.1|  hypothetical protein RMCBS344292_04394                 132   5e-34    
ref|XP_004927249.1|  PREDICTED: general transcription factor IIH ...    134   6e-34    
ref|XP_004089524.1|  PREDICTED: general transcription factor IIH ...    130   6e-34    
ref|XP_010812208.1|  PREDICTED: general transcription factor IIH ...    130   6e-34    
ref|NP_001258797.1|  general transcription factor IIH subunit 3 i...    130   6e-34    
gb|KFO71452.1|  General transcription factor IIH subunit 3              134   7e-34    
ref|XP_006740471.1|  PREDICTED: general transcription factor IIH ...    130   9e-34    
gb|KFP49008.1|  General transcription factor IIH subunit 3              133   9e-34    
ref|XP_007864412.1|  transcription factor Tfb4                          134   9e-34    
ref|XP_008111892.1|  PREDICTED: LOW QUALITY PROTEIN: general tran...    134   1e-33    
emb|CCG81596.1|  RNA polymerase II transcription factor B subunit 4     134   1e-33    
ref|XP_007266555.1|  Tfb4-domain-containing protein                     135   1e-33    
ref|XP_003740668.1|  PREDICTED: general transcription factor IIH ...    134   1e-33    
ref|XP_005612707.1|  PREDICTED: general transcription factor IIH ...    130   1e-33    
emb|CEI89047.1|  hypothetical protein RMCBS344292_03420                 133   1e-33    
ref|XP_008055531.1|  PREDICTED: general transcription factor IIH ...    129   2e-33    
ref|XP_009282204.1|  PREDICTED: general transcription factor IIH ...    132   2e-33    
gb|KFO23512.1|  General transcription factor IIH subunit 3              133   2e-33    
ref|XP_009003119.1|  PREDICTED: general transcription factor IIH ...    129   2e-33    
ref|XP_009907603.1|  PREDICTED: general transcription factor IIH ...    128   2e-33    
gb|KFP75832.1|  General transcription factor IIH subunit 3              133   2e-33    
ref|XP_004844018.1|  PREDICTED: general transcription factor IIH ...    132   3e-33    
ref|XP_002107753.1|  hypothetical protein TRIADDRAFT_51576              132   3e-33    
gb|KIO32241.1|  hypothetical protein M407DRAFT_66889                    133   3e-33    
gb|KFZ47964.1|  General transcription factor IIH subunit 3              132   3e-33    
gb|EAW98428.1|  general transcription factor IIH, polypeptide 3, ...    129   3e-33    
gb|ACO14744.1|  General transcription factor IIH subunit 3              132   6e-33    
emb|CDQ66202.1|  unnamed protein product                                132   7e-33    
ref|XP_005691409.1|  PREDICTED: general transcription factor IIH ...    131   8e-33    
emb|CCA72023.1|  related to TFIIH basal transcription factor comp...    132   1e-32    
ref|XP_008334025.1|  PREDICTED: general transcription factor IIH ...    130   2e-32    
ref|XP_007526202.1|  PREDICTED: general transcription factor IIH ...    131   2e-32    
ref|XP_011505028.1|  PREDICTED: general transcription factor IIH ...    130   2e-32    
ref|XP_007339097.1|  transcription factor Tfb4                          131   3e-32    
ref|XP_008516742.1|  PREDICTED: general transcription factor IIH ...    130   3e-32    
ref|XP_006957397.1|  transcription factor Tfb4                          129   3e-32    
ref|XP_008334024.1|  PREDICTED: general transcription factor IIH ...    130   4e-32    
gb|EFX81722.1|  hypothetical protein DAPPUDRAFT_224195                  129   4e-32    
ref|XP_004798459.1|  PREDICTED: general transcription factor IIH ...    130   4e-32    
gb|KFM79973.1|  General transcription factor IIH subunit 3              125   5e-32    
ref|XP_003835830.1|  similar to RNA polymerase II transcription f...    131   5e-32    
ref|XP_007702774.1|  hypothetical protein COCSADRAFT_173760             130   5e-32    
ref|XP_002840396.1|  hypothetical protein                               130   6e-32    
ref|XP_005595269.1|  PREDICTED: general transcription factor IIH ...    125   6e-32    
ref|NP_595532.1|  transcription factor TFIIH complex subunit Tfb4       129   7e-32    
gb|EMD91710.1|  hypothetical protein COCHEDRAFT_1136566                 130   7e-32    
dbj|BAA21460.1|  basic transcription factor 2.35KD subunit              129   7e-32    
gb|EUN25060.1|  hypothetical protein COCVIDRAFT_28342                   130   7e-32    
ref|XP_005145237.1|  PREDICTED: general transcription factor IIH ...    128   7e-32    
ref|XP_007683288.1|  hypothetical protein COCMIDRAFT_32502              130   8e-32    
ref|XP_007708072.1|  hypothetical protein COCCADRAFT_33192              130   8e-32    
ref|XP_008249856.1|  PREDICTED: general transcription factor IIH ...    129   8e-32    
gb|KIM30388.1|  hypothetical protein M408DRAFT_21905                    131   9e-32    
ref|XP_005000492.1|  PREDICTED: general transcription factor IIH ...    129   1e-31    
gb|KDQ57833.1|  hypothetical protein JAAARDRAFT_130607                  130   1e-31    
ref|XP_008155448.1|  PREDICTED: general transcription factor IIH ...    128   1e-31    
ref|XP_011124210.1|  hypothetical protein AOL_s00097g75                 129   1e-31    
ref|XP_005703870.1|  transcription initiation factor TFIIH subuni...    129   2e-31    
ref|XP_011402837.1|  PREDICTED: general transcription factor IIH ...    127   2e-31    
gb|KGO35916.1|  Transcription factor Tfb4                               129   2e-31    



>ref|XP_009626298.1| PREDICTED: general transcription factor IIH subunit 3 [Nicotiana 
tomentosiformis]
Length=288

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFR+GPLHPQPRILCLHGSPDGPGQYVA+MN+IFSAQRSMVPIDSC 
Sbjct  115  SGSLSMALCYIQRVFRTGPLHPQPRILCLHGSPDGPGQYVAVMNAIFSAQRSMVPIDSCV  174

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+QHSAFLQQASYIT GVYLKPQ+ DGLFQYLSTVFATDLHSRAFL LPRPVGVDFRAS
Sbjct  175  IGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRAFLQLPRPVGVDFRAS  234

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKRHW  200
            CFCHKNTIDMGYICSVCLSIFCKH  +CSTCGS FG+AR Q+P+A    +   W
Sbjct  235  CFCHKNTIDMGYICSVCLSIFCKHHKKCSTCGSNFGEARKQDPSASDQKRNPRW  288



>ref|XP_009776618.1| PREDICTED: general transcription factor IIH subunit 3 [Nicotiana 
sylvestris]
Length=291

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFR+GPLHPQPRILCLHGSPDGPGQYVA+MN+IFSAQRSMVPIDSC 
Sbjct  116  SGSLSMALCYIQRVFRTGPLHPQPRILCLHGSPDGPGQYVAVMNAIFSAQRSMVPIDSCV  175

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+QHSAFLQQASYIT GVYLKPQ+ DGLFQYLSTVFATDLHSRAFL LPRPVGVDFRAS
Sbjct  176  IGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRAFLQLPRPVGVDFRAS  235

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKK  209
            CFCHKNTIDMGYICSVCLSIFCKH  +CSTCGS FG+AR Q+P+A    +K
Sbjct  236  CFCHKNTIDMGYICSVCLSIFCKHHKKCSTCGSNFGEARKQDPSASGQRRK  286



>ref|XP_006347459.1| PREDICTED: general transcription factor IIH subunit 3-like [Solanum 
tuberosum]
Length=290

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVA+MNSIFSAQRSMVPIDSC 
Sbjct  116  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAVMNSIFSAQRSMVPIDSCV  175

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+QHSAFLQQASYIT GVYLKPQ+ DGLFQYLSTVFATDLHSR+FL LPRPVGVDFRAS
Sbjct  176  IGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRSFLQLPRPVGVDFRAS  235

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAA  227
            CFCHKNTIDMG+ICSVCLSIFCKH  +CSTCGS FG+AR Q+P+A
Sbjct  236  CFCHKNTIDMGFICSVCLSIFCKHHKKCSTCGSNFGEARKQDPSA  280



>ref|XP_004241513.1| PREDICTED: general transcription factor IIH subunit 3 [Solanum 
lycopersicum]
Length=290

 Score =   315 bits (807),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVA+MNSIFSAQRSMVPIDSC 
Sbjct  116  SGALSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAVMNSIFSAQRSMVPIDSCV  175

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+QHSAFLQQASYIT GVYLKPQ+ DGLFQYLSTVFATDLHSR+FL LPRPVGVDFRAS
Sbjct  176  IGSQHSAFLQQASYITGGVYLKPQVSDGLFQYLSTVFATDLHSRSFLQLPRPVGVDFRAS  235

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKRHW  200
            CFCHKNTIDMG+ICSVCLSIFCKH  +CSTCGS FG+AR Q+P+A  D ++  +
Sbjct  236  CFCHKNTIDMGFICSVCLSIFCKHHKKCSTCGSNFGEARKQDPSAS-DQRRTSY  288



>ref|XP_011101336.1| PREDICTED: general transcription factor IIH subunit 3 [Sesamum 
indicum]
 ref|XP_011101337.1| PREDICTED: general transcription factor IIH subunit 3 [Sesamum 
indicum]
Length=292

 Score =   315 bits (806),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSGPLHP PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC 
Sbjct  117  SGSLSMALCYIQRVFRSGPLHPHPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCV  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IGAQHSAFLQQASYIT GVYLKPQ+LDGLFQYLSTVFATDLHSR FL LP+P GVDFRAS
Sbjct  177  IGAQHSAFLQQASYITGGVYLKPQLLDGLFQYLSTVFATDLHSRGFLQLPKPAGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSIFCKHQ +CSTCGSVFG+A  Q+ + P D K++
Sbjct  237  CFCHKNTIDMGYICSVCLSIFCKHQKKCSTCGSVFGQAPVQDSSTP-DRKRK  287



>gb|EYU17663.1| hypothetical protein MIMGU_mgv1a011002mg [Erythranthe guttata]
Length=295

 Score =   315 bits (806),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSGPLHP PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPID+C 
Sbjct  117  SGSLSMALCYIQRVFRSGPLHPHPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDACV  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG QHSAFLQQASYIT GVYLKPQ+LDGLFQYLSTVFATDLHSRAFL LP+P GVDFRAS
Sbjct  177  IGTQHSAFLQQASYITGGVYLKPQLLDGLFQYLSTVFATDLHSRAFLQLPKPAGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP  224
            CFCHKNTIDMGYICSVCLSIFCKHQ +CSTCGSVFG+A+ Q+ + P
Sbjct  237  CFCHKNTIDMGYICSVCLSIFCKHQKKCSTCGSVFGQAQAQDSSTP  282



>emb|CDP12389.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   302 bits (774),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC +G QH
Sbjct  124  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCVVGIQH  183

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ LDGLFQYL+TVFATDLHSR FL LP+PVGVDFRASCFCHK
Sbjct  184  SAFLQQASYITGGVYLKPQQLDGLFQYLATVFATDLHSRNFLRLPKPVGVDFRASCFCHK  243

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAA  227
            NTIDMG+ICSVCLSIFCKHQ +CSTCGS FG+A+  +P+A
Sbjct  244  NTIDMGFICSVCLSIFCKHQKKCSTCGSTFGQAKTHDPSA  283



>emb|CBI19033.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFR+GPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC IGAQH
Sbjct  128  MALCYIQRVFRTGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGAQH  187

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ LDGLFQYLSTVFATDLHSR FL LP+P GVDFRASCFCHK
Sbjct  188  SAFLQQASYITGGVYLKPQQLDGLFQYLSTVFATDLHSRRFLQLPKPAGVDFRASCFCHK  247

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+    +A  D K++
Sbjct  248  NTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQSDGNSAT-DRKRK  293



>ref|XP_002284465.2| PREDICTED: general transcription factor IIH subunit 3 [Vitis 
vinifera]
Length=303

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFR+GPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC IGAQH
Sbjct  134  MALCYIQRVFRTGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGAQH  193

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ LDGLFQYLSTVFATDLHSR FL LP+P GVDFRASCFCHK
Sbjct  194  SAFLQQASYITGGVYLKPQQLDGLFQYLSTVFATDLHSRRFLQLPKPAGVDFRASCFCHK  253

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+    +A  D K++
Sbjct  254  NTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQSDGNSAT-DRKRK  299



>gb|KDO80687.1| hypothetical protein CISIN_1g022374mg [Citrus sinensis]
Length=213

 Score =   287 bits (734),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC 
Sbjct  37   SGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCY  96

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PVGVDFRAS
Sbjct  97   LGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRAS  156

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q       ++KR
Sbjct  157  CFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKR  208



>ref|XP_010675078.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=278

 Score =   289 bits (740),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCLHGSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QH
Sbjct  110  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGGQH  169

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ L+GLFQYLSTVFATDLHSR F+ LP+PVGVDFRASCFCHK
Sbjct  170  SAFLQQASYITGGVYLKPQQLEGLFQYLSTVFATDLHSRNFIQLPKPVGVDFRASCFCHK  229

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFC H  +CSTCGS++G+A+    +     +K 
Sbjct  230  NTIDMGYICSVCLSIFCMHHKKCSTCGSLYGRAQSDASSTSGQKRKE  276



>gb|KDO80684.1| hypothetical protein CISIN_1g022374mg [Citrus sinensis]
Length=298

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCY  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PVGVDFRAS
Sbjct  182  LGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQ--EPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q  EP+A   ++KR
Sbjct  242  CFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSAT--NRKR  293



>ref|XP_006472762.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X1 [Citrus sinensis]
Length=298

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGLLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCY  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PVGVDFRAS
Sbjct  182  LGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQ--EPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q  EP+A   ++KR
Sbjct  242  CFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSAT--NRKR  293



>ref|XP_010675067.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=306

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCLHGSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QH
Sbjct  138  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGGQH  197

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ L+GLFQYLSTVFATDLHSR F+ LP+PVGVDFRASCFCHK
Sbjct  198  SAFLQQASYITGGVYLKPQQLEGLFQYLSTVFATDLHSRNFIQLPKPVGVDFRASCFCHK  257

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFC H  +CSTCGS++G+A+    +     +K 
Sbjct  258  NTIDMGYICSVCLSIFCMHHKKCSTCGSLYGRAQSDASSTSGQKRKE  304



>gb|KJB59107.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
 gb|KJB59108.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
 gb|KJB59109.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
 gb|KJB59111.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
 gb|KJB59112.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
Length=211

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHP PRILCL GS DGP QYVAIMN+IFSAQRS VPIDSC 
Sbjct  37   SGSLSMALCYIQRVFRSGALHPHPRILCLQGSLDGPEQYVAIMNAIFSAQRSSVPIDSCY  96

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+Q+SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+F+HLP+PVGVDFRAS
Sbjct  97   IGSQNSAFLQQASYITGGVHHKPQNLDGLFQYLMTIFATDLHSRSFIHLPKPVGVDFRAS  156

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+  E A+  D K++
Sbjct  157  CFCHKNTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQS-EAASASDKKRK  207



>gb|KJB59104.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
 gb|KJB59105.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
Length=296

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHP PRILCL GS DGP QYVAIMN+IFSAQRS VPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGALHPHPRILCLQGSLDGPEQYVAIMNAIFSAQRSSVPIDSCY  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+Q+SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+F+HLP+PVGVDFRAS
Sbjct  182  IGSQNSAFLQQASYITGGVHHKPQNLDGLFQYLMTIFATDLHSRSFIHLPKPVGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+  E A+  D K++
Sbjct  242  CFCHKNTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQS-EAASASDKKRK  292



>ref|XP_007019036.1| Basal transcription factor complex subunit-related isoform 1 
[Theobroma cacao]
 gb|EOY16261.1| Basal transcription factor complex subunit-related isoform 1 
[Theobroma cacao]
Length=296

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHP PRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC +GAQ+
Sbjct  127  MALCYIQRVFRSGALHPHPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYMGAQN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+FLHLP+PVGVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVHHKPQHLDGLFQYLMTIFATDLHSRSFLHLPKPVGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+  E A+  D K++
Sbjct  247  NTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQS-EAASTSDKKRK  292



>ref|XP_010999370.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Populus euphratica]
 ref|XP_010999371.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Populus euphratica]
Length=298

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC +GA +
Sbjct  129  MALCYIQRVFRSGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCYVGAHN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL+TVFATDLHSR+F+ LPRP GVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGVYVKPQHLDGLFQYLTTVFATDLHSRSFIQLPRPAGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFC H  +CSTCGSVFG+A+    +   D K++
Sbjct  249  TTIDMGYICSVCLSIFCNHHKKCSTCGSVFGQAQSDTSSTS-DLKRK  294



>ref|NP_564050.1| basal transcription factor complex subunit-related protein [Arabidopsis 
thaliana]
 gb|AAM61618.1| unknown [Arabidopsis thaliana]
 gb|ABE77412.1| At1g18340 [Arabidopsis thaliana]
 gb|AEE29705.1| basal transcription factor complex subunit-related protein [Arabidopsis 
thaliana]
Length=301

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  + ++  D K++
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDDASSASDKKRK  297



>ref|XP_002892997.1| hypothetical protein ARALYDRAFT_472054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69256.1| hypothetical protein ARALYDRAFT_472054 [Arabidopsis lyrata subsp. 
lyrata]
Length=301

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR+F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRSFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  + ++  D K++
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDDASSVSDKKRK  297



>ref|XP_010498221.1| PREDICTED: general transcription factor IIH subunit 3-like [Camelina 
sativa]
Length=301

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  E ++  D K++
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDEASSVSDKKRK  297



>ref|XP_002307429.2| basal transcription factor complex subunit-related family protein 
[Populus trichocarpa]
 gb|EEE94425.2| basal transcription factor complex subunit-related family protein 
[Populus trichocarpa]
Length=298

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC +GA +
Sbjct  129  MALCYIQRVFRSGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCYVGAHN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL+TVFATDLHSR+F+ LPRP GVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGVYVKPQHLDGLFQYLTTVFATDLHSRSFIQLPRPAGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFC H  +CSTCGSVFG+A+    +   D K++
Sbjct  249  TTIDMGYICSVCLSIFCNHHKKCSTCGSVFGQAQSDTSSTS-DLKRK  294



>ref|XP_010459446.1| PREDICTED: general transcription factor IIH subunit 3-like [Camelina 
sativa]
Length=301

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  E ++  D K++
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDEASSVSDKKRK  297



>ref|XP_010477011.1| PREDICTED: general transcription factor IIH subunit 3-like [Camelina 
sativa]
Length=301

 Score =   282 bits (722),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG +HPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHIHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  E ++  D K++
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDEASSVSDKKRK  297



>gb|KDP32789.1| hypothetical protein JCGZ_12081 [Jatropha curcas]
Length=296

 Score =   279 bits (714),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPL+PQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC +G+ +
Sbjct  127  MALCYIQRVFRSGPLNPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCYVGSHN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL TVFATDLH R+FL LPRP GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYVKPQHLDGLFQYLVTVFATDLHCRSFLQLPRPAGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFCK   +CSTCGSVFG+++    +A  D K++
Sbjct  247  TTIDMGYICSVCLSIFCKQHKKCSTCGSVFGQSQSDNSSAS-DRKRK  292



>ref|XP_010273663.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Nelumbo nucifera]
Length=303

 Score =   279 bits (714),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQ+VFRSGPLHPQPRILCL GS DGP QYVAIMN+IFSAQRSMVPID+C IGAQHSAF
Sbjct  137  CYIQKVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDACVIGAQHSAF  196

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKP  LDGLFQYLSTVF+TDL SR+FL LP+PVGVDFRASCFCHK TI
Sbjct  197  LQQASYITGGVYLKPPQLDGLFQYLSTVFSTDLQSRSFLQLPKPVGVDFRASCFCHKKTI  256

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGYICSVCLSIFCKH  +CSTCGSVFG+A         D K++
Sbjct  257  DMGYICSVCLSIFCKHHKKCSTCGSVFGQAHSSATTTS-DRKRK  299



>ref|XP_006305456.1| hypothetical protein CARUB_v10009867mg [Capsella rubella]
 gb|EOA38354.1| hypothetical protein CARUB_v10009867mg [Capsella rubella]
Length=301

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC 
Sbjct  126  SGSLSMALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCY  185

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG Q+SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+P+GVDFRAS
Sbjct  186  IGVQNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRAS  245

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQE  236
            CFCHK TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  E
Sbjct  246  CFCHKKTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDE  287



>ref|XP_008219657.1| PREDICTED: general transcription factor IIH subunit 3 [Prunus 
mume]
Length=296

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 146/167 (87%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GS DGP QYVAIMN+IFSAQRSMVPIDSC +G+ +
Sbjct  127  MALCYIQRVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDSCYMGSSN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  +GLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYLKPQQPNGLFQYLSTVFATDLHSRAFLQLPKSLGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+    +    +KKR
Sbjct  247  KTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQSDVNST--SNKKR  291



>ref|XP_008391898.1| PREDICTED: general transcription factor IIH subunit 3 [Malus 
domestica]
 ref|XP_008391899.1| PREDICTED: general transcription factor IIH subunit 3 [Malus 
domestica]
Length=297

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GS DGP QYVAIMNSIFSAQRSMVPIDSC +G+ +
Sbjct  128  MALCYIQRVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNSIFSAQRSMVPIDSCYMGSSN  187

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  +GLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  188  SAFLQQASYITGGVYLKPQQPNGLFQYLSTVFATDLHSRAFLQLPKSLGVDFRASCFCHK  247

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFCKH  +CSTCGSVFG+A  Q  A+   ++KR
Sbjct  248  KTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQA--QLDASSTSNRKR  292



>ref|XP_009363173.1| PREDICTED: general transcription factor IIH subunit 3 [Pyrus 
x bretschneideri]
 ref|XP_009363174.1| PREDICTED: general transcription factor IIH subunit 3 [Pyrus 
x bretschneideri]
 ref|XP_009363175.1| PREDICTED: general transcription factor IIH subunit 3 [Pyrus 
x bretschneideri]
Length=297

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 147/167 (88%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GS DGP QYVAIMNSIFSAQRSMVPIDSC +G+ +
Sbjct  128  MALCYIQRVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNSIFSAQRSMVPIDSCYMGSSN  187

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  +GLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  188  SAFLQQASYITGGVYLKPQQPNGLFQYLSTVFATDLHSRAFLQLPKSLGVDFRASCFCHK  247

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFCKH  +CSTCGSVFG+A  Q  A+   ++KR
Sbjct  248  KTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQA--QLDASSTSNRKR  292



>ref|XP_004152842.1| PREDICTED: general transcription factor IIH subunit 3-like [Cucumis 
sativus]
 gb|KGN61231.1| hypothetical protein Csa_2G072450 [Cucumis sativus]
Length=295

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQ+VFRSG LHPQPRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC IG+ +
Sbjct  127  MALCYIQKVFRSGSLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYIGSHN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ +DGLFQYLSTVF TDLHSR FL LP+ VGVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYLKPQQMDGLFQYLSTVFGTDLHSRTFLQLPKSVGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
             TIDMGY+CSVCLSIFCKH  +CSTCGSVFG+ 
Sbjct  247  KTIDMGYVCSVCLSIFCKHHKKCSTCGSVFGET  279



>gb|KDO80685.1| hypothetical protein CISIN_1g022374mg [Citrus sinensis]
Length=293

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 151/174 (87%), Gaps = 9/174 (5%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPR     GSPDGP QYVAIMN+IFSAQRSMVPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGLLHPQPR-----GSPDGPEQYVAIMNAIFSAQRSMVPIDSCY  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PVGVDFRAS
Sbjct  177  LGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQ--EPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q  EP+A   ++KR
Sbjct  237  CFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSAT--NRKR  288



>ref|XP_006472763.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X2 [Citrus sinensis]
Length=293

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 151/174 (87%), Gaps = 9/174 (5%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHPQPR     GSPDGP QYVAIMN+IFSAQRSMVPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGLLHPQPR-----GSPDGPEQYVAIMNAIFSAQRSMVPIDSCY  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PVGVDFRAS
Sbjct  177  LGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPVGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQ--EPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q  EP+A   ++KR
Sbjct  237  CFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSAT--NRKR  288



>ref|NP_001131186.1| hypothetical protein [Zea mays]
 gb|ACF78234.1| unknown [Zea mays]
 gb|ACF79492.1| unknown [Zea mays]
 gb|ACN33344.1| unknown [Zea mays]
 gb|AFW66646.1| hypothetical protein ZEAMMB73_940692 [Zea mays]
Length=291

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LS++LCYIQR+FRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC 
Sbjct  122  SGALSISLCYIQRIFRSGSRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +G Q SAFLQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSRAFL LP+ +GVDFRAS
Sbjct  182  VGTQDSAFLQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRAFLRLPKTLGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            CFCHK TIDMGY+CS+CLSIFCK+Q +CSTCGS F +A
Sbjct  242  CFCHKKTIDMGYVCSICLSIFCKNQKKCSTCGSEFSRA  279



>ref|XP_010065813.1| PREDICTED: general transcription factor IIH subunit 3 [Eucalyptus 
grandis]
 gb|KCW63477.1| hypothetical protein EUGRSUZ_G01112 [Eucalyptus grandis]
 gb|KCW63478.1| hypothetical protein EUGRSUZ_G01112 [Eucalyptus grandis]
 gb|KCW63479.1| hypothetical protein EUGRSUZ_G01112 [Eucalyptus grandis]
Length=296

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSGP HP PRILCLHGS DGP QYVAIMN+IFSAQRSMVPIDSC IGAQ+SAF
Sbjct  130  CYIQRVFRSGPRHPHPRILCLHGSQDGPEQYVAIMNAIFSAQRSMVPIDSCFIGAQNSAF  189

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ+L+G FQYLSTVF TDLHSR FL LP+ VGVDFRASCFCHK TI
Sbjct  190  LQQASYITGGVYLKPQLLEGTFQYLSTVFGTDLHSRGFLQLPKSVGVDFRASCFCHKKTI  249

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGYICSVCLSIFCKH  +CSTCGSVFG+   +  + P  +KKR
Sbjct  250  DMGYICSVCLSIFCKHHKKCSTCGSVFGQPHSEAASEP--NKKR  291



>ref|XP_010530197.1| PREDICTED: general transcription factor IIH subunit 3 [Tarenaya 
hassleriana]
Length=298

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG +HPQPRILCL GSPDGP QYVA+MN+IFSAQRS +PIDSC IG Q+
Sbjct  127  MALCYIQRVFRSGHIHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSAIPIDSCYIGTQN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+ KPQ LDGLFQYL+++FA+DLHSR F+ LP+P GVDF ASCFCHK
Sbjct  187  SAFLQQASYITGGVHHKPQQLDGLFQYLTSIFASDLHSRGFIQLPKPAGVDFLASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            NTIDMGYICSVCLSIFCKH  +CSTCGSVFG+++  E ++  D K++
Sbjct  247  NTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQSKLDESSSASDKKRK  293



>gb|KJB59110.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
Length=291

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 6/172 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHP PR     GS DGP QYVAIMN+IFSAQRS VPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGALHPHPR-----GSLDGPEQYVAIMNAIFSAQRSSVPIDSCY  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+Q+SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+F+HLP+PVGVDFRAS
Sbjct  177  IGSQNSAFLQQASYITGGVHHKPQNLDGLFQYLMTIFATDLHSRSFIHLPKPVGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHKNTIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+  E A+  D K++
Sbjct  237  CFCHKNTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQS-EAASASDKKRK  287



>gb|ADE77788.1| unknown [Picea sitchensis]
Length=306

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQR+ R GP HPQPRILCL GSPDGP QYVAIMN+IFSAQRSMVP+DSC 
Sbjct  140  SGSLSMALCYIQRIIRGGPSHPQPRILCLQGSPDGPQQYVAIMNAIFSAQRSMVPVDSCI  199

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +G+QHSAFLQQAS+IT G+YLKPQ L+GLFQ+L+ VFATDLHSR FL LPRP GVDFRAS
Sbjct  200  VGSQHSAFLQQASHITGGIYLKPQQLEGLFQFLAMVFATDLHSRRFLQLPRPTGVDFRAS  259

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            CFCHK TIDMGY+CSVCLSIFC+H  +CSTC S F +
Sbjct  260  CFCHKKTIDMGYVCSVCLSIFCEHSKKCSTCESTFNQ  296



>ref|XP_006416613.1| hypothetical protein EUTSA_v10008316mg [Eutrema salsugineum]
 gb|ESQ34966.1| hypothetical protein EUTSA_v10008316mg [Eutrema salsugineum]
Length=300

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  130  MALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  189

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ LDGLFQYL+T+FATDLHSR F+ LP+PVGVDFRASCFCHK
Sbjct  190  SAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPVGVDFRASCFCHK  249

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFC+H  +CSTCGSVFG+++  + ++  + K++
Sbjct  250  KTIDMGYICSVCLSIFCEHHKKCSTCGSVFGQSKLDDVSSVSNKKRK  296



>gb|AES71297.2| general transcription factor IIH subunit, putative [Medicago 
truncatula]
Length=296

 Score =   272 bits (695),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS+VP+DSC 
Sbjct  124  SGALSMALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSVVPVDSCF  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+ +SAFLQQASYIT G+Y +P  ++GLFQYLSTVFATDLHSR FL LP+ +GVDFRAS
Sbjct  184  IGSNNSAFLQQASYITGGIYYRPPQMEGLFQYLSTVFATDLHSREFLRLPKSLGVDFRAS  243

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            CFCHK TIDMGY+CSVCLSIFC+H  +CSTC SVFG+   Q  AA  +++KR
Sbjct  244  CFCHKQTIDMGYVCSVCLSIFCEHHDKCSTCSSVFGQT--QSEAASEENRKR  293



>ref|XP_003573866.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Brachypodium distachyon]
Length=290

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LS+ALCYIQRVFRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC 
Sbjct  122  SGALSLALCYIQRVFRSGTRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +G Q SAFLQQASYIT GVYLKPQ L GLFQYL+ VFA+DLHSRAFL LP+ +GVDFRAS
Sbjct  182  VGTQDSAFLQQASYITGGVYLKPQELSGLFQYLAAVFASDLHSRAFLRLPKTLGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            CFCHK TIDMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  242  CFCHKKTIDMGYVCSVCLSIFCKYHKKCSTCGSEFSR  278



>ref|XP_008441918.1| PREDICTED: LOW QUALITY PROTEIN: general transcription factor 
IIH subunit 3 [Cucumis melo]
Length=295

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQ+VFRSG LHPQPRILCL GSPDGP QYVAIMN+IFSAQRSMV IDSC IG+ +
Sbjct  127  MALCYIQKVFRSGSLHPQPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVSIDSCYIGSHN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ +DGLFQYL+TVF TDLHSR FL LP+ VGVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYLKPQQMDGLFQYLATVFGTDLHSRTFLQLPKSVGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
             TIDMGY+CSVCLSIFCKH  +CSTCGSVFG+ 
Sbjct  247  XTIDMGYVCSVCLSIFCKHHKKCSTCGSVFGET  279



>ref|XP_004290857.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=300

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQ+VFRSGP HP PRILCL GS DGP QYVAIMN+IFSAQRSMVPIDSC +G+ +
Sbjct  127  MALCYIQKVFRSGPQHPHPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDSCYMGSNN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  DGL QYL+TVFATDLHSRAFL LP+  GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYLKPQQPDGLLQYLTTVFATDLHSRAFLQLPKSAGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TID GYICSVCLSIFCKH  +CSTCGSVFG+A+ + P+    +KKR
Sbjct  247  KTIDTGYICSVCLSIFCKHHKKCSTCGSVFGQAQSEVPST--TNKKR  291



>ref|XP_007223251.1| hypothetical protein PRUPE_ppa009386mg [Prunus persica]
 gb|EMJ24450.1| hypothetical protein PRUPE_ppa009386mg [Prunus persica]
Length=295

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GS DGP QYVAIMN+IFSAQRS VPIDSC +G+ +
Sbjct  127  MALCYIQRVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNAIFSAQRS-VPIDSCYMGSSN  185

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  +GLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  186  SAFLQQASYITGGVYLKPQQPNGLFQYLSTVFATDLHSRAFLQLPKSLGVDFRASCFCHK  245

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGYICSVCLSIFCKH  +CSTCGSVFG+A+    +    +KKR
Sbjct  246  KTIDMGYICSVCLSIFCKHHKKCSTCGSVFGQAQSDVNST--SNKKR  290



>ref|XP_004290858.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=298

 Score =   271 bits (694),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 143/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQ+VFRSGP HP PRILCL GS DGP QYVAIMN+IFSAQRSMVPIDSC +G+ +
Sbjct  127  MALCYIQKVFRSGPQHPHPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDSCYMGSNN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  DGL QYL+TVFATDLHSRAFL LP+  GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGVYLKPQQPDGLLQYLTTVFATDLHSRAFLQLPKSAGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TID GYICSVCLSIFCKH  +CSTCGSVFG+A+ + P+    +KKR
Sbjct  247  KTIDTGYICSVCLSIFCKHHKKCSTCGSVFGQAQSEVPST--TNKKR  291



>ref|XP_010999372.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X3 [Populus euphratica]
Length=295

 Score =   271 bits (693),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC +GA +
Sbjct  129  MALCYIQRVFRSGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCYVGAHN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL+TVFATDLHSR+F+ LPRP GVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGVYVKPQHLDGLFQYLTTVFATDLHSRSFIQLPRPAGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGS  263
             TIDMGYICSVCLSIFC H  +CSTCG 
Sbjct  249  TTIDMGYICSVCLSIFCNHHKKCSTCGD  276



>emb|CDY19207.1| BnaC05g14080D [Brassica napus]
Length=300

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  130  MALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  189

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT+GV+  P+ LDGLFQ+L+T+FATDLH+R+F+ LP+PVGVDFRASCFCHK
Sbjct  190  SAFLQQASYITSGVHHAPKQLDGLFQFLTTIFATDLHTRSFVQLPKPVGVDFRASCFCHK  249

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+++  + A+    KKR
Sbjct  250  KTIDMGYVCSVCLSIFCEHHKKCSTCGSVFGQSK-LDGASTVSEKKR  295



>emb|CDY26168.1| BnaA06g12490D [Brassica napus]
Length=300

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  130  MALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  189

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ LDGLFQ+L+T+FATDLH+R+F+ LP+PVGVDFRASCFCHK
Sbjct  190  SAFLQQASYITGGVHHAPKQLDGLFQFLTTIFATDLHTRSFVQLPKPVGVDFRASCFCHK  249

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+++    +   D K++
Sbjct  250  KTIDMGYVCSVCLSIFCEHHKKCSTCGSVFGQSKLDGASTVSDKKRK  296



>ref|XP_009149277.1| PREDICTED: general transcription factor IIH subunit 3-like [Brassica 
rapa]
Length=300

 Score =   270 bits (690),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR+FRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  130  MALCYIQRIFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  189

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ LDGLFQ+L+T+FATDLH+R+F+ LP+PVGVDFRASCFCHK
Sbjct  190  SAFLQQASYITGGVHHAPKQLDGLFQFLTTIFATDLHTRSFVQLPKPVGVDFRASCFCHK  249

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+++    +   D K++
Sbjct  250  KTIDMGYVCSVCLSIFCEHHKKCSTCGSVFGQSKLDGASTVSDKKRK  296



>ref|XP_010999369.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Populus euphratica]
Length=411

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC +GA +
Sbjct  129  MALCYIQRVFRSGPLHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCYVGAHN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL+TVFATDLHSR+F+ LPRP GVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGVYVKPQHLDGLFQYLTTVFATDLHSRSFIQLPRPAGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGS  263
             TIDMGYICSVCLSIFC H  +CSTCG 
Sbjct  249  TTIDMGYICSVCLSIFCNHHKKCSTCGD  276



>ref|XP_004500559.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X2 [Cicer arietinum]
Length=294

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS VP+DSC IG+ +
Sbjct  127  MALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSSVPVDSCYIGSNN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y +P  +DGLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGIYYRPPQMDGLFQYLSTVFATDLHSRAFLRLPKSLGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTC SVFG+A+    +A  D++KR
Sbjct  247  QTIDMGYVCSVCLSIFCEHHDKCSTCSSVFGQAQSNVASA--DNRKR  291



>dbj|BAK06937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LS+ALCYIQR+FRSG  HPQPRILC+ GSPDGP QYVA+MNSIFSAQRSMVPID+C 
Sbjct  122  SGALSLALCYIQRIFRSGSRHPQPRILCVQGSPDGPEQYVAVMNSIFSAQRSMVPIDTCI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +G Q SAFLQQASYIT GVY+KPQ L GLFQYL+ VFATDLHSR FL LP+ +GVDFRAS
Sbjct  182  VGTQDSAFLQQASYITGGVYMKPQELSGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRAS  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            CFCHK TIDMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  242  CFCHKKTIDMGYVCSVCLSIFCKYHKKCSTCGSEFSR  278



>ref|XP_008802071.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X3 [Phoenix dactylifera]
 ref|XP_008802073.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X3 [Phoenix dactylifera]
Length=459

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  703  ALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHS  524
            ALCYIQRVFRSG LHPQPRILCL  SPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHS
Sbjct  140  ALCYIQRVFRSGALHPQPRILCLQASPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHS  199

Query  523  AFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKN  344
            AFLQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK 
Sbjct  200  AFLQQASYITGGVYLKPQQLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKK  259

Query  343  TIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            TIDMGY+CSVCLSIFCKH  +CSTCGS F ++
Sbjct  260  TIDMGYVCSVCLSIFCKHHKKCSTCGSEFNQS  291



>ref|XP_008802068.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802069.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Phoenix dactylifera]
Length=475

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -1

Query  703  ALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHS  524
            ALCYIQRVFRSG LHPQPRILCL  SPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHS
Sbjct  140  ALCYIQRVFRSGALHPQPRILCLQASPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHS  199

Query  523  AFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKN  344
            AFLQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK 
Sbjct  200  AFLQQASYITGGVYLKPQQLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKK  259

Query  343  TIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            TIDMGY+CSVCLSIFCKH  +CSTCGS F ++
Sbjct  260  TIDMGYVCSVCLSIFCKHHKKCSTCGSEFNQS  291



>ref|XP_010916569.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Elaeis guineensis]
Length=305

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHSAF
Sbjct  139  CYIQRVFRSGALHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHSAF  198

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  199  LQQASYITGGVYLKPQHLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  258

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGY+CSVCLSIFCKH  +CSTCGS F ++     A   D K++
Sbjct  259  DMGYVCSVCLSIFCKHHKKCSTCGSEFNQSPPDANATS-DRKRK  301



>ref|XP_010273665.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X3 [Nelumbo nucifera]
Length=284

 Score =   266 bits (679),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQ+VFRSGPLHPQPRILCL GS DGP QYVAIMN+IFSAQRSMVPID+C IGAQHSAF
Sbjct  137  CYIQKVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDACVIGAQHSAF  196

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKP  LDGLFQYLSTVF+TDL SR+FL LP+PVGVDFRASCFCHK TI
Sbjct  197  LQQASYITGGVYLKPPQLDGLFQYLSTVFSTDLQSRSFLQLPKPVGVDFRASCFCHKKTI  256

Query  337  DMGYICSVCLSIFCKHQPQCSTCG  266
            DMGYICSVCLSIFCKH  +CSTCG
Sbjct  257  DMGYICSVCLSIFCKHHKKCSTCG  280



>ref|XP_008367337.1| PREDICTED: general transcription factor IIH subunit 3-like [Malus 
domestica]
Length=274

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSGPLHPQPRILCL GS DGP QYVAIMNSIFSAQRSMVPIDSC +G+ +
Sbjct  128  MALCYIQRVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNSIFSAQRSMVPIDSCYMGSSN  187

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVYLKPQ  +GLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  188  SAFLQQASYITGGVYLKPQQPNGLFQYLSTVFATDLHSRAFLQLPKSLGVDFRASCFCHK  247

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCG  266
             TIDMGYICSVCLSIFCKH  +CSTCG
Sbjct  248  KTIDMGYICSVCLSIFCKHHKKCSTCG  274



>ref|XP_008676482.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN27367.1| unknown [Zea mays]
 gb|AFW66647.1| hypothetical protein ZEAMMB73_940692 [Zea mays]
Length=294

 Score =   266 bits (680),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 3/161 (2%)
 Frame = -1

Query  721  SGSLSMALC---YIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPID  551
            SG+LS++LC    IQR+FRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPID
Sbjct  122  SGALSISLCCYLDIQRIFRSGSRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPID  181

Query  550  SCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDF  371
            SC +G Q SAFLQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSRAFL LP+ +GVDF
Sbjct  182  SCIVGTQDSAFLQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRAFLRLPKTLGVDF  241

Query  370  RASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            RASCFCHK TIDMGY+CS+CLSIFCK+Q +CSTCGS F +A
Sbjct  242  RASCFCHKKTIDMGYVCSICLSIFCKNQKKCSTCGSEFSRA  282



>emb|CDX96723.1| BnaA08g22660D [Brassica napus]
Length=304

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR+FR+G LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  131  MALCYIQRIFRTGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  190

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ L GLFQ+L+T+FATDLH+R F+ LP+PVGVDFRASCFCHK
Sbjct  191  SAFLQQASYITGGVHHAPKQLGGLFQFLTTIFATDLHTRGFVQLPKPVGVDFRASCFCHK  250

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKAR--GQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+++  G   ++  + +KR
Sbjct  251  KTIDMGYVCSVCLSIFCEHHKKCSTCGSVFGQSKLDGANASSSVNDRKR  299



>ref|XP_010916571.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X3 [Elaeis guineensis]
Length=296

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHSAF
Sbjct  139  CYIQRVFRSGALHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHSAF  198

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  199  LQQASYITGGVYLKPQHLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  258

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSV  260
            DMGY+CSVCLSIFCKH  +CSTCGSV
Sbjct  259  DMGYVCSVCLSIFCKHHKKCSTCGSV  284



>ref|XP_007137405.1| hypothetical protein PHAVU_009G124300g [Phaseolus vulgaris]
 gb|ESW09399.1| hypothetical protein PHAVU_009G124300g [Phaseolus vulgaris]
Length=292

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 3/167 (2%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G+ DGP QYVAIMN+IFSAQRS VPIDSC IG+ +
Sbjct  127  MALCYIQRAFRSGPMPPQPRILCLQGTADGPEQYVAIMNAIFSAQRSTVPIDSCYIGSNN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDLHSRAFL LP+ VGVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLHSRAFLRLPKSVGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMG++CSVCLSIFC+H  +CSTCGSVFG+A+     A   ++KR
Sbjct  247  QTIDMGFVCSVCLSIFCEHHDKCSTCGSVFGQAKVDASEA---NRKR  290



>ref|XP_004952041.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X1 [Setaria italica]
Length=291

 Score =   263 bits (673),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQR+FRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC +G Q SAF
Sbjct  130  CYIQRIFRSGTRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCIVGTQDSAF  189

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TI
Sbjct  190  LQQASYITGGVYLKPQELNGLFQYLAVVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTI  249

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            DMGY+CSVCLSIFCK+Q +CSTCGS F +
Sbjct  250  DMGYVCSVCLSIFCKNQKKCSTCGSEFSR  278



>ref|XP_009110347.1| PREDICTED: general transcription factor IIH subunit 3-like [Brassica 
rapa]
Length=304

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR+FR+G LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  131  MALCYIQRIFRTGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  190

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ L GLFQ+L+T+FATDLH+R F+ LP+ VGVDFRASCFCHK
Sbjct  191  SAFLQQASYITGGVHHAPKQLGGLFQFLTTIFATDLHTRGFVQLPKTVGVDFRASCFCHK  250

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKAR--GQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+++  G   ++  + +KR
Sbjct  251  KTIDMGYVCSVCLSIFCEHHKKCSTCGSVFGQSKLDGANASSSVNDRKR  299



>ref|XP_003523449.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X1 [Glycine max]
 gb|KHN47029.1| General transcription factor IIH subunit 3 [Glycine soja]
Length=294

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G+ DGP QYVAIMN+IFSAQ S VPIDSC IG+ +
Sbjct  129  MALCYIQRAFRSGPMPPQPRILCLQGAADGPEQYVAIMNAIFSAQHSTVPIDSCYIGSNN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDLHSRAFL LP+ VGVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLHSRAFLRLPKSVGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+A+    AA  D +++
Sbjct  249  QTIDMGYVCSVCLSIFCEHHDKCSTCGSVFGQAQLDASAA--DRQRK  293



>ref|XP_010916572.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X4 [Elaeis guineensis]
Length=286

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHSAF
Sbjct  139  CYIQRVFRSGALHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHSAF  198

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  199  LQQASYITGGVYLKPQHLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  258

Query  337  DMGYICSVCLSIFCKHQPQCSTCG  266
            DMGY+CSVCLSIFCKH  +CSTCG
Sbjct  259  DMGYVCSVCLSIFCKHHKKCSTCG  282



>ref|NP_001045748.1| Os02g0125800 [Oryza sativa Japonica Group]
 dbj|BAD08012.1| putative TFIIH basal transcription factor complex p34 subunit 
[Oryza sativa Japonica Group]
 dbj|BAF07662.1| Os02g0125800 [Oryza sativa Japonica Group]
 dbj|BAH00724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC +G Q SAF
Sbjct  128  CYIQRVFRSGTRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCIVGTQDSAF  187

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TI
Sbjct  188  LQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTI  247

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            DMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  248  DMGYVCSVCLSIFCKYHKKCSTCGSEFNR  276



>gb|KHN09200.1| General transcription factor IIH subunit 3 [Glycine soja]
Length=294

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G  DGP QYVAIMN+IFSAQ S VPIDSC IG+ +
Sbjct  129  MALCYIQRAFRSGPMPPQPRILCLQGVADGPEQYVAIMNAIFSAQHSTVPIDSCYIGSNN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDLHSRAFL LP+ VGVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLHSRAFLRLPKSVGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+A+    AA  D +++
Sbjct  249  QTIDMGYVCSVCLSIFCEHHDKCSTCGSVFGQAQLDASAA--DRQRK  293



>ref|XP_009409176.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009409177.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009409178.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=314

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRS   HPQPRILCL GSPDGP QYVA+MN+IFSAQRSM+PIDSC +G QHSAF
Sbjct  148  CYIQRVFRSRARHPQPRILCLQGSPDGPEQYVAVMNAIFSAQRSMIPIDSCVMGVQHSAF  207

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYLS VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  208  LQQASYITGGVYLKPQQLDGLFQYLSAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  267

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGY+CSVCLSIFCKH  +CSTCGS F +      A   D K++
Sbjct  268  DMGYVCSVCLSIFCKHHKKCSTCGSDFSQGPTDANA---DRKRK  308



>ref|NP_001242062.1| uncharacterized protein LOC100776751 [Glycine max]
 gb|ACU24393.1| unknown [Glycine max]
Length=294

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G  DGP QYVAIMN+IFSAQ S VPIDSC IG+ +
Sbjct  129  MALCYIQRAFRSGPMPPQPRILCLRGVADGPEQYVAIMNAIFSAQHSTVPIDSCYIGSNN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDL+SRAFL LP+ VGVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLYSRAFLRLPKSVGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
             TIDMGY+CSVCLSIFC+H  +CSTCGSVFG+A+    AA  D +++
Sbjct  249  QTIDMGYVCSVCLSIFCEHHDKCSTCGSVFGQAQLDASAA--DRQRK  293



>ref|XP_006648269.1| PREDICTED: general transcription factor IIH subunit 3-like [Oryza 
brachyantha]
Length=292

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG  HPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC +G Q SAF
Sbjct  132  CYIQRVFRSGTRHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCIVGTQDSAF  191

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ L GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TI
Sbjct  192  LQQASYITGGVYLKPQELSGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTI  251

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            DMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  252  DMGYVCSVCLSIFCKYHKKCSTCGSEFNR  280



>emb|CDX83854.1| BnaC08g17910D [Brassica napus]
Length=276

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHPQPRILCL GSPDGP QYVA+MNSIFSAQR MVPIDSC IG Q+
Sbjct  130  MALCYIQRVFRSGHLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRLMVPIDSCYIGTQN  189

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GV+  P+ LDGLFQ+L+T+FATDLH+R F+ LP+PVGVDFRASCFCHK
Sbjct  190  SAFLQQASYITGGVHHAPKQLDGLFQFLTTIFATDLHTRGFVQLPKPVGVDFRASCFCHK  249

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCG  266
             TIDMGY+CSVCLSIFC+H  +CSTCG
Sbjct  250  KTIDMGYVCSVCLSIFCEHHKKCSTCG  276



>gb|KEH34826.1| general transcription factor IIH subunit, putative [Medicago 
truncatula]
Length=276

 Score =   258 bits (658),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS+VP+DSC 
Sbjct  124  SGALSMALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSVVPVDSCF  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+ +SAFLQQASYIT G+Y +P  ++GLFQYLSTVFATDLHSR FL LP+ +GVDFRAS
Sbjct  184  IGSNNSAFLQQASYITGGIYYRPPQMEGLFQYLSTVFATDLHSREFLRLPKSLGVDFRAS  243

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTC  269
            CFCHK TIDMGY+CSVCLSIFC+H  +CSTC
Sbjct  244  CFCHKQTIDMGYVCSVCLSIFCEHHDKCSTC  274



>gb|KEH34827.1| general transcription factor IIH subunit, putative [Medicago 
truncatula]
Length=275

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS+VP+DSC 
Sbjct  124  SGALSMALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSVVPVDSCF  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+ +SAFLQQASYIT G+Y +P  ++GLFQYLSTVFATDLHSR FL LP+ +GVDFRAS
Sbjct  184  IGSNNSAFLQQASYITGGIYYRPPQMEGLFQYLSTVFATDLHSREFLRLPKSLGVDFRAS  243

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTC  269
            CFCHK TIDMGY+CSVCLSIFC+H  +CSTC
Sbjct  244  CFCHKQTIDMGYVCSVCLSIFCEHHDKCSTC  274



>ref|XP_003601046.1| General transcription factor IIH subunit [Medicago truncatula]
Length=340

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS+VP+DSC 
Sbjct  124  SGALSMALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSVVPVDSCF  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+ +SAFLQQASYIT G+Y +P  ++GLFQYLSTVFATDLHSR FL LP+ +GVDFRAS
Sbjct  184  IGSNNSAFLQQASYITGGIYYRPPQMEGLFQYLSTVFATDLHSREFLRLPKSLGVDFRAS  243

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQ  239
            CFCHK TIDMGY+CSVCLSIFC+H  +CSTC      A  +
Sbjct  244  CFCHKQTIDMGYVCSVCLSIFCEHHDKCSTCSFTIYDASNE  284



>ref|XP_010233747.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Brachypodium distachyon]
Length=285

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 135/157 (86%), Gaps = 5/157 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LS+ALCYIQRVFRSG  HPQPR     GSPDGP QYVA+MNSIFSAQRSMVPIDSC 
Sbjct  122  SGALSLALCYIQRVFRSGTRHPQPR-----GSPDGPEQYVAVMNSIFSAQRSMVPIDSCI  176

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +G Q SAFLQQASYIT GVYLKPQ L GLFQYL+ VFA+DLHSRAFL LP+ +GVDFRAS
Sbjct  177  VGTQDSAFLQQASYITGGVYLKPQELSGLFQYLAAVFASDLHSRAFLRLPKTLGVDFRAS  236

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            CFCHK TIDMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  237  CFCHKKTIDMGYVCSVCLSIFCKYHKKCSTCGSEFSR  273



>ref|XP_008802070.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Phoenix dactylifera]
Length=470

 Score =   259 bits (662),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = -1

Query  703  ALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHS  524
            ALCYIQRVFRSG LHPQPR      SPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHS
Sbjct  140  ALCYIQRVFRSGALHPQPR-----ASPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHS  194

Query  523  AFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKN  344
            AFLQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK 
Sbjct  195  AFLQQASYITGGVYLKPQQLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKK  254

Query  343  TIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            TIDMGY+CSVCLSIFCKH  +CSTCGS F ++
Sbjct  255  TIDMGYVCSVCLSIFCKHHKKCSTCGSEFNQS  286



>ref|XP_010916570.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Elaeis guineensis]
Length=300

 Score =   253 bits (645),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 129/150 (86%), Gaps = 5/150 (3%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG LHPQPR     GSPDGP QYVA+MN+IFSAQRSMVPIDSC IG QHSAF
Sbjct  139  CYIQRVFRSGALHPQPR-----GSPDGPEQYVAVMNAIFSAQRSMVPIDSCVIGVQHSAF  193

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  194  LQQASYITGGVYLKPQHLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  253

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            DMGY+CSVCLSIFCKH  +CSTCGS F ++
Sbjct  254  DMGYVCSVCLSIFCKHHKKCSTCGSEFNQS  283



>ref|XP_010273664.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Nelumbo nucifera]
Length=298

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQ+VFRSGPLHPQPRILCL GS DGP QYVAIMN+IFSAQRSMVPID+C IGAQHSAF
Sbjct  137  CYIQKVFRSGPLHPQPRILCLQGSSDGPEQYVAIMNAIFSAQRSMVPIDACVIGAQHSAF  196

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKP  LDGLFQYLSTVF+TDL SR+FL LP+PVGVDFRASCFCHK TI
Sbjct  197  LQQASYITGGVYLKPPQLDGLFQYLSTVFSTDLQSRSFLQLPKPVGVDFRASCFCHKKTI  256

Query  337  DMGYICSVCLSIFC  296
            DMGYICSVCLSIFC
Sbjct  257  DMGYICSVCLSIFC  270



>ref|XP_006578973.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X2 [Glycine max]
Length=276

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G+ DGP QYVAIMN+IFSAQ S VPIDSC IG+ +
Sbjct  129  MALCYIQRAFRSGPMPPQPRILCLQGAADGPEQYVAIMNAIFSAQHSTVPIDSCYIGSNN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDLHSRAFL LP+ VGVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLHSRAFLRLPKSVGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCG  266
             TIDMGY+CSVCLSIFC+H  +CSTCG
Sbjct  249  QTIDMGYVCSVCLSIFCEHHDKCSTCG  275



>ref|XP_004500558.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X1 [Cicer arietinum]
Length=315

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS VP+DSC IG+ +
Sbjct  127  MALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSSVPVDSCYIGSNN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y +P  +DGLFQYLSTVFATDLHSRAFL LP+ +GVDFRASCFCHK
Sbjct  187  SAFLQQASYITGGIYYRPPQMDGLFQYLSTVFATDLHSRAFLRLPKSLGVDFRASCFCHK  246

Query  346  NTIDMGYICSVCLSIFCKHQPQCST  272
             TIDMGY+CSVCLSIFC+H  +CST
Sbjct  247  QTIDMGYVCSVCLSIFCEHHDKCST  271



>ref|XP_004952042.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X2 [Setaria italica]
Length=286

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 5/149 (3%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQR+FRSG  HPQPR     GSPDGP QYVA+MNSIFSAQRSMVPIDSC +G Q SAF
Sbjct  130  CYIQRIFRSGTRHPQPR-----GSPDGPEQYVAVMNSIFSAQRSMVPIDSCIVGTQDSAF  184

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TI
Sbjct  185  LQQASYITGGVYLKPQELNGLFQYLAVVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTI  244

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            DMGY+CSVCLSIFCK+Q +CSTCGS F +
Sbjct  245  DMGYVCSVCLSIFCKNQKKCSTCGSEFSR  273



>ref|XP_006580978.1| PREDICTED: uncharacterized protein LOC100776751 isoform X1 [Glycine 
max]
Length=276

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR FRSGP+ PQPRILCL G  DGP QYVAIMN+IFSAQ S VPIDSC IG+ +
Sbjct  129  MALCYIQRAFRSGPMPPQPRILCLQGVADGPEQYVAIMNAIFSAQHSTVPIDSCYIGSNN  188

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT G+Y KP  LDGL+QYLSTVFATDLHSRAFL LP+ VGVDFRASCFCHK
Sbjct  189  SAFLQQASYITGGIYYKPPQLDGLYQYLSTVFATDLHSRAFLRLPKSVGVDFRASCFCHK  248

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCG  266
             TIDMGY+CSVCLSIFC+H  +CSTCG
Sbjct  249  QTIDMGYVCSVCLSIFCEHHDKCSTCG  275



>ref|XP_001753108.1| predicted protein [Physcomitrella patens]
 gb|EDQ82149.1| predicted protein [Physcomitrella patens]
Length=257

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 7/172 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL-HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            SGSLSMALCYIQRV R GPL HPQ RILCL GSPD P QY+++MNSIFSAQR+ V ID+C
Sbjct  85   SGSLSMALCYIQRVLR-GPLPHPQARILCLQGSPDAPYQYISVMNSIFSAQRNGVVIDAC  143

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             +G+QHSAFLQQA++IT G+Y+KP   DGLF+YL  VF TDL SR FL LPRPVGVDFRA
Sbjct  144  VVGSQHSAFLQQATHITGGIYMKPPQPDGLFEYLMMVFTTDLFSRQFLQLPRPVGVDFRA  203

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKAR-----GQEPAAP  224
            SCFCHK TIDMG++CSVCLSIFCKH   CSTCG+ F ++      G +  AP
Sbjct  204  SCFCHKKTIDMGFVCSVCLSIFCKHHQTCSTCGATFSRSNSTTVTGMKRKAP  255



>ref|XP_009409179.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=309

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 131/164 (80%), Gaps = 8/164 (5%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRS   HPQPR     GSPDGP QYVA+MN+IFSAQRSM+PIDSC +G QHSAF
Sbjct  148  CYIQRVFRSRARHPQPR-----GSPDGPEQYVAVMNAIFSAQRSMIPIDSCVMGVQHSAF  202

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYLS VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  203  LQQASYITGGVYLKPQQLDGLFQYLSAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  262

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGY+CSVCLSIFCKH  +CSTCGS F +      A   D K++
Sbjct  263  DMGYVCSVCLSIFCKHHKKCSTCGSDFSQGPTDANA---DRKRK  303



>ref|XP_002532948.1| RNA polymerase II transcription factor B subunit, putative [Ricinus 
communis]
 gb|EEF29432.1| RNA polymerase II transcription factor B subunit, putative [Ricinus 
communis]
Length=266

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQR+FRSGPLHPQPRILCL GSPDGP QYVA+MNSIFSAQRSMVPIDSC +G  +
Sbjct  128  MALCYIQRIFRSGPLHPQPRILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCYVGGHN  187

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            SAFLQQASYIT GVY+KPQ LDGLFQYL TVFATDLHSR+FL LPRP GVDFRASCFCHK
Sbjct  188  SAFLQQASYITGGVYVKPQHLDGLFQYLVTVFATDLHSRSFLQLPRPAGVDFRASCFCHK  247

Query  346  NTIDMGYICS  317
             TIDMG+ICS
Sbjct  248  TTIDMGFICS  257



>ref|XP_006828057.1| hypothetical protein AMTR_s00008p00264310, partial [Amborella 
trichopoda]
 gb|ERM95473.1| hypothetical protein AMTR_s00008p00264310, partial [Amborella 
trichopoda]
Length=277

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQR+ R+GP+HPQPRILCL  SPDG  QYVAIMN+IFSAQRSMVPIDSC +G++ SAF
Sbjct  134  CYIQRILRTGPVHPQPRILCLQASPDGSEQYVAIMNAIFSAQRSMVPIDSCVVGSEDSAF  193

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVY KPQ LDGLFQ LS VFATDLHSR FL LP P GVDFRASCFCHK  I
Sbjct  194  LQQASYITGGVYQKPQHLDGLFQCLSMVFATDLHSRRFLKLPTPTGVDFRASCFCHKEPI  253

Query  337  DMGYICSVCLSIFCKHQPQCSTCG  266
             MGY+CSVCLSIFCK+  +CSTCG
Sbjct  254  GMGYVCSVCLSIFCKYHTKCSTCG  277



>gb|KJB59106.1| hypothetical protein B456_009G245300 [Gossypium raimondii]
Length=248

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQRVFRSG LHP PRILCL GS DGP QYVAIMN+IFSAQRS VPIDSC 
Sbjct  122  SGSLSMALCYIQRVFRSGALHPHPRILCLQGSLDGPEQYVAIMNAIFSAQRSSVPIDSCY  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG+Q+SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+F+HLP+PVGVDFRAS
Sbjct  182  IGSQNSAFLQQASYITGGVHHKPQNLDGLFQYLMTIFATDLHSRSFIHLPKPVGVDFRAS  241

Query  361  CFCHK  347
            C   K
Sbjct  242  CMFFK  246



>ref|XP_007019037.1| Basal transcription factor complex subunit-related isoform 2 
[Theobroma cacao]
 gb|EOY16262.1| Basal transcription factor complex subunit-related isoform 2 
[Theobroma cacao]
Length=274

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            MALCYIQRVFRSG LHP PRILCL GSPDGP QYVAIMN+IFSAQRSMVPIDSC +GAQ+
Sbjct  127  MALCYIQRVFRSGALHPHPRILCLQGSPDGPEQYVAIMNAIFSAQRSMVPIDSCYMGAQN  186

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCF  356
            SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHSR+FLHLP+PVGVDFRAS F
Sbjct  187  SAFLQQASYITGGVHHKPQHLDGLFQYLMTIFATDLHSRSFLHLPKPVGVDFRASKF  243



>gb|EMT22292.1| General transcription factor IIH subunit 3 [Aegilops tauschii]
Length=265

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 111/147 (76%), Gaps = 12/147 (8%)
 Frame = -1

Query  691  IQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAFLQ  512
            IQR+FRSG  HPQPR     GSPDGP QY            S VPID+C +G Q SAFLQ
Sbjct  117  IQRIFRSGTRHPQPR-----GSPDGPEQYAYFF-------LSTVPIDTCIVGTQDSAFLQ  164

Query  511  QASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTIDM  332
            QASYIT GVY+KPQ L GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TIDM
Sbjct  165  QASYITGGVYMKPQELSGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTIDM  224

Query  331  GYICSVCLSIFCKHQPQCSTCGSVFGK  251
            GY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  225  GYVCSVCLSIFCKYHKKCSTCGSEFSR  251



>ref|XP_010916573.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X5 [Elaeis guineensis]
Length=277

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 112/164 (68%), Gaps = 29/164 (18%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG LHPQPR                            VPIDSC IG QHSAF
Sbjct  139  CYIQRVFRSGALHPQPR----------------------------VPIDSCVIGVQHSAF  170

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ LDGLFQYL+ VFATDL SR FL LP+P GVDFRASCFCHK TI
Sbjct  171  LQQASYITGGVYLKPQHLDGLFQYLAAVFATDLQSRNFLQLPKPAGVDFRASCFCHKKTI  230

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            DMGY+CSVCLSIFCKH  +CSTCGS F ++     A   D K++
Sbjct  231  DMGYVCSVCLSIFCKHHKKCSTCGSEFNQSPPDANATS-DRKRK  273



>ref|XP_005650835.1| transcription factor Tfb4 [Coccomyxa subellipsoidea C-169]
 gb|EIE26291.1| transcription factor Tfb4 [Coccomyxa subellipsoidea C-169]
Length=305

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP----LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            +G+LS ALC I +   +         QPR+LCL GSPD   QY+++MN+IF+AQR  V I
Sbjct  129  AGALSRALCLINKAQLASAGGSRTRKQPRLLCLKGSPDATEQYISVMNAIFAAQRCEVVI  188

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D+C +GA  SAFLQQA+++TNG+YL+P+  D L QYL T+F  D  SR+FL LPRP+GVD
Sbjct  189  DACMLGASDSAFLQQAAHLTNGIYLRPKHKDALLQYLLTIFCGDAFSRSFLQLPRPIGVD  248

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPA  230
            FRA+CFCH+  ID+GY+CSVCLSIFC+   +CSTCG+ F K   + PA
Sbjct  249  FRAACFCHRRAIDLGYVCSVCLSIFCESITECSTCGTTF-KVVARTPA  295



>gb|EEC72394.1| hypothetical protein OsI_05675 [Oryza sativa Indica Group]
 gb|EEE56222.1| hypothetical protein OsJ_05207 [Oryza sativa Japonica Group]
Length=261

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 105/149 (70%), Gaps = 28/149 (19%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSG  HPQPR                            VPIDSC +G Q SAF
Sbjct  128  CYIQRVFRSGTRHPQPR----------------------------VPIDSCIVGTQDSAF  159

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASYIT GVYLKPQ L+GLFQYL+ VFATDLHSR FL LP+ +GVDFRASCFCHK TI
Sbjct  160  LQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTI  219

Query  337  DMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            DMGY+CSVCLSIFCK+  +CSTCGS F +
Sbjct  220  DMGYVCSVCLSIFCKYHKKCSTCGSEFNR  248



>ref|XP_006434173.1| hypothetical protein CICLE_v100020022mg, partial [Citrus clementina]
 gb|ESR47413.1| hypothetical protein CICLE_v100020022mg, partial [Citrus clementina]
Length=124

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  562  VPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPV  383
            VPIDSC +GAQ+SAFLQQASYIT GV+ KPQ LDGLFQYL T+F TDLHSR FL LP+PV
Sbjct  1    VPIDSCYLGAQNSAFLQQASYITGGVHHKPQQLDGLFQYLLTIFGTDLHSRNFLQLPKPV  60

Query  382  GVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQEPAAP*DHKKR  206
            GVDFRASCFCHKNTIDMGYICSVCLSI+CKH  +CSTCGSVFG+A+ Q       ++KR
Sbjct  61   GVDFRASCFCHKNTIDMGYICSVCLSIYCKHLKKCSTCGSVFGQAQTQSDEPSATNRKR  119



>ref|XP_004169281.1| PREDICTED: general transcription factor IIH subunit 3-like, partial 
[Cucumis sativus]
Length=121

 Score =   184 bits (466),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -1

Query  562  VPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPV  383
            VPIDSC IG+ +SAFLQQASYIT GVYLKPQ +DGLFQYLSTVF TDLHSR FL LP+ V
Sbjct  1    VPIDSCYIGSHNSAFLQQASYITGGVYLKPQQMDGLFQYLSTVFGTDLHSRTFLQLPKSV  60

Query  382  GVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKA  248
            GVDFRASCFCHK TIDMGY+CSVCLSIFCKH  +CSTCGSVFG+ 
Sbjct  61   GVDFRASCFCHKKTIDMGYVCSVCLSIFCKHHKKCSTCGSVFGET  105



>gb|KHG29334.1| General transcription factor IIH subunit 3 [Gossypium arboreum]
Length=276

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 105/137 (77%), Gaps = 22/137 (16%)
 Frame = -1

Query  721  SGSLSMALC-----------------YIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIM  593
            SGSLSMALC                  IQRVFRSG LHP PR     GSPDGP QYVAIM
Sbjct  122  SGSLSMALCCILSGVLMLPYFFDILTDIQRVFRSGALHPHPR-----GSPDGPEQYVAIM  176

Query  592  NSIFSAQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHS  413
            N+IFSAQRS VPIDSC +G+Q+SAFLQQASYIT GV+ KPQ LDGLFQYL T+FATDLHS
Sbjct  177  NAIFSAQRSSVPIDSCYLGSQNSAFLQQASYITGGVHHKPQNLDGLFQYLMTIFATDLHS  236

Query  412  RAFLHLPRPVGVDFRAS  362
            R+F+HLP+PVGVDFRAS
Sbjct  237  RSFIHLPKPVGVDFRAS  253



>ref|XP_003283083.1| hypothetical protein DICPUDRAFT_9126 [Dictyostelium purpureum]
 gb|EGC40332.1| hypothetical protein DICPUDRAFT_9126 [Dictyostelium purpureum]
Length=282

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S +LSMALCYI R+ +  P + +PRIL  + SPD   QY+++MN IFSAQ+  +P+DSC 
Sbjct  125  SAALSMALCYINRIRKESP-NLKPRILVFNISPDVSSQYISVMNCIFSAQKQSIPVDSCI  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +    S FLQQAS++TNG+YLKP   + L QYL T F  D  SR  L  P    VD+RAS
Sbjct  184  LSQTDSTFLQQASHLTNGIYLKPHKQELLSQYLLTTFLLDTQSRKSLAYPNLKSVDYRAS  243

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            CFCHK  +D+G++CSVCLSIFC H   CSTCG+ F 
Sbjct  244  CFCHKKIVDIGFVCSVCLSIFCNHFSSCSTCGTKFS  279



>ref|XP_005845495.1| hypothetical protein CHLNCDRAFT_13819, partial [Chlorella variabilis]
 gb|EFN53393.1| hypothetical protein CHLNCDRAFT_13819, partial [Chlorella variabilis]
Length=135

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 101/134 (75%), Gaps = 1/134 (1%)
 Frame = -1

Query  655  QP-RILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAFLQQASYITNGVYL  479
            QP R+LCL  +PD P QY+++MN+IFSAQRS V ID+C +G +HS FLQQA+Y+T GVYL
Sbjct  2    QPARVLCLTAAPDVPSQYISVMNAIFSAQRSGVLIDACQLGRRHSTFLQQAAYLTGGVYL  61

Query  478  KPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTIDMGYICSVCLSIF  299
            KP     L QYL++VFA D  +R FL +P    VDFRASCFCHK  ID+GY+CS CLSIF
Sbjct  62   KPSKPVALVQYLNSVFAVDAATRQFLRMPGTAHVDFRASCFCHKRQIDLGYVCSACLSIF  121

Query  298  CKHQPQCSTCGSVF  257
            C+  P C+TCG+ F
Sbjct  122  CEQLPACTTCGTEF  135



>ref|XP_001415467.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93759.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=285

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 3/159 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQR---VFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPID  551
            +G+LS+ALCY  R   +  +  L  +PRILCL  S D P  Y+++MN+IFSAQR  +PID
Sbjct  116  AGALSLALCYCNRAQTLETAAGLRVRPRILCLQASQDNPTDYISMMNAIFSAQRQSIPID  175

Query  550  SCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDF  371
            + A+G     FLQQA++IT G Y+KP    GL QYL +  A D+ SR+ L LP   GVDF
Sbjct  176  AFALGEHDLPFLQQAAHITRGAYVKPTHGAGLLQYLLSTAALDMRSRSHLKLPAARGVDF  235

Query  370  RASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            RASCFCHK  + +G++CSVCLSIFC+ +  C TCG+ F 
Sbjct  236  RASCFCHKRPVSVGFVCSVCLSIFCERRSSCDTCGADFA  274



>ref|XP_009823444.1| hypothetical protein H257_01771 [Aphanomyces astaci]
 gb|ETV86645.1| hypothetical protein H257_01771 [Aphanomyces astaci]
Length=280

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S  LS+ALC+I R         QPRIL + GSPD   QY++IMN IFSAQ+  VPIDSC 
Sbjct  112  SAGLSLALCFINRAMNESR-ELQPRILVVDGSPDFAEQYISIMNCIFSAQKKHVPIDSCV  170

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            + ++ SAFLQQASY+T G+Y KP+   GL QY  +++  D  +R  L LP    VDFRA 
Sbjct  171  LASEPSAFLQQASYLTGGIYFKPKEPQGLVQYFLSIWLADADTRQMLKLPTQASVDFRAM  230

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCHK TI   ++C VCLS+FC+  P CSTCG
Sbjct  231  CFCHKQTISTAFVCPVCLSLFCEFSPVCSTCG  262



>emb|CEG73089.1| hypothetical protein RMATCC62417_08534 [Rhizopus microsporus]
Length=301

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 107/157 (68%), Gaps = 1/157 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR-SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCYI R+ +     + +PRIL L  SPD   QY+ +MN IFSAQ++ +P+D C
Sbjct  128  TGALSMALCYINRITKLDDEGYIKPRILVLSVSPDSAFQYIPLMNCIFSAQKASIPVDVC  187

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  + +AFLQQAS IT GVY++      L +YL   F  D +SR FL+LP    VDFRA
Sbjct  188  KIYGEDNAFLQQASNITGGVYVRVDNAQALLEYLLMAFLPDRYSRNFLNLPTQDQVDFRA  247

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            +CFCHK  +D+G++CSVCLSIFCK  P CSTC + F 
Sbjct  248  ACFCHKQIVDIGFVCSVCLSIFCKWSPVCSTCKTKFA  284



>gb|KDO30370.1| hypothetical protein SPRG_05081 [Saprolegnia parasitica CBS 223.65]
Length=289

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S  LS+ALC+I R         +PRIL +  SPD   QY++IMN IFSAQ+  VPID+C 
Sbjct  122  SAGLSLALCFINRAMNEQ-RDLRPRILSIQASPDFAAQYISIMNCIFSAQKKHVPIDACV  180

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  + S+FLQQA+Y+T G+Y KP+ +DGL QY  T++  D  +RA L LP    VDFRA 
Sbjct  181  LSDEPSSFLQQAAYLTGGIYFKPRDVDGLVQYFLTIWLADTSTRALLKLPSQGSVDFRAM  240

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCHK TI   ++C VCLS+FC+ QP CSTCG
Sbjct  241  CFCHKKTIATAFVCPVCLSLFCEFQPICSTCG  272



>ref|XP_008606098.1| hypothetical protein SDRG_02296 [Saprolegnia diclina VS20]
 gb|EQC40399.1| hypothetical protein SDRG_02296 [Saprolegnia diclina VS20]
Length=289

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S  LS+ALC+I R         +PRIL +  SPD   QY++IMN IFSAQ+  VPID+C 
Sbjct  122  SAGLSLALCFINRAMNEQ-RDLRPRILSVQASPDFAAQYISIMNCIFSAQKKHVPIDACI  180

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  + S+FLQQA+Y+T GVY KP+ +DGL QY  T++  D  +RA L LP    VDFRA 
Sbjct  181  LSEEPSSFLQQAAYLTGGVYFKPRDVDGLVQYFLTIWLADTSTRALLKLPSQASVDFRAM  240

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCHK TI   ++C VCLS+FC+  P CSTCG
Sbjct  241  CFCHKKTIATAFVCPVCLSLFCEFLPICSTCG  272



>emb|CDS09653.1| hypothetical protein LRAMOSA11013 [Absidia idahoensis var. thermophila]
Length=325

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 106/157 (68%), Gaps = 1/157 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL-HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+ SMALCYI R+ +   L H +PRIL L  SPD   QY+ +MN IFSAQ++ +P+D C
Sbjct  136  TGAFSMALCYINRITKLDQLGHIKPRILILTLSPDSAYQYIPLMNCIFSAQKAGIPVDVC  195

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  Q +AFLQQA+ IT G+Y+K      L QYL   F  + ++R FL+LP    VDFRA
Sbjct  196  KIYGQETAFLQQAANITGGIYIKVNNAQALLQYLMFAFLPERYARNFLNLPNQDQVDFRA  255

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            +CFCHK  +D+GY+CSVCLSIFC   P C+TC + F 
Sbjct  256  ACFCHKKIVDIGYVCSVCLSIFCSWIPVCTTCKTKFA  292



>ref|XP_004360639.1| general transcription factor IIH [Dictyostelium fasciculatum]
 gb|EGG22788.1| general transcription factor IIH [Dictyostelium fasciculatum]
Length=304

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            +ALCYI R+ +      + RIL  + SPD   QY+ +MN IFSAQ+  +P+DSC + +  
Sbjct  133  LALCYINRIKKDNST-IRSRILVFNISPDVSTQYIPVMNCIFSAQKQSIPVDSCILTSTD  191

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            S FLQQAS++TNG+YL+P   D L QYL + F  D +SR FL++P    VD+RASCFCHK
Sbjct  192  STFLQQASHLTNGIYLRPHRQDHLGQYLLSSFLIDSYSRKFLNVPTLKTVDYRASCFCHK  251

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
              +D+G++CSVCLSI+CK+   C+TCG+ F
Sbjct  252  KIVDIGFVCSVCLSIYCKYSSSCTTCGTKF  281



>gb|EXX76109.1| Tfb4p [Rhizophagus irregularis DAOM 197198w]
Length=282

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL-HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCY  R+ R+  + H +PRIL +  SPD P QY++IMN IFSAQ+  +PID C
Sbjct  98   AGALSMALCYTNRIMRADEIGHIKPRILIISISPDSPYQYISIMNCIFSAQKLGIPIDVC  157

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             + ++ + FL+QA+++T G YLK QI  G  Q+L   F  D  +R +  LP    VDF A
Sbjct  158  KVHSEETVFLKQAAHLTGGRYLKLQIPQGFLQFLMITFLPDRFTRNYQCLPGEEKVDFSA  217

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQE  236
            SCFCHK  ID+GY+CSVCLSIFC    QCSTC S    A   E
Sbjct  218  SCFCHKKMIDIGYVCSVCLSIFCHPLEQCSTCRSSLMLASVNE  260



>gb|ESA11069.1| hypothetical protein GLOINDRAFT_193002 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX76108.1| Tfb4p [Rhizophagus irregularis DAOM 197198w]
Length=316

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL-HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCY  R+ R+  + H +PRIL +  SPD P QY++IMN IFSAQ+  +PID C
Sbjct  132  AGALSMALCYTNRIMRADEIGHIKPRILIISISPDSPYQYISIMNCIFSAQKLGIPIDVC  191

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             + ++ + FL+QA+++T G YLK QI  G  Q+L   F  D  +R +  LP    VDF A
Sbjct  192  KVHSEETVFLKQAAHLTGGRYLKLQIPQGFLQFLMITFLPDRFTRNYQCLPGEEKVDFSA  251

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQE  236
            SCFCHK  ID+GY+CSVCLSIFC    QCSTC S    A   E
Sbjct  252  SCFCHKKMIDIGYVCSVCLSIFCHPLEQCSTCRSSLMLASVNE  294



>dbj|GAM28580.1| hypothetical protein SAMD00019534_117560 [Acytostelium subglobosum 
LB1]
Length=337

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S ++S+ LC+I R+ +  P + +PRIL  + SPD   QY+ +MN IFSAQ+  +P+DSC 
Sbjct  144  SAAMSLGLCHINRMKKDLP-NLKPRILVFNISPDVSSQYIPVMNCIFSAQKQSIPVDSCI  202

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            + +  S FLQQAS++T+G+YLKPQ  + L QYL + F  D  SR  L +P    VDF+AS
Sbjct  203  LSSD-STFLQQASHLTSGIYLKPQRQENLCQYLVSTFLIDSDSRRHLSVPTLTTVDFKAS  261

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            CFCHK  +D+G++CSVCLSIFCK    CSTCG+ F 
Sbjct  262  CFCHKRIVDIGFVCSVCLSIFCKPSSSCSTCGTKFA  297



>ref|XP_008866339.1| hypothetical protein H310_04008 [Aphanomyces invadans]
 gb|ETW04901.1| hypothetical protein H310_04008 [Aphanomyces invadans]
Length=281

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 93/144 (65%), Gaps = 1/144 (1%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            C+I R         QPRIL +  SPD   QY+AIMN IFSAQ+  VPIDSC +  + SAF
Sbjct  120  CFINRAMNES-RELQPRILIVDSSPDFAEQYIAIMNCIFSAQKKRVPIDSCVLATEPSAF  178

Query  517  LQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNTI  338
            LQQASY+T G+Y KP+   GL QY  T++  D  +R  L LP    VDFRA CFCHK TI
Sbjct  179  LQQASYLTGGLYFKPKERQGLVQYFLTIWLADTDTRQMLKLPTQASVDFRAMCFCHKQTI  238

Query  337  DMGYICSVCLSIFCKHQPQCSTCG  266
               ++C VCLS+FC+  P CSTCG
Sbjct  239  STAFVCPVCLSLFCEFSPVCSTCG  262



>ref|XP_003323260.2| hypothetical protein PGTG_04797 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP78841.2| hypothetical protein PGTG_04797 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=322

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -1

Query  715  SLSMALCYIQRVFRSGPLHPQ---PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +L+ ALC+I R+ R      +    RIL L  S D PGQY+ +MN IFSAQ+S +PID C
Sbjct  135  ALAKALCHINRLARENENKKESLKARILILSVSSDAPGQYIPMMNCIFSAQKSTIPIDVC  194

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  +++ FLQQA+++T G+Y + +    + QYL+ +F   L +R FL+LP+   VDFRA
Sbjct  195  KISKENAVFLQQAAHLTEGIYYQIEKPKAILQYLTMIFLPGLAARKFLNLPKHQEVDFRA  254

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +CFCH+  ID+GY+CSVCLSIFC   P CSTC + F
Sbjct  255  ACFCHREIIDVGYVCSVCLSIFCTPTPVCSTCRTKF  290



>ref|XP_007415046.1| hypothetical protein MELLADRAFT_110826 [Melampsora larici-populina 
98AG31]
 gb|EGG01701.1| hypothetical protein MELLADRAFT_110826 [Melampsora larici-populina 
98AG31]
Length=316

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHP---QPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
             +L+ ALC+I RV +         +PRIL +  SPD PGQY+ +MN IFSAQ+S +PID 
Sbjct  131  NALAKALCHINRVTKEETRPKDSLKPRILIISISPDSPGQYIPMMNCIFSAQKSCIPIDV  190

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C I  + + FLQQASY+TNG+Y + +    L QYL+ +F   +  R  L+LP+   VD R
Sbjct  191  CKITGEDAVFLQQASYLTNGIYYRLEKPKALIQYLTMIFLPGVSIRKSLNLPQQEEVDLR  250

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFC   P CSTC + F
Sbjct  251  AACFCHRKIIDLGYVCSVCLSIFCTPIPVCSTCRTKF  287



>gb|EPS73731.1| hypothetical protein M569_01027, partial [Genlisea aurea]
Length=208

 Score =   159 bits (401),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 83/90 (92%), Gaps = 1/90 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SGSLSMALCYIQR+FR+G  HPQPRILCLHGSPDGPGQY+AIMNSIFSAQR MVPIDSC 
Sbjct  118  SGSLSMALCYIQRIFRTGNRHPQPRILCLHGSPDGPGQYIAIMNSIFSAQRLMVPIDSCL  177

Query  541  IGAQHSAFLQQASYITNGVYLKPQI-LDGL  455
            +GA+HSAFLQQAS+IT GVYLKPQI  DGL
Sbjct  178  VGAEHSAFLQQASHITRGVYLKPQIPPDGL  207



>ref|XP_643618.1| general transcription factor IIH, polypeptide 3 [Dictyostelium 
discoideum AX4]
 sp|Q86IB5.1|TF2H3_DICDI RecName: Full=General transcription factor IIH subunit 3; AltName: 
Full=TFIIH basal transcription factor complex subunit 
3 [Dictyostelium discoideum]
 gb|EAL69509.1| general transcription factor IIH, polypeptide 3 [Dictyostelium 
discoideum AX4]
Length=372

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = -1

Query  706  MALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQH  527
            +ALCYI R+ R  P   +PRIL  + SPD   QY+++MN IFS+Q+  +P+DSC +    
Sbjct  196  IALCYINRIKRETPT-IKPRILVFNISPDVSSQYISVMNCIFSSQKQSIPVDSCILSQSD  254

Query  526  SAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHK  347
            S FLQQAS++T+G+YLKPQ  + L QYL T F  D  SR  L  P    VD+RASCFCHK
Sbjct  255  STFLQQASHLTSGIYLKPQKQELLSQYLLTTFLLDTLSRKSLAYPTLKSVDYRASCFCHK  314

Query  346  NTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
              +D+GY+CSVCLSIFC H   CSTCG+ F 
Sbjct  315  RIVDIGYVCSVCLSIFCGHSSSCSTCGTKFS  345



>gb|KFH63921.1| hypothetical protein MVEG_09746 [Mortierella verticillata NRRL 
6337]
Length=318

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 103/157 (66%), Gaps = 1/157 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS-GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            + SLS+ LCYI +  +S G  H +PRIL L  SPD    Y+ IMN IFSAQ++ +PID C
Sbjct  129  AASLSLGLCYINQALKSDGMGHVKPRILVLTVSPDSSSDYIPIMNCIFSAQKANIPIDVC  188

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  + + FLQQA++IT G+Y++     GL Q L   F  D+ SR +L LP    VDFRA
Sbjct  189  KIWGEDAVFLQQAAHITEGIYIRLDDPHGLLQILMFSFLPDMFSRNYLCLPGQDQVDFRA  248

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFG  254
            +CFCHK  +D+GY+CSVCLSIFC   P CSTC + F 
Sbjct  249  ACFCHKKIVDIGYVCSVCLSIFCSFSPVCSTCRTKFA  285



>ref|XP_009529831.1| hypothetical protein PHYSODRAFT_508027 [Phytophthora sojae]
 gb|EGZ16082.1| hypothetical protein PHYSODRAFT_508027 [Phytophthora sojae]
Length=298

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            + SLS ALC+I R     P   +PRIL +  SPD    Y+AIMN IFSAQ+  V +D+C 
Sbjct  128  AASLSRALCFINRAINEEP-DLRPRILVVQKSPDVSEHYIAIMNGIFSAQKKSVAVDACI  186

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  +HS+F+QQA+Y+T G+Y KP    GL QYL +++  D   R  L LP    VDFRA 
Sbjct  187  LANEHSSFMQQAAYLTGGIYYKPNDHSGLLQYLISIYLPDPSMRKLLKLPSQDSVDFRAM  246

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCH+  I   Y+C VCLS+FC+ +P CSTCG
Sbjct  247  CFCHREVISTAYVCPVCLSLFCEFRPICSTCG  278



>ref|XP_002908844.1| general transcription factor IIH subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY57658.1| general transcription factor IIH subunit, putative [Phytophthora 
infestans T30-4]
Length=293

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            + SLS +LC+I R     P   +PRIL +  SPD    Y+AIMN IFSAQ+  V +D+C 
Sbjct  123  AASLSRSLCFINRAINEEP-DLRPRILVIQKSPDVSEHYIAIMNGIFSAQKKSVAVDACI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  +HS+F+QQA+Y+T G+Y KP    GL QYL +++  D   R  L LP    VDFRA 
Sbjct  182  LATEHSSFMQQAAYLTGGIYYKPNDHSGLLQYLISIYLPDPSMRKLLKLPSQDSVDFRAM  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCH+  I   Y+C VCLS+FC+ +P CSTCG
Sbjct  242  CFCHREVISTAYVCPVCLSLFCEFRPICSTCG  273



>gb|ETI47842.1| hypothetical protein F443_07986 [Phytophthora parasitica P1569]
Length=293

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            + SLS +LC+I R     P   +PRIL +  SPD    Y+AIMN IFSAQ+  V +D+C 
Sbjct  123  AASLSRSLCFINRAINEEP-DLRPRILVIQKSPDVSEHYIAIMNGIFSAQKKNVAVDACI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  +HS+F+QQA+Y+T G+Y KP    GL QYL +++  D   R  L LP    VDFRA 
Sbjct  182  LSTEHSSFMQQAAYLTGGIYYKPNDHSGLLQYLISIYLPDPSMRKLLKLPSQDSVDFRAM  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCH+  I   Y+C VCLS+FC+ +P CSTCG
Sbjct  242  CFCHREVISTAYVCPVCLSLFCEFRPICSTCG  273



>ref|XP_008904731.1| hypothetical protein PPTG_10953 [Phytophthora parasitica INRA-310]
 gb|ETK87829.1| hypothetical protein L915_07812 [Phytophthora parasitica]
 gb|ETL41249.1| hypothetical protein L916_07742 [Phytophthora parasitica]
 gb|ETM47636.1| hypothetical protein L914_07705 [Phytophthora parasitica]
 gb|ETN10294.1| hypothetical protein PPTG_10953 [Phytophthora parasitica INRA-310]
 gb|ETO76617.1| hypothetical protein F444_08029 [Phytophthora parasitica P1976]
 gb|ETP17670.1| hypothetical protein F441_07955 [Phytophthora parasitica CJ01A1]
 gb|ETP45727.1| hypothetical protein F442_07922 [Phytophthora parasitica P10297]
Length=293

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            + SLS +LC+I R     P   +PRIL +  SPD    Y+AIMN IFSAQ+  V +D+C 
Sbjct  123  AASLSRSLCFINRAINEEP-DLRPRILVIQKSPDVSEHYIAIMNGIFSAQKKNVAVDACI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  +HS+F+QQA+Y+T G+Y KP    GL QYL +++  D   R  L LP    VDFRA 
Sbjct  182  LSTEHSSFMQQAAYLTGGIYYKPNDHSGLLQYLISIYLPDPSMRKLLKLPSQDSVDFRAM  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCH+  I   Y+C VCLS+FC+ +P CSTCG
Sbjct  242  CFCHREVISTAYVCPVCLSLFCEFRPICSTCG  273



>emb|CCA24938.1| general transcription factor IIH subunit putative [Albugo laibachii 
Nc14]
Length=288

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = -1

Query  700  LCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSA  521
            LC + RV +       PRI  +  SPD P  Y++IMNSIFSAQ+  V ID+C +  +HS 
Sbjct  125  LCCMNRVLKENA-QLCPRIFVIQRSPDVPEHYISIMNSIFSAQKKTVAIDACILSEEHSP  183

Query  520  FLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKNT  341
            F+QQA+Y+T G+Y KP+++DGL QYL T++  D + R  L  P    VDFRA CFCHK  
Sbjct  184  FMQQATYLTGGIYYKPRVIDGLLQYLITLYLPDPNMRKMLRFPSQESVDFRAMCFCHKKA  243

Query  340  IDMGYICSVCLSIFCKHQPQCSTCG  266
            +   ++C VCLS+FC+ QP CSTCG
Sbjct  244  VSTAFVCPVCLSLFCQFQPICSTCG  268



>gb|KEH34828.1| general transcription factor IIH subunit, putative [Medicago 
truncatula]
Length=226

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            SG+LSMALCYIQR FRSGP+HPQPRILCL GS DGP QYVAIMN+IFSAQRS+VP+DSC 
Sbjct  124  SGALSMALCYIQRAFRSGPMHPQPRILCLQGSTDGPEQYVAIMNAIFSAQRSVVPVDSCF  183

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLS  440
            IG+ +SAFLQQASYIT G+Y +P  ++GLFQYLS
Sbjct  184  IGSNNSAFLQQASYITGGIYYRPPQMEGLFQYLS  217



>emb|CCI50237.1| unnamed protein product [Albugo candida]
Length=284

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = -1

Query  703  ALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHS  524
             LC + RV + G     PRI  +  SPD P  Y++IMNSIFSAQ+  V ID+C +  +HS
Sbjct  122  GLCCMNRVLK-GNADLFPRIFVIQRSPDVPEHYISIMNSIFSAQKKNVAIDACILSQEHS  180

Query  523  AFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRASCFCHKN  344
             F+QQA+Y+T G+Y KP+++DGL QYL T++  D + R     P    VDFRA CFCHK 
Sbjct  181  PFMQQATYLTGGIYYKPRLIDGLLQYLITLYLPDPNVRKMFRFPSQESVDFRAMCFCHKK  240

Query  343  TIDMGYICSVCLSIFCKHQPQCSTCG  266
             +   Y+C VCLS+FC+ QP CSTCG
Sbjct  241  AVSTAYVCPVCLSLFCQFQPICSTCG  266



>gb|ETL94412.1| hypothetical protein L917_07627 [Phytophthora parasitica]
Length=293

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            + SLS +LC+I R     P   +PRIL +  SPD    Y+AIMN IFSAQ+  V +D+C 
Sbjct  123  AASLSRSLCFINRAINEEP-DLRPRILVIQKSPDVSEHYIAIMNGIFSAQKKNVAVDACI  181

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            +  +HS+F+QQA+Y+T G+Y KP    GL QYL +++  D   R  L LP    VDFRA 
Sbjct  182  LSMEHSSFMQQAAYLTGGIYYKPNDHSGLLQYLISIYLPDPSMRKLLKLPSQDSVDFRAM  241

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCG  266
            CFCH+  I   Y+C VCLS+FC+ +P CSTCG
Sbjct  242  CFCHREVISTAYVCPVCLSLFCEFRPICSTCG  273



>ref|XP_002676214.1| predicted protein [Naegleria gruberi]
 gb|EFC43470.1| predicted protein [Naegleria gruberi]
Length=346

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 102/155 (66%), Gaps = 2/155 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL--HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+LSMALC+I R+ +  PL      RIL    SPD   QY+++MN+IFSA++  + +D+
Sbjct  178  SGALSMALCFINRLEKEKPLGMSLNSRILTFQVSPDISSQYISVMNAIFSAEKMSIMLDA  237

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S FLQQA ++T G YLKPQ  +GL QYL T+F  +   R+++ LP    VDFR
Sbjct  238  CVLSNDDSTFLQQACFLTGGNYLKPQRQEGLIQYLLTIFMLEKSLRSYIQLPVQNTVDFR  297

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGS  263
            ASCF  +  ID GY+C VCLSIF  H+P CSTC S
Sbjct  298  ASCFETRKPIDDGYVCPVCLSIFSSHKPVCSTCAS  332



>gb|KCW63476.1| hypothetical protein EUGRSUZ_G01112 [Eucalyptus grandis]
Length=312

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  697  CYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCAIGAQHSAF  518
            CYIQRVFRSGP HP PRILCLHGS DGP QYVAIMN+IFSAQRSMVPIDSC IGAQ+SAF
Sbjct  130  CYIQRVFRSGPRHPHPRILCLHGSQDGPEQYVAIMNAIFSAQRSMVPIDSCFIGAQNSAF  189

Query  517  LQQASYITNGVYLKPQILDGLFQYLS  440
            LQQASYIT GVYLKPQ+L+G FQYLS
Sbjct  190  LQQASYITGGVYLKPQLLEGTFQYLS  215



>gb|KIJ19132.1| hypothetical protein PAXINDRAFT_109674 [Paxillus involutus ATCC 
200175]
Length=321

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 110/190 (58%), Gaps = 15/190 (8%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGP----------LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQR  569
            G+L+ A+CYI R+ R  P          + P PRIL L  SPD    Y+ IMNSIFSAQ+
Sbjct  121  GALTKAVCYINRISRPSPSATNIAEDPAVLPDPRILILSVSPDLSSSYIPIMNSIFSAQK  180

Query  568  SMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPR  389
              V ID C +    + FLQQA+++TNG Y+  +  D L QYL   F +    R  L +P+
Sbjct  181  LKVTIDVCKLYGPDAVFLQQAAHLTNGSYIYLERRDALLQYLIMSFLSPPSVRKVLAVPK  240

Query  388  PVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF-----GKARGQEPAAP  224
               +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F      +     PA P
Sbjct  241  QDKIDFRAACFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKFPIKTLQRLSAARPAPP  300

Query  223  *DHKKRHWLM  194
              + +   L+
Sbjct  301  PTNPRNSLLL  310



>ref|XP_003074271.1| basal transcription factor complex subunit-related (ISS) [Ostreococcus 
tauri]
Length=319

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQR---VFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPID  551
            +G+LS+ALCY  R   +  +  L  +PRILCL  S D P  Y+ +MN+IFSAQR  +P+D
Sbjct  154  AGALSLALCYCNRAQALENAAGLRSKPRILCLQASQDNPTDYIPMMNAIFSAQRQSIPVD  213

Query  550  SCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDF  371
            + A+G   S F+QQA++IT G Y+KP + DGL QYL +    DL SRAFL LP+     F
Sbjct  214  AFALGEHDSPFMQQAAHITRGAYVKPTLGDGLLQYLLSTAVMDLRSRAFLKLPQAKASTF  273

Query  370  RASCFCHKNTIDM-GYICSVCLSIFCKHQPQCSTCGSVF  257
            RAS            ++CSVCLS+FC  +P C TCG+ F
Sbjct  274  RASVLLPTTARQASAFVCSVCLSVFCDGRPACDTCGTTF  312



>emb|CEP17684.1| hypothetical protein [Parasitella parasitica]
Length=320

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR-SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCYI RV +     H +PRIL L  SPD   QY+ +MN IFSAQ++ +P+D C
Sbjct  150  TGALSMALCYINRVTKLDDEGHIKPRILVLSVSPDSAYQYIPLMNCIFSAQKASIPLDVC  209

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  + +AFLQQAS IT GVY+K +    L +YL   F  D +SR +L+LP    VDFRA
Sbjct  210  KIFGEETAFLQQASNITGGVYVKMENRQALLEYLMMAFLPDRYSRNYLNLPTQDQVDFRA  269

Query  364  SCFCHKNTIDMGYICSVCLS  305
            +CFCHK  +D+G++CSVCLS
Sbjct  270  ACFCHKKIVDIGFVCSVCLS  289



>gb|EWM26854.1| general transcription factor iih [Nannochloropsis gaditana]
Length=394

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S +LS +LCYIQR  R  P     R+L L  S D  G Y A MN  FSAQRS VPID+  
Sbjct  220  SQALSKSLCYIQRALRESP-SLSARMLVLQASADAHGDYNAFMNCTFSAQRSSVPIDAAV  278

Query  541  IGA-----QHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGV  377
              +     + S+FLQQASYIT GVY++P   + L QY   +F    H R  L LP+   V
Sbjct  279  FSSPASVHKDSSFLQQASYITGGVYVRPDRPEALLQYFLHLFLPSHHLRQALRLPKQESV  338

Query  376  DFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGS  263
            DFRA+CFCH+  ++  Y+CSVCLSIFC   P+C+TCG+
Sbjct  339  DFRAACFCHRKAVEQAYVCSVCLSIFCAFAPECATCGT  376



>gb|EWM26855.1| general transcription factor iih [Nannochloropsis gaditana]
Length=393

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            S +LS +LCYIQR  R  P     R+L L  S D  G Y A MN  FSAQRS VPID+  
Sbjct  219  SQALSKSLCYIQRALRESP-SLSARMLVLQASADAHGDYNAFMNCTFSAQRSSVPIDAAV  277

Query  541  IGA-----QHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGV  377
              +     + S+FLQQASYIT GVY++P   + L QY   +F    H R  L LP+   V
Sbjct  278  FSSPASVHKDSSFLQQASYITGGVYVRPDRPEALLQYFLHLFLPSHHLRQALRLPKQESV  337

Query  376  DFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGS  263
            DFRA+CFCH+  ++  Y+CSVCLSIFC   P+C+TCG+
Sbjct  338  DFRAACFCHRKAVEQAYVCSVCLSIFCAFAPECATCGT  375



>gb|EXX76110.1| Tfb4p [Rhizophagus irregularis DAOM 197198w]
Length=276

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL-HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCY  R+ R+  + H +PRIL +  SPD P QY++IMN IFSAQ+  +PID C
Sbjct  132  AGALSMALCYTNRIMRADEIGHIKPRILIISISPDSPYQYISIMNCIFSAQKLGIPIDVC  191

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             + ++ + FL+QA+++T G YLK QI  G  Q+L   F  D  +R +  LP    VDF A
Sbjct  192  KVHSEETVFLKQAAHLTGGRYLKLQIPQGFLQFLMITFLPDRFTRNYQCLPGEEKVDFSA  251

Query  364  SCFCHKNTIDMGYICSVCLS  305
            SCFCHK  ID+GY+CSVCLS
Sbjct  252  SCFCHKKMIDIGYVCSVCLS  271



>ref|XP_011448626.1| PREDICTED: general transcription factor IIH subunit 3-like [Crassostrea 
gigas]
Length=269

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 9/160 (6%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQP-----RILCLHGSPDGPGQYVAIMNSIFSAQRSMVP  557
            +G+L+MALC+I +  RS   H +      RIL + GS D   QY+ +MN++F+AQ+  V 
Sbjct  97   AGALAMALCHINKTERS---HEEAGILSSRILVIKGSEDNTEQYMNLMNAVFTAQKQNVV  153

Query  556  IDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGV  377
            ID+C +  + S  LQQA  IT G+YLK   + GL QYL  VF  D   R  L LP  V V
Sbjct  154  IDACVLDNE-SGLLQQACDITGGIYLKIPQMKGLLQYLMWVFLPDPLERPKLTLPPKVQV  212

Query  376  DFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            D+RA+CFCH+N ID+GY+CSVCLSIFC   P C TC + F
Sbjct  213  DYRAACFCHRNLIDIGYVCSVCLSIFCAFSPICGTCQTTF  252



>gb|ETN62327.1| TFIIH basal transcription factor complex p34 subunit [Anopheles 
darlingi]
Length=288

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+ P       R+L + GS +   QY+  MN  F+AQ+  V +D 
Sbjct  116  AGSMSMALCYIARINRNKPPGSKINSRVLVVTGSNECASQYMTYMNVFFTAQKQGVVVDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+ + LDG  QYL  VF  D   R  L LP PV VD+R
Sbjct  176  CALDKALS-LLQQGCDITGGQYLRLEQLDGFLQYLLWVFLPDPQMRCKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  235  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  271



>gb|KDQ21367.1| hypothetical protein BOTBODRAFT_25802 [Botryobasidium botryosum 
FD-172 SS1]
Length=322

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 100/163 (61%), Gaps = 9/163 (6%)
 Frame = -1

Query  718  GSLSMALCYIQRVFR---------SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRS  566
            G+L+ ALC+I R+           + P  P PRIL    SPD    Y+ +MNSIFSAQ+ 
Sbjct  130  GALTKALCHINRLTHPTASANPSIAVPTPPNPRILIFSVSPDLSTAYIPLMNSIFSAQKL  189

Query  565  MVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRP  386
             V ID C +  + + FLQQA+++T G+Y+ P+  D L QYL+  F      R  L +P  
Sbjct  190  KVAIDVCKLYGEDTVFLQQAAHLTGGLYVNPERRDALLQYLAMCFLPSTAIRRVLGMPTQ  249

Query  385  VGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
              VDFRA+CFCHKN ID+GYICSVCLSIFC   P CSTC + F
Sbjct  250  DHVDFRAACFCHKNIIDIGYICSVCLSIFCSPVPVCSTCRTKF  292



>ref|XP_001662634.1| AAEL012523-PA [Aedes aegypti]
 gb|EAT35304.1| AAEL012523-PA [Aedes aegypti]
Length=288

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI RV R+ P  +    RIL + GS +   QY+  MN  F+AQ+  V +D 
Sbjct  116  AGSMAMALCYIARVHRNKPAGVKINSRILVVTGSNECASQYMTYMNVFFTAQKQNVSLDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YLK   LDG  QYL  VF  +  +R  L LP PV VD+R
Sbjct  176  CALDKPLS-LLQQGCDITGGQYLKLPQLDGFLQYLLWVFLPEPLTRCKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  235  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  271



>dbj|GAA93863.1| hypothetical protein E5Q_00509 [Mixia osmundae IAM 14324]
 gb|KEI42800.1| hypothetical protein L969DRAFT_608417 [Mixia osmundae IAM 14324]
Length=331

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 104/173 (60%), Gaps = 11/173 (6%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHP-QPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
             +L+  LC+I R+ R    H  +PR+L L  S D   QY+ +MN IFSAQ++ VPID C 
Sbjct  132  SALARTLCHINRISREETKHTIKPRVLLLSVSHDSSSQYIPLMNCIFSAQKANVPIDVCK  191

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            I    + FLQQA+Y+++G+Y K +   GL QYL   F   + SR  L+LP    VD RA+
Sbjct  192  IYGDDAVFLQQAAYLSSGIYYKLEKRAGLLQYLMMTFLPGVTSRKLLNLPSQDAVDLRAA  251

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSV----------FGKARGQEP  233
            CFCH+  +D+G++CSVCLSIFC  +P C TC +           FG A+G  P
Sbjct  252  CFCHQRIVDIGFVCSVCLSIFCTPRPSCLTCRTKFPLSTLKRLGFGPAKGNAP  304



>ref|XP_005189282.1| PREDICTED: general transcription factor IIH subunit 3 [Musca 
domestica]
Length=294

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCY+ R+ R+    +    RIL L GS +   QY+  MN  F+AQ+  + ID 
Sbjct  123  AGSMSMALCYVARMQRNAQPGVKIHSRILVLTGSNECASQYMTYMNVFFTAQKLGIVIDV  182

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+   LDGL QYL  VF  D  +R  L LP P  VD+R
Sbjct  183  CALDKSLS-LLQQGCDITGGQYLRLTQLDGLLQYLLWVFLPDPKTRQMLVLPPPTKVDYR  241

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  242  AACFCHREMIDIGYVCSVCLSIFCKFSPICTTCHTVF  278



>gb|KIK26971.1| hypothetical protein PISMIDRAFT_675275 [Pisolithus microcarpus 
441]
Length=332

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 100/164 (61%), Gaps = 10/164 (6%)
 Frame = -1

Query  718  GSLSMALCYIQRV---------FRSGPLH-PQPRILCLHGSPDGPGQYVAIMNSIFSAQR  569
            G+L+ ALCYI R+            G  H P PRIL L  SPD    Y+ IMN+IFSAQ+
Sbjct  124  GALTKALCYINRITLPSTSSTNVAEGSTHLPDPRILILSVSPDLSSSYIPIMNAIFSAQK  183

Query  568  SMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPR  389
              V ID C I    + FLQQA+++TNG Y+  +  D L QYL   F      R  L +PR
Sbjct  184  LKVTIDVCKIYGADTVFLQQAAHLTNGSYIYLERRDALLQYLIMSFLPPPLVRKVLTVPR  243

Query  388  PVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
               +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  244  QDKIDFRAACFCHKNIVDVGFVCSVCLSIFCQPVPVCSTCRTKF  287



>ref|XP_011142778.1| PREDICTED: general transcription factor IIH subunit 3 [Harpegnathos 
saltator]
 gb|EFN89365.1| General transcription factor IIH subunit 3 [Harpegnathos saltator]
Length=292

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 101/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSG----PLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LSMALCYI R+ R       LHP  RIL +  S D   QY+  MN  F+AQ+  V +
Sbjct  116  SGALSMALCYIARLERDKVAGQKLHP--RILVITASNDSATQYMNYMNIFFTAQKMNVIL  173

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   IT G YLK   L GL QYL  VF  D + R+ L LP PV VD
Sbjct  174  DVCSLD-QELTLLQQGCDITGGNYLKVPQLAGLLQYLLWVFLPDPNVRSKLVLPPPVKVD  232

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH+  ID+GY+CS+CLS+FCK  P C+TC +VF
Sbjct  233  YRAACFCHQELIDIGYVCSICLSVFCKFSPICTTCHTVF  271



>ref|XP_011063092.1| PREDICTED: general transcription factor IIH subunit 3 [Acromyrmex 
echinatior]
 gb|EGI60141.1| General transcription factor IIH subunit 3 [Acromyrmex echinatior]
Length=292

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSG----PLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LSMALCYI R+ R       LHP  R+L +  S D   QY+  MN  F+AQR  V +
Sbjct  116  SGALSMALCYIARLEREKVAGQKLHP--RMLVITASNDSATQYMNYMNIFFTAQRMNVIL  173

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   IT G YLK   L GL QYL  VF  D   R+ L LP PV VD
Sbjct  174  DVCSLD-QELTLLQQGCDITGGNYLKVPQLAGLLQYLLWVFLPDPSVRSKLVLPPPVKVD  232

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  233  YRAACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_010091384.1| General transcription factor IIH subunit 3 [Morus notabilis]
 gb|EXB44374.1| General transcription factor IIH subunit 3 [Morus notabilis]
Length=236

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 80/99 (81%), Gaps = 5/99 (5%)
 Frame = -1

Query  643  LCLHGSPDGPGQ-----YVAIMNSIFSAQRSMVPIDSCAIGAQHSAFLQQASYITNGVYL  479
            LC  GS +G        YVAIMN+IFSAQRSMVPIDSC +G+ +SAFLQQASYIT GVYL
Sbjct  107  LCKEGSENGLASSLLSGYVAIMNAIFSAQRSMVPIDSCYLGSNNSAFLQQASYITGGVYL  166

Query  478  KPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            KPQ  DGLFQYLSTVFATDLHSR FL LP+ VGVDFRAS
Sbjct  167  KPQQPDGLFQYLSTVFATDLHSRTFLQLPKSVGVDFRAS  205



>gb|KIO09913.1| hypothetical protein M404DRAFT_130737 [Pisolithus tinctorius 
Marx 270]
Length=331

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 100/163 (61%), Gaps = 9/163 (6%)
 Frame = -1

Query  718  GSLSMALCYIQRV--------FRSGPLH-PQPRILCLHGSPDGPGQYVAIMNSIFSAQRS  566
            G+L+ ALCYI R+           G  + P PRIL L  SPD    Y+ IMN+IFSAQ+ 
Sbjct  124  GALTKALCYINRITLPSISTSVAEGSTNVPDPRILILSVSPDLSSSYIPIMNAIFSAQKL  183

Query  565  MVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRP  386
             V ID C I    + FLQQA+++TNG Y+  +  D L QYL   F      R  L +PR 
Sbjct  184  KVTIDVCKIYGPDTVFLQQAAHLTNGSYIFLERRDALLQYLIMSFLPPPSVRKVLAVPRQ  243

Query  385  VGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
              +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  244  DKIDFRAACFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  286



>ref|XP_002003554.1| GI21952 [Drosophila mojavensis]
 gb|EDW12996.1| GI21952 [Drosophila mojavensis]
Length=299

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+ P  +    RIL + GS +   QY+  MN  F+AQ+  + +D+
Sbjct  125  AGSMSMALCYISRLQRNVPAGVKMHSRILVITGSNECASQYMTFMNVFFTAQKLGIVVDT  184

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   ITNG +LK   LDGL QYL  VF      R  L LP    VD+R
Sbjct  185  CALDKTLS-LLQQGCDITNGQFLKVNQLDGLLQYLLWVFLPSPQMRHKLVLPPTPKVDYR  243

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  244  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  280



>ref|XP_010220468.1| PREDICTED: general transcription factor IIH subunit 3 [Tinamus 
guttatus]
Length=267

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +   G    + RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKGNQEIRSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVLHMPSLLQYLLWVFLPDQEQRAQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_011160004.1| PREDICTED: general transcription factor IIH subunit 3 [Solenopsis 
invicta]
Length=292

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSG----PLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LSMALCYI R+ R       LHP  RIL +  S D   QY+  MN  F+AQR  V +
Sbjct  116  SGALSMALCYIARLEREKVAGQKLHP--RILVITASNDSATQYMNYMNIFFTAQRMNVIL  173

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   I+ G YLK   L GL QYL  VF  D   R  L LP PV VD
Sbjct  174  DVCSLD-QELTLLQQGCDISGGNYLKVPQLAGLLQYLLWVFLPDPSVRLKLVLPPPVKVD  232

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  233  YRAACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_001968252.1| GG24611 [Drosophila erecta]
 gb|EDV57311.1| GG24611 [Drosophila erecta]
Length=299

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS-GP-LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+  P +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMSMALCYISRLQRNVAPGVKMHSRILVLTGSNECASQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   LDGL QYL  VF    H R  L LP P  VD+R
Sbjct  184  CALNKTLS-LLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPHIRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  279



>ref|XP_005100664.1| PREDICTED: general transcription factor IIH subunit 3-like [Aplysia 
californica]
Length=302

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +G++ MALCYI R+ +  P+      RIL L GS D P QY+  MN++F+AQ+  V ID+
Sbjct  131  AGAMCMALCYIHRLEKECPIGESLTARILILKGSDDCPSQYMNFMNAVFTAQKQNVVIDA  190

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + ++ S  LQQA  IT G YL      GL QYL  VF  D  SR+ + LP    VD+R
Sbjct  191  CILDSE-SGLLQQACDITGGTYLNIPQAQGLLQYLLWVFLPDPSSRSKMALPPRAQVDYR  249

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSI+C   P CSTC + F
Sbjct  250  AACFCHRNLIEIGYVCSVCLSIYCSFSPICSTCQTTF  286



>ref|XP_001988455.1| GH10566 [Drosophila grimshawi]
 gb|EDW03322.1| GH10566 [Drosophila grimshawi]
Length=300

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR--SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R  +  +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  125  AGSMSMALCYISRLQRNVAAGVKMHSRILVLTGSNECASQYMTYMNVFFTAQKLSIVIDA  184

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  185  CALDKTLS-LLQQGCDITSGQFLKVTQLDGLLQYLLWVFMPSPQMRHKLVLPPPPKVDYR  243

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  244  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  280



>gb|KIM45246.1| hypothetical protein M413DRAFT_39084, partial [Hebeloma cylindrosporum 
h7]
Length=286

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 98/161 (61%), Gaps = 7/161 (4%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHPQ-------PRILCLHGSPDGPGQYVAIMNSIFSAQRSMV  560
            G+L+ ALCYI R+       P        PRIL L  SPD    Y+ IMN+IFSAQ+  V
Sbjct  113  GALTKALCYINRISLGASTAPDAQHGLTDPRILILSVSPDLSTSYIPIMNAIFSAQKLKV  172

Query  559  PIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVG  380
             ID+C I    + FLQQA+++T G YL  +  D L QYL   F   L  R  L +P    
Sbjct  173  SIDACQIFGPDTVFLQQAAHLTGGSYLHLEHRDALLQYLIMSFLPPLAIRKVLAVPTQDK  232

Query  379  VDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  233  IDFRAACFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  273



>ref|XP_009641428.1| PREDICTED: general transcription factor IIH subunit 3 [Egretta 
garzetta]
Length=267

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +   ++ +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKVNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRAQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_010015384.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Nestor notabilis]
Length=267

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            GSL+ ALCYI ++ +   G    + RIL +  + D   QY+  MN IF+AQ+  V ID+C
Sbjct  94   GSLAKALCYINKMSKDVKGNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDAC  153

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+RA
Sbjct  154  VLDSD-SGLLQQACDITGGIYLKVLHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYRA  212

Query  364  SCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  213  ACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_005498319.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Columba livia]
Length=267

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINRMSKEVKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLESD-SGLLQQACDITGGIYLKVLHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_007489992.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Monodelphis domestica]
Length=268

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  94   AGSLAKALCYIHRMSKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNIVIDA  153

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + A  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L+LP P+ VD+R
Sbjct  154  CVLDAD-SGLLQQACDITGGIYLKVPQMPSLLQYLLWVFLPDQDQRSQLNLPPPIHVDYR  212

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  213  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  249



>ref|XP_009995910.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Chaetura pelagica]
Length=267

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI +V +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKVSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_002052933.1| GJ17829 [Drosophila virilis]
 gb|EDW65088.1| GJ17829 [Drosophila virilis]
Length=300

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR--SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R  +  +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  125  AGSMSMALCYISRLQRNVAAGVKMHSRILVLTGSNECASQYMTYMNVFFTAQKLGIVIDT  184

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   ITNG +LK   LDGL QYL  VF      R  L LP    VD+R
Sbjct  185  CALDKTLS-LLQQGCDITNGQFLKVTQLDGLLQYLLWVFLPSPQMRHKLVLPPTPKVDYR  243

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  244  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  280



>gb|KFB35291.1| hypothetical protein ZHAS_00001517 [Anopheles sinensis]
Length=562

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+         R+L + GS +   QY+  MN  F+AQ+  V ID 
Sbjct  390  AGSMSMALCYIARINRNKAPGAKINARVLVVTGSNECASQYMTYMNVFFTAQKQGVVIDV  449

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+ + LDG  QYL  VF  D   R  L LP PV VD+R
Sbjct  450  CALDKALS-LLQQGCDITGGQYLRLEQLDGFLQYLLWVFLPDPQMRCKLVLPPPVKVDYR  508

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  509  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  545



>ref|XP_008491568.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Calypte anna]
Length=267

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANEEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_010718381.1| PREDICTED: general transcription factor IIH subunit 3 [Meleagris 
gallopavo]
Length=267

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   L  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHLPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_011178395.1| PREDICTED: general transcription factor IIH subunit 3 [Bactrocera 
cucurbitae]
 ref|XP_011178396.1| PREDICTED: general transcription factor IIH subunit 3 [Bactrocera 
cucurbitae]
Length=292

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+ R+    +    RIL + GS +   QY+  MN  F+AQ+  + ID 
Sbjct  121  AGSMAMALCYISRIQRNAAAGVKLHSRILVVTGSNECASQYMTYMNVFFTAQKLGITIDV  180

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+   LDGL QYL  VF  D   R  L LP  + VD+R
Sbjct  181  CAMDKTMS-LLQQGCDITGGQYLRLTQLDGLLQYLLWVFLPDPQMRQKLVLPPAIKVDYR  239

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  240  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  276



>ref|XP_010159847.1| PREDICTED: general transcription factor IIH subunit 3 [Eurypyga 
helias]
Length=266

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    H +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  92   AGSLAKALCYINKMSKEVKDHQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  151

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  152  CVLDSD-SGLLQQACDITGGLYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  210

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  211  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  247



>ref|XP_005016337.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Anas platyrhynchos]
 ref|XP_005016338.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Anas platyrhynchos]
Length=267

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRAQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009664928.1| PREDICTED: general transcription factor IIH subunit 3 [Struthio 
camelus australis]
 ref|XP_009664929.1| PREDICTED: general transcription factor IIH subunit 3 [Struthio 
camelus australis]
Length=267

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +   G    + RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKGNQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVLHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_010197275.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Colius striatus]
Length=266

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  92   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  151

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  152  CVLDSD-SGLLQQACDITGGIYLKVPHMSSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  210

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  211  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  247



>ref|XP_316918.4| AGAP008522-PA [Anopheles gambiae str. PEST]
 gb|EAA12181.5| AGAP008522-PA [Anopheles gambiae str. PEST]
Length=288

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+         R+L + GS +   QY+  MN  F+AQ+  V +D 
Sbjct  116  AGSMSMALCYIARINRNKAPGSKINSRVLVVTGSNECASQYMTYMNVFFTAQKQGVVVDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+ + L+G  QYL  VF  D   R  L LP PV VD+R
Sbjct  176  CALDKALS-LLQQGCDITGGQYLRLEQLEGFLQYLLWVFLPDPQMRCKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  235  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  271



>ref|XP_007844054.1| rna polymerase ii transcription factor b subunit 4 [Moniliophthora 
roreri MCA 2997]
 gb|ESK96580.1| rna polymerase ii transcription factor b subunit 4 [Moniliophthora 
roreri MCA 2997]
Length=317

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 99/167 (59%), Gaps = 13/167 (8%)
 Frame = -1

Query  718  GSLSMALCYIQR---------VFRSGPLHP----QPRILCLHGSPDGPGQYVAIMNSIFS  578
            G+L+ ALCYI R         +  S  L P     PRIL L  SPD    Y+ IMNSIFS
Sbjct  113  GALTKALCYINRLTVEANATTINSSEALEPIALPDPRILILSVSPDLASSYIPIMNSIFS  172

Query  577  AQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLH  398
            AQ+  V ID+C I    + FLQQAS++T G Y+  +  D L QYL+         R  + 
Sbjct  173  AQKLKVTIDACQIAGPENVFLQQASHLTGGSYIYAERRDALLQYLTMALLPPPSVRKTIA  232

Query  397  LPRPVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +P    +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  233  VPTQDKIDFRATCFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  279



>ref|XP_011331600.1| PREDICTED: general transcription factor IIH subunit 3 [Cerapachys 
biroi]
 gb|EZA62506.1| General transcription factor IIH subunit [Cerapachys biroi]
Length=294

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS----GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LS ALCYI R+ R       LH   RIL + GS D   QY+  MN  F+AQR  V +
Sbjct  118  SGALSRALCYIARLERDRVAGQKLHS--RILVITGSHDSATQYMNYMNIFFTAQRMNVIL  175

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   IT G YLK   L GL QYL  VF  D + R+ L LP PV VD
Sbjct  176  DVCSLD-QELTLLQQGCDITGGNYLKIPQLAGLLQYLLWVFLPDPNVRSKLVLPPPVKVD  234

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH+  +D+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  YRAACFCHQELVDIGYVCSICLSIFCKFSPICTTCHTVF  273



>gb|KIM69186.1| hypothetical protein SCLCIDRAFT_13298 [Scleroderma citrinum Foug 
A]
Length=332

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 100/164 (61%), Gaps = 10/164 (6%)
 Frame = -1

Query  718  GSLSMALCYIQRVFR---------SGPLHP-QPRILCLHGSPDGPGQYVAIMNSIFSAQR  569
            G+L+ ALCYI R+ +           P  P  PRIL L  SPD    Y+ IMN+IFSAQ+
Sbjct  124  GALTKALCYINRIAQPPASVGNVAEDPAIPSDPRILILSVSPDLSSSYIPIMNAIFSAQK  183

Query  568  SMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPR  389
              V ID C I    + FLQQA+++TNG Y+  +  D L QYL   F      R  L +P+
Sbjct  184  LKVTIDVCKIYGPDTVFLQQAAHLTNGSYIYLEQRDALLQYLIMSFLPSPSVRKVLVIPK  243

Query  388  PVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
               +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  244  QDKIDFRAACFCHKNIVDVGFVCSVCLSIFCQPVPVCSTCRTKF  287



>gb|KJA20721.1| hypothetical protein HYPSUDRAFT_118008, partial [Hypholoma sublateritium 
FD-334 SS-4]
Length=280

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 97/159 (61%), Gaps = 5/159 (3%)
 Frame = -1

Query  718  GSLSMALCYIQRV-----FRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            G+L+ ALCYI R+       S      PRIL L  SPD    Y+ IMN+IFSAQ+  + I
Sbjct  106  GALTKALCYINRISPGTSTPSSDRASDPRILILSVSPDLSTSYIPIMNAIFSAQKMKITI  165

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D+C I    + FLQQA+++T G YL     D L QYL   F     +R  L +P    +D
Sbjct  166  DACQIFGPDTVFLQQAAHLTGGAYLFLDRRDALLQYLIMAFLPPAATRKVLAVPTQDKID  225

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            FRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  226  FRAACFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  264



>ref|XP_001842028.1| TFIIH basal transcription factor complex p34 subunit [Culex quinquefasciatus]
 gb|EDS37566.1| TFIIH basal transcription factor complex p34 subunit [Culex quinquefasciatus]
Length=292

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 102/161 (63%), Gaps = 7/161 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+ R+ P  +    RIL + GS +   QY+  MN  F+AQ+  V +D 
Sbjct  116  AGSMAMALCYIARINRNKPAGVKINSRILVVTGSNECASQYMTYMNVFFTAQKQNVTLDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATD--LH--SRAFLHLPRPVG  380
            CA+    S  LQQ   IT G YLK   LDG  QYL  VF  D  +H   R  L LP PV 
Sbjct  176  CALDKPLS-LLQQGCDITGGQYLKLPQLDGFLQYLLWVFLPDPQMHPQMRCKLVLPPPVK  234

Query  379  VDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            VD+RA+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  235  VDYRAACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  275



>ref|XP_001375408.3| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Monodelphis domestica]
Length=336

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  162  AGSLAKALCYIHRMSKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNIVIDA  221

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + A  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L+LP P+ VD+R
Sbjct  222  CVLDAD-SGLLQQACDITGGIYLKVPQMPSLLQYLLWVFLPDQDQRSQLNLPPPIHVDYR  280

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  281  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  317



>ref|XP_011314254.1| PREDICTED: general transcription factor IIH subunit 3 [Fopius 
arisanus]
Length=293

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSG----PLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LS+ALCYI R+ R       LH   RI  + GS D   QY+  MN  F+AQ+  V +
Sbjct  118  SGALSLALCYIARLEREKVPGEKLHS--RIFVVTGSNDSATQYMNYMNIFFTAQKMGVIL  175

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQA  IT G YLK   L GL QYL  VF  D   RA L LP PV VD
Sbjct  176  DVCSLD-QELTLLQQACDITGGNYLKIPQLAGLLQYLLWVFLPDPEVRAKLVLPPPVKVD  234

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH   ID+GY+CSVCLSIFCK  P C+TC ++F
Sbjct  235  YRAACFCHHELIDIGYVCSVCLSIFCKFSPICTTCHTLF  273



>ref|XP_009866840.1| PREDICTED: general transcription factor IIH subunit 3 [Apaloderma 
vittatum]
Length=267

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGLYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>dbj|GAN02372.1| tfb4-domain-containing protein [Mucor ambiguus]
Length=301

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR-SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCYI RV +     H +PRIL L  SPD   QY+ +MN IFSAQ++ +P+D C
Sbjct  133  TGALSMALCYINRVTKLDDEGHIKPRILVLSVSPDSAYQYIPLMNCIFSAQKASIPLDVC  192

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  + +AFLQQAS IT GVY+K +    L +YL   F  D +SR +L+LP    VDFRA
Sbjct  193  KIFGEETAFLQQASNITGGVYVKMENRQALLEYLMMAFLPDRYSRNYLNLPSQDQVDFRA  252

Query  364  SCFCHKNTIDMGYICS  317
            +CFCHK  +D+G++CS
Sbjct  253  ACFCHKKIVDIGFVCS  268



>ref|XP_011207828.1| PREDICTED: general transcription factor IIH subunit 3 [Bactrocera 
dorsalis]
Length=292

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+ R+    +    RIL + GS +   QY+  MN  F+AQ+  + ID 
Sbjct  121  AGSMAMALCYISRIQRNAAAGVKMHSRILVVTGSNECASQYMTYMNVFFTAQKLGITIDV  180

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+   LDGL QYL  VF  D   R  L LP    VD+R
Sbjct  181  CAMDKTMS-LLQQGCDITGGQYLRLTQLDGLLQYLLWVFLPDPQMRQKLVLPPATKVDYR  239

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  240  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  276



>ref|NP_001264448.1| general transcription factor IIH subunit 3 [Gallus gallus]
Length=307

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  133  AGSLAKALCYINKISKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  192

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  +  LQQA  IT G+YLK   L  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  193  CVLDSD-TGLLQQACDITGGIYLKVPHLPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  251

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  252  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  288



>ref|XP_003761131.1| PREDICTED: general transcription factor IIH subunit 3 [Sarcophilus 
harrisii]
Length=316

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  141  AGSLAKALCYIHRMGKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNIVIDA  200

Query  547  CAIGAQHSAFLQQASYITNGVYLK-PQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDF  371
            C +    S  LQQA  IT G+YLK PQ+L  L QYL  VF  D   R+ L+LP P+ VD+
Sbjct  201  CVLDTD-SGLLQQACDITGGIYLKVPQML-SLLQYLLWVFLPDQDQRSQLNLPPPIHVDY  258

Query  370  RASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            RA+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  259  RAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  296



>ref|XP_001357006.2| GA18615 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34072.2| GA18615 [Drosophila pseudoobscura pseudoobscura]
Length=298

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+ R+    +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMAMALCYISRLQRNVAAGVKMHSRILVLTGSNECSSQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  184  CALDKTLS-LLQQGCDITTGQFLKVTQLDGLLQYLLWVFLPAPQMRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  279



>ref|XP_009705558.1| PREDICTED: general transcription factor IIH subunit 3 [Cariama 
cristata]
Length=267

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_004526613.1| PREDICTED: general transcription factor IIH subunit 3-like [Ceratitis 
capitata]
Length=293

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGP--LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+ R+    +    RIL + GS +   QY+  MN  F+AQ+  + ID 
Sbjct  122  AGSMAMALCYISRIQRNAAAGVKMHSRILVVTGSNECASQYMTYMNVFFTAQKLGITIDV  181

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G YL+   LDGL QYL  VF  D   R  L LP    VD+R
Sbjct  182  CALDKTMS-LLQQGCDITGGQYLRLTQLDGLLQYLLWVFLPDPQMRQKLVLPPATKVDYR  240

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  241  AACFCHRELIDIGYVCSVCLSIFCKFSPICTTCHTVF  277



>ref|XP_002189370.2| PREDICTED: general transcription factor IIH subunit 3 isoform 
1 [Taeniopygia guttata]
 ref|XP_004176463.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
2 [Taeniopygia guttata]
Length=267

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +   ++ +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMGKDLKVNQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009483660.1| PREDICTED: general transcription factor IIH subunit 3 [Pelecanus 
crispus]
Length=267

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_003397229.1| PREDICTED: general transcription factor IIH subunit 3-like [Bombus 
terrestris]
Length=292

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCY+ R+ R      +   RIL +  S D   QY+  MN  F+AQ+  + +D 
Sbjct  116  SGALTMALCYVARLEREKVASEKIYSRILVITASNDSATQYMNYMNIFFTAQKMGIILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L+GL QYL  +F  D + R+ L LP PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLNGLLQYLLWIFLPDPNVRSKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_010777418.1| PREDICTED: general transcription factor IIH subunit 3 [Notothenia 
coriiceps]
Length=299

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL--HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI RV +   +    + RIL +  + D   QY+  MN IF++Q+  + ID+
Sbjct  125  AGSLAKALCYINRVAKDHEVGQETKSRILVIKAAEDCALQYMNFMNVIFASQKQNILIDA  184

Query  547  CAIGAQHSAFLQQASYITNGVYLK-PQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDF  371
            C + +  S  LQQA  IT G+YLK PQ +  L QYL  VF  D   RA L LP PV VD+
Sbjct  185  CVLDSD-SGLLQQACDITGGLYLKIPQKV-ALAQYLLWVFLPDSEQRAQLVLPPPVHVDY  242

Query  370  RASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            RA+CFCH+N ID+GY+CSVCLSIFC   P C+TC + F
Sbjct  243  RAACFCHRNLIDIGYVCSVCLSIFCNFSPICTTCETAF  280



>ref|XP_003488130.1| PREDICTED: general transcription factor IIH subunit 3-like [Bombus 
impatiens]
Length=292

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCY+ R+ R      +   RIL +  S D   QY+  MN  F+AQ+  + +D 
Sbjct  116  SGALTMALCYVARLEREKVASEKIYSRILVITASNDSATQYMNYMNIFFTAQKMGIILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L+GL QYL  +F  D + R+ L LP PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLNGLLQYLLWIFLPDPNVRSKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_009984347.1| PREDICTED: general transcription factor IIH subunit 3 [Tauraco 
erythrolophus]
Length=267

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_005298780.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Chrysemys picta bellii]
Length=307

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +        + RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  133  AGSLAKALCYIHRMNKEVKASQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  192

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  193  CVLDSD-SGLLQQACDITGGIYLKVPRIPSLLQYLLWVFLPDQEQRSQLILPPPIHVDYR  251

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  252  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  288



>ref|XP_010137832.1| PREDICTED: general transcription factor IIH subunit 3 [Buceros 
rhinoceros silvestris]
Length=267

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINKMSKELKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009955352.1| PREDICTED: general transcription factor IIH subunit 3 [Leptosomus 
discolor]
Length=267

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDTD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009878559.1| PREDICTED: general transcription factor IIH subunit 3 [Charadrius 
vociferus]
Length=267

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALC+I ++ +    H +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCFINKMSKEVKAHREMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_005231215.1| PREDICTED: general transcription factor IIH subunit 3 [Falco 
peregrinus]
 ref|XP_005434617.1| PREDICTED: general transcription factor IIH subunit 3 [Falco 
cherrug]
Length=268

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  94   AGSLAKALCYINKMNKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  153

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  154  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  212

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  213  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  249



>ref|XP_008941414.1| PREDICTED: general transcription factor IIH subunit 3, partial 
[Merops nubicus]
Length=241

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  67   AGSLAKALCYINKMSKQVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  126

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  127  CILDS-DSGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  185

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  186  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  222



>ref|XP_009319434.1| PREDICTED: general transcription factor IIH subunit 3 [Pygoscelis 
adeliae]
Length=258

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  84   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  143

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  144  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  202

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  203  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  239



>ref|XP_010602612.1| PREDICTED: general transcription factor IIH subunit 3 [Fukomys 
damarensis]
Length=309

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  S D   QY+  MN IF+AQ+  + ID+
Sbjct  135  AGSLAKALCYIHRMNKEVKDNQEMKSRILVIKASEDSALQYMNFMNVIFAAQKQNIAIDA  194

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  195  CVLDSD-SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRAQLILPPPIHVDYR  253

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  254  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  290



>ref|XP_011260725.1| PREDICTED: general transcription factor IIH subunit 3 [Camponotus 
floridanus]
 gb|EFN65408.1| General transcription factor IIH subunit 3 [Camponotus floridanus]
Length=292

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  721  SGSLSMALCYIQRV----FRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LSMALCYI R+    F +  LH   R+L +  S D   QY+  MN  F+AQR  V +
Sbjct  116  SGALSMALCYIARLEREKFANQKLHS--RMLVITASNDSAMQYMNYMNIFFTAQRMNVIL  173

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   IT G YL+   L GL QYL  VF  D   R+ L LP PV V+
Sbjct  174  DVCSLD-QELTLLQQGCEITGGNYLQVPQLAGLLQYLLWVFLPDPSVRSKLVLPPPVKVN  232

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +RA+CFCH++ ID+GY+CS+CLSIFCK+ P C+TC +VF
Sbjct  233  YRAACFCHQDLIDIGYVCSICLSIFCKYSPICTTCHTVF  271



>ref|XP_010285864.1| PREDICTED: general transcription factor IIH subunit 3 [Phaethon 
lepturus]
Length=267

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_007767079.1| transcription factor Tfb4 [Coniophora puteana RWD-64-598 SS2]
 gb|EIW83271.1| transcription factor Tfb4 [Coniophora puteana RWD-64-598 SS2]
Length=327

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 98/162 (60%), Gaps = 8/162 (5%)
 Frame = -1

Query  718  GSLSMALCYIQRVFR----SGPLHPQ----PRILCLHGSPDGPGQYVAIMNSIFSAQRSM  563
             +L+ ALCYI R+      +GP  P     PRIL L  SPD    Y+ IMN IFSAQ+  
Sbjct  121  SALAKALCYINRITHPSTSAGPEDPNELPDPRILILSVSPDLSSSYIPIMNCIFSAQKLK  180

Query  562  VPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPV  383
            V ID C +    + FLQQA+++T G Y+  +  D L QYL   F      R  L +PR  
Sbjct  181  VTIDVCKVYGPETVFLQQAAHLTEGSYIHLERRDALLQYLVMSFLAPPSVRGVLAVPRQE  240

Query  382  GVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
             +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  241  RIDFRAACFCHKNIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  282



>ref|XP_007665097.1| PREDICTED: general transcription factor IIH subunit 3 [Ornithorhynchus 
anatinus]
 ref|XP_001507590.2| PREDICTED: general transcription factor IIH subunit 3 [Ornithorhynchus 
anatinus]
Length=268

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +        + RIL +  S D   QY+  MN IF+AQ+  + ID+
Sbjct  94   AGSLAKALCYIHRMNKEVKDSQEMRSRILVIKASEDSALQYMNFMNVIFAAQKQNILIDA  153

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  154  CVLDSD-SGLLQQACDITGGIYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYR  212

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  213  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  249



>ref|XP_003462950.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Cavia porcellus]
Length=309

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL L  + D   QY+  MN IF+AQ+  + ID+
Sbjct  135  AGSLAKALCYIHRMNKEVKDNQEMKSRILVLKAAEDSALQYMNFMNVIFAAQKQNILIDA  194

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  195  CVLDTD-SGLLQQACDITGGLYLKVPQMTSLLQYLLWVFLPDQDQRAQLILPPPIHVDYR  253

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  254  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  290



>ref|XP_009930792.1| PREDICTED: general transcription factor IIH subunit 3 [Opisthocomus 
hoazin]
Length=267

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_010170724.1| PREDICTED: general transcription factor IIH subunit 3 [Caprimulgus 
carolinensis]
Length=267

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_006910038.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Pteropus alecto]
 ref|XP_006910039.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Pteropus alecto]
Length=268

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  94   AGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  153

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +G+  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  154  CVLGSD-SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYR  212

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  213  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  249



>ref|XP_007381488.1| transcription factor Tfb4 [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN11961.1| transcription factor Tfb4 [Punctularia strigosozonata HHB-11173 
SS5]
Length=338

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 99/159 (62%), Gaps = 5/159 (3%)
 Frame = -1

Query  718  GSLSMALCYIQRVFR----SGPLHP-QPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            G+L+ ALCYI R+      + P  P +PRIL L  SPD    Y+ IMNSIFSAQ+  V +
Sbjct  123  GALTKALCYINRIMNVSADNEPRSPSEPRILILSVSPDQSTSYIPIMNSIFSAQKLKVTM  182

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C +    S FLQQAS++T G Y+  +  D L QYL   F      R  L +P    +D
Sbjct  183  DVCQLYGPESVFLQQASHLTGGSYIHLEHRDALLQYLIMSFLPPPSIRRTLSVPTQDKID  242

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            FRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  243  FRAACFCHKNIVDVGFVCSVCLSIFCQPVPVCSTCRTKF  281



>ref|XP_010305484.1| PREDICTED: general transcription factor IIH subunit 3 [Balearica 
regulorum gibbericeps]
Length=267

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_008924891.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Manacus vitellinus]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + +D+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSTLQYMNFMNVIFAAQKQSILVDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009471282.1| PREDICTED: general transcription factor IIH subunit 3 [Nipponia 
nippon]
 ref|XP_009806450.1| PREDICTED: general transcription factor IIH subunit 3 [Gavia 
stellata]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009282205.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Aptenodytes forsteri]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_004636025.1| PREDICTED: general transcription factor IIH subunit 3 [Octodon 
degus]
Length=313

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  139  AGSLAKALCYIHRMTKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  198

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  199  CVLDSD-SGLLQQACDITGGLYLKVPQMTSLLQYLLWVFLPDQDQRAQLILPPPIHVDYR  257

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  258  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  294



>ref|XP_009572811.1| PREDICTED: general transcription factor IIH subunit 3 [Fulmarus 
glacialis]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_005524288.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Pseudopodoces humilis]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKDLKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_002077716.1| GD22925 [Drosophila simulans]
 gb|EDX03301.1| GD22925 [Drosophila simulans]
Length=299

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS-GP-LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+  P +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMSMALCYISRLQRNLAPGVKMHSRILVLTGSNECASQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  184  CALDKTLS-LLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F  
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIFKN  281



>ref|XP_006619790.1| PREDICTED: general transcription factor IIH subunit 3-like [Apis 
dorsata]
Length=292

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCYI R+ R      +   RIL +  S D   QY+  MN  F+AQ+  V +D 
Sbjct  116  SGALTMALCYISRLEREKIAGEKLYSRILVITASNDSATQYMNYMNIFFTAQKMGVILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L+GL QYL  +F  D + R+ L  P PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLNGLLQYLLWIFLPDPNVRSKLVFPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_006119740.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Pelodiscus sinensis]
Length=330

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  S D   QY+  MN IF+AQ+  + ID+
Sbjct  156  AGSLAKALCYIHRMNKEVKANQEIKSRILIIKASEDSALQYMNFMNVIFAAQKQNILIDA  215

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  216  CVLDSD-SGLLQQACDITGGIYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYR  274

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  275  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  311



>ref|XP_009501525.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Phalacrocorax carbo]
Length=267

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_791329.2| PREDICTED: general transcription factor IIH subunit 3-like [Strongylocentrotus 
purpuratus]
Length=313

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+MALCYI RV +   +  +   RIL L  + D   QY+  MN IF+AQ+  +PID+
Sbjct  136  AGSLAMALCYIHRVXKECAVGEKIKSRILVLKAADDSASQYMNFMNVIFTAQKQNIPIDA  195

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +  + S+ LQQA  IT G YLK     GL QYL  V+      R  L LP  + VD+R
Sbjct  196  CILD-KDSSLLQQACDITGGKYLKLLSTTGLLQYLLWVYLPSPSQRESLVLPPAIHVDYR  254

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFC + P CSTC + F
Sbjct  255  AACFCHRILIDVGYVCSVCLSIFCTYSPICSTCHTAF  291



>ref|XP_394705.3| PREDICTED: general transcription factor IIH subunit 3 [Apis mellifera]
Length=292

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCYI R+ R      +   RIL +  S D   QY+  MN  F+AQ+  V +D 
Sbjct  116  SGALTMALCYIARLEREKIAGEKLYSRILVITASNDSATQYMNYMNIFFTAQKMGVILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L+GL QYL  +F  D + R+ L  P PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLNGLLQYLLWIFLPDPNVRSKLVFPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>ref|XP_008632244.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Corvus brachyrhynchos]
 ref|XP_010396704.1| PREDICTED: general transcription factor IIH subunit 3 [Corvus 
cornix cornix]
 ref|XP_010396705.1| PREDICTED: general transcription factor IIH subunit 3 [Corvus 
cornix cornix]
Length=267

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMGKDLKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009907858.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Picoides pubescens]
Length=267

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCYINKMSKELKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQELRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_001877780.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR11883.1| predicted protein [Laccaria bicolor S238N-H82]
Length=360

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 100/167 (60%), Gaps = 13/167 (8%)
 Frame = -1

Query  718  GSLSMALCYIQRV-------------FRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFS  578
            G+L+ ALCY+ R+              R   + P PRIL L  SPD    Y+ IMNSIFS
Sbjct  128  GALTKALCYVNRISLPPPSNSSTSPNTRDSTVLPDPRILILSVSPDLSTSYIPIMNSIFS  187

Query  577  AQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLH  398
            AQ+  V ID+C +    + FLQQA+++T G YL  +  D L QYL   F +    R  L 
Sbjct  188  AQKLKVTIDACQVYGPDAVFLQQAAHLTGGSYLFLERRDALLQYLIMSFLSAPSIRQVLA  247

Query  397  LPRPVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +P    +DFRA+CFCHKN ID+G++CSVCLSIFC+  P CSTC + F
Sbjct  248  VPTQDRIDFRAACFCHKNIIDIGFVCSVCLSIFCQPVPVCSTCRTKF  294



>ref|XP_003698948.1| PREDICTED: general transcription factor IIH subunit 3-like [Apis 
florea]
Length=292

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCYI R+ R      +   RIL +  S D   QY+  MN  F+AQ+  V +D 
Sbjct  116  SGALTMALCYIARLEREKIAGEKLYSRILVITASNDSATQYMNYMNIFFTAQKMGVILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L+GL QYL  +F  D + R+ L  P PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLNGLLQYLLWIFLPDPNVRSKLVFPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CS+CLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSICLSIFCKFSPICTTCHTVF  271



>gb|KIK09917.1| hypothetical protein K443DRAFT_127299 [Laccaria amethystina LaAM-08-1]
Length=364

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 100/167 (60%), Gaps = 13/167 (8%)
 Frame = -1

Query  718  GSLSMALCYIQRV-------------FRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFS  578
            G+L+ ALCY+ R+              R   + P PRIL L  SPD    Y+ IMNSIFS
Sbjct  129  GALTKALCYVNRISLPPPSNSSTSLNTRDSTVLPDPRILILSVSPDLSTSYIPIMNSIFS  188

Query  577  AQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLH  398
            AQ+  V ID+C +    + FLQQA+++T G YL  +  D L QYL   F +    R  L 
Sbjct  189  AQKLKVTIDACQVYGPDAVFLQQAAHLTGGSYLFLERRDALLQYLIMSFLSAPSIRQILA  248

Query  397  LPRPVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +P    +DFRA+CFCHKN ID+G++CSVCLSIFC+  P CSTC + F
Sbjct  249  VPTQDRIDFRAACFCHKNIIDIGFVCSVCLSIFCQPVPVCSTCRTKF  295



>ref|XP_002041670.1| GM16625 [Drosophila sechellia]
 gb|EDW45486.1| GM16625 [Drosophila sechellia]
Length=299

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS-GP-LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+  P +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMSMALCYISRLQRNLAPGVKMHSRILVLTGSNECASQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  184  CALDKTLS-LLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  279



>ref|XP_005424057.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Geospiza fortis]
 ref|XP_005424058.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Geospiza fortis]
 ref|XP_009090732.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Serinus canaria]
 ref|XP_009090734.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Serinus canaria]
Length=267

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMGKDLKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|NP_001120625.1| general transcription factor IIH, polypeptide 3, 34kDa [Xenopus 
(Silurana) tropicalis]
 gb|AAI61775.1| gtf2h3 protein [Xenopus (Silurana) tropicalis]
Length=200

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPL--HPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +        + RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  26   AGSLAKALCYINKIAKDTKAGQEVKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  85

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK    + L QYL  VF  D   R+ L+L  PV VD+R
Sbjct  86   CVLDS-DSGLLQQACDITGGIYLKLPQANSLLQYLLWVFLPDPDQRSHLNLLPPVHVDYR  144

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  145  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  181



>ref|XP_009071590.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Acanthisitta chloris]
Length=267

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSLS ALCYI ++ +    + +   RIL +  + D   QY+  MN +F+AQ+  + ID+
Sbjct  93   AGSLSKALCYINKMSKDLKANQEMKSRILVIKAAEDSALQYMNFMNVVFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  +F  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWMFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_007424720.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Python bivittatus]
Length=304

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +      +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  130  AGSLAKALCYIHRITKENKASQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKRNILIDA  189

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK      L QYL  V+  D   R+ L LP PV VD+R
Sbjct  190  CVLDSD-SGLLQQACDITGGIYLKIPYKPSLLQYLLWVYLPDQEQRSQLILPPPVHVDYR  248

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  249  AACFCHRNLIEIGYVCSVCLSIFCTFSPICTTCETAF  285



>ref|XP_010189243.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Mesitornis unicolor]
Length=267

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDTD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_009920938.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Haliaeetus albicilla]
Length=267

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMGKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>ref|XP_007424719.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Python bivittatus]
Length=308

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +      +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  134  AGSLAKALCYIHRITKENKASQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKRNILIDA  193

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK      L QYL  V+  D   R+ L LP PV VD+R
Sbjct  194  CVLDSD-SGLLQQACDITGGIYLKIPYKPSLLQYLLWVYLPDQEQRSQLILPPPVHVDYR  252

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  253  AACFCHRNLIEIGYVCSVCLSIFCTFSPICTTCETAF  289



>gb|EPB87532.1| hypothetical protein HMPREF1544_05623 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=301

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR-SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSC  545
            +G+LSMALCYI RV +     H +PRIL L  SPD   QY+ +MN IFSAQ++ +P+D C
Sbjct  133  TGALSMALCYINRVTKLDDEGHIKPRILVLSVSPDSAYQYIPLMNCIFSAQKASIPLDVC  192

Query  544  AIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRA  365
             I  + +AFLQQAS IT GVY+K +    L +YL   F  D +SR +L+LP    VDFRA
Sbjct  193  KIFGEETAFLQQASNITGGVYVKMENRLALLEYLMMAFLPDRYSRNYLNLPSQDQVDFRA  252

Query  364  SCFCHKNTIDMGYICS  317
            +CFCHK  +D+G++CS
Sbjct  253  ACFCHKKIVDIGFVCS  268



>ref|XP_010082753.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Pterocles gutturalis]
Length=267

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALC+I ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  V ID+
Sbjct  93   AGSLAKALCFINKMSKEVKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDTD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



>gb|AAH31030.1| Unknown (protein for IMAGE:4724313), partial [Homo sapiens]
Length=235

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  61   AGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  120

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  121  CVLDSD-SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSRLILPPPVHVDYR  179

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  180  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  216



>ref|XP_005055218.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Ficedula albicollis]
Length=307

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  133  AGSLAKALCYINKMGKDLKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  192

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  193  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  251

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  252  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  288



>gb|ERL91675.1| hypothetical protein D910_09003 [Dendroctonus ponderosae]
Length=300

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +G+++MALCYI R+ R+ P   +   RIL + GS D   QY+  MN  F+AQ+  V +D 
Sbjct  128  AGAIAMALCYIARLQRTKPPGSKLNSRILVVSGSGDSASQYMNYMNVFFTAQKLNVVLDV  187

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+  QH + LQQ   IT G+YLK   +  L Q+L  VF  +   R  L LP PV VD+R
Sbjct  188  CALD-QHLSLLQQGCDITGGMYLKVPQITALLQFLLWVFLPEPPIREKLVLPPPVKVDYR  246

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+G++CSVCLSIFCK  P C+TC  VF
Sbjct  247  AACFCHRELIDIGFVCSVCLSIFCKFSPICTTCHMVF  283



>gb|KIK40166.1| hypothetical protein CY34DRAFT_807469 [Suillus luteus UH-Slu-Lm8-n1]
Length=333

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 100/169 (59%), Gaps = 20/169 (12%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHP---------------QPRILCLHGSPDGPGQYVAIMNSI  584
            G+++ ALCYI R+      HP                PRIL L  SPD    Y+ IMN+I
Sbjct  121  GAVTKALCYINRI-----THPSSTTAGVAEDPSVIHDPRILILSVSPDLSSSYIPIMNAI  175

Query  583  FSAQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAF  404
            FSAQ+  V ID C +    + FLQQA+++TNG Y+  +  D L QYL   F +    R  
Sbjct  176  FSAQKLKVTIDVCKVYGPDTVFLQQAAHLTNGSYIYLERRDALLQYLIMSFLSPTPIRKI  235

Query  403  LHLPRPVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            L +P+   +DFRA+CFCHKN +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  236  LAVPKQDKIDFRAACFCHKNIVDIGFVCSVCLSIFCQPLPVCSTCRTKF  284



>gb|ENN73317.1| hypothetical protein YQE_10080, partial [Dendroctonus ponderosae]
Length=300

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +G+++MALCYI R+ R+ P   +   RIL + GS D   QY+  MN  F+AQ+  V +D 
Sbjct  128  AGAIAMALCYIARLQRTKPPGSKLNSRILVVSGSGDSASQYMNYMNVFFTAQKLNVVLDV  187

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+  QH + LQQ   IT G+YLK   +  L Q+L  VF  +   R  L LP PV VD+R
Sbjct  188  CALD-QHLSLLQQGCDITGGMYLKVPQITALLQFLLWVFLPEPPIREKLVLPPPVKVDYR  246

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+G++CSVCLSIFCK  P C+TC  VF
Sbjct  247  AACFCHRELIDIGFVCSVCLSIFCKFSPICTTCHMVF  283



>ref|XP_005055217.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Ficedula albicollis]
Length=308

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  134  AGSLAKALCYINKMGKDLKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  193

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  194  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  252

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  253  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  289



>ref|XP_006015174.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Alligator sinensis]
Length=309

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  135  AGSIAKALCYIHRLTKEVKANQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  194

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C +    S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  195  CVL-ENDSGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLILPPPIHVDYR  253

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  254  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  290



>ref|XP_002020665.1| GL15043 [Drosophila persimilis]
 gb|EDW39658.1| GL15043 [Drosophila persimilis]
Length=298

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRV--FRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS++MALCYI R+    +  +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMAMALCYISRLHGMLAAGVKMHSRILVLTGSNECSSQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  184  CALDKTLS-LLQQGCDITTGQFLKVTQLDGLLQYLLWVFLPAPQMRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  279



>ref|XP_006883001.1| PREDICTED: general transcription factor IIH subunit 3-like isoform 
X1 [Elephantulus edwardii]
Length=299

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  128  AGSLAKALCYIHRMSKEVKDNQEMKSRILVIKAAEDSAAQYMNFMNVIFAAQKQNILIDA  187

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  188  CVLDSD-SGLLQQACDITGGLYLKVPQMPSLLQYLLFVFLPDQDQRSQLILPPPIHVDYR  246

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC S F
Sbjct  247  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCESAF  283



>ref|XP_004844017.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X1 [Heterocephalus glaber]
Length=309

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  135  AGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  194

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   RA L LP P+ VD+R
Sbjct  195  CVLDSD-SGLLQQACDITGGLYLKVPQMASLLQYLLWVFLPDQDQRAQLILPPPIHVDYR  253

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  254  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  290



>ref|XP_010580545.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Haliaeetus leucocephalus]
Length=308

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  134  AGSLAKALCYINKMGKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  193

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+R
Sbjct  194  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYR  252

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  253  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  289



>ref|XP_007872653.1| hypothetical protein PNEG_00752 [Pneumocystis murina B123]
 gb|EMR11156.1| hypothetical protein PNEG_00752 [Pneumocystis murina B123]
Length=319

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHP-QPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            GSL MAL Y+ R  ++   +  + RI  +  S D   QY+ IMN  FSAQ+  +PID C 
Sbjct  145  GSLCMALAYVNRFMQNIEENKLKARIFIISVSSDIAFQYIPIMNCTFSAQKKKIPIDVCK  204

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            IG + S FLQQAS  T G+YL       L QYL  +F  D   R  L LP  + VDFRA+
Sbjct  205  IG-KDSVFLQQASDATKGIYLHLDKPKSLLQYLMMIFLPDQKVRQHLVLPFQLNVDFRAA  263

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGKARGQE  236
            CFCHK  +D+GY+CSVCLSIFC   P+C  C ++F     Q+
Sbjct  264  CFCHKKIVDIGYVCSVCLSIFCIKYPKCLICDTIFDTNMSQK  305



>ref|XP_003703450.1| PREDICTED: general transcription factor IIH subunit 3-like [Megachile 
rotundata]
Length=292

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            SG+L+MALCYI R+ R      +   RIL +  S D   QY+  MN  F+AQ+  V +D 
Sbjct  116  SGALTMALCYIARLEREKVAGQKLYSRILTITASNDSATQYMNYMNIFFTAQKMGVILDV  175

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C++  Q    LQQ   IT G YLK   L GL QYL  +F  D   R+ L LP PV VD+R
Sbjct  176  CSLD-QELTLLQQGCDITGGNYLKVPQLSGLLQYLLWIFLPDPSIRSKLVLPPPVKVDYR  234

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+  ID+GY+CSVCLSIFCK  P C+TC +VF
Sbjct  235  AACFCHQELIDIGYVCSVCLSIFCKFSPICTTCHTVF  271



>ref|XP_010366703.1| PREDICTED: general transcription factor IIH subunit 3 isoform 
X2 [Rhinopithecus roxellana]
Length=267

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS--GPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI R+ +        + RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYIHRMNKEIKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLADQDQRSQLILPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P C+TC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAF  248



>ref|XP_002087508.1| GE15755 [Drosophila yakuba]
 gb|EDW87220.1| GE15755 [Drosophila yakuba]
Length=299

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRS-GP-LHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R+  P +    RIL + GS +   QY+  MN  F+AQ+  + ID+
Sbjct  124  AGSMSMALCYISRLQRNVAPGVKMHSRILVITGSNECASQYMTFMNVFFTAQKLGITIDT  183

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   LDGL QYL  VF      R  L LP P  VD+R
Sbjct  184  CALDKTLS-LLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYR  242

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVFGK  251
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F  
Sbjct  243  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIFKN  281



>gb|EPS97727.1| hypothetical protein FOMPIDRAFT_147470 [Fomitopsis pinicola FP-58527 
SS1]
Length=336

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 96/161 (60%), Gaps = 7/161 (4%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSGPLHP-------QPRILCLHGSPDGPGQYVAIMNSIFSAQRSMV  560
            G+L+ +LCYI R+  +             PRIL L  SPD    Y+ IMNSIFSAQ+  V
Sbjct  124  GALTKSLCYINRITATSSAQSAEQTASLDPRILILSVSPDQSSSYIPIMNSIFSAQKLRV  183

Query  559  PIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVG  380
             ID C +    S FLQQA+++T G YL  +  D L QYL+  F      R  L +P    
Sbjct  184  TIDVCKVYGSESVFLQQAAHLTGGSYLHLERADALLQYLTMSFLPPPGIRQLLSVPTQDK  243

Query  379  VDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            VDFRA+CFCHK  +D+G++CSVCLSIFC+  P CSTC + F
Sbjct  244  VDFRAACFCHKRIVDIGFVCSVCLSIFCQPVPVCSTCRTKF  284



>gb|KFV01969.1| General transcription factor IIH subunit 3, partial [Tauraco 
erythrolophus]
Length=301

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            +GSL+ ALC I  + +      + RIL +  + D   QY+  MN IF+AQ+  V ID+C 
Sbjct  130  AGSLAKALCCILLILKGSNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDACV  189

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+RA+
Sbjct  190  LDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYRAA  248

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  249  CFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  283



>ref|XP_001961833.1| GF14734 [Drosophila ananassae]
 gb|EDV31054.1| GF14734 [Drosophila ananassae]
Length=297

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFR--SGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GS+SMALCYI R+ R  +  +    RIL L GS +   QY+  MN  F+AQ+  + ID+
Sbjct  123  AGSMSMALCYISRLQRNVTSGVKMHSRILVLTGSNECASQYMTFMNVFFTAQKLGIVIDT  182

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            CA+    S  LQQ   IT+G +LK   L+GL QYL  VF      R  L LP P  VD+R
Sbjct  183  CALDKTLS-LLQQGCDITSGQFLKVTQLEGLLQYLLWVFLPAPQMRHKLVLPPPPKVDYR  241

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            ASCFCH+  ID+GY+CSVCLS+FCK+ P C+TC ++F
Sbjct  242  ASCFCHRELIDIGYVCSVCLSVFCKYSPICTTCHTIF  278



>gb|KFP60150.1| General transcription factor IIH subunit 3, partial [Cariama 
cristata]
Length=301

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 97/155 (63%), Gaps = 1/155 (1%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDSCA  542
            +GSL+ ALC I  +  S     + RIL +  + D   QY+  MN IF+AQ+  V ID+C 
Sbjct  130  AGSLAKALCCILLITESSNQEIKSRILVIKAAEDSALQYMNFMNVIFAAQKQSVLIDACV  189

Query  541  IGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFRAS  362
            + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP P+ VD+RA+
Sbjct  190  LDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPIHVDYRAA  248

Query  361  CFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  249  CFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  283



>gb|EFZ18109.1| hypothetical protein SINV_08150 [Solenopsis invicta]
Length=322

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 96/155 (62%), Gaps = 7/155 (5%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSG----PLHPQPRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPI  554
            SG+LSMALCYI R+ R       LHP  RIL +  S D   QY+  MN  F+AQR  V +
Sbjct  114  SGALSMALCYIARLEREKVAGQKLHP--RILVITASNDSATQYMNYMNIFFTAQRMNVIL  171

Query  553  DSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVD  374
            D C++  Q    LQQ   I+ G YLK   L GL QYL  VF  D   R  L LP PV VD
Sbjct  172  DVCSLD-QELTLLQQGCDISGGNYLKVPQLAGLLQYLLWVFLPDPSVRLKLVLPPPVKVD  230

Query  373  FRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTC  269
            +RA+CFCH+  ID+GY+CS+CLSIFCK  P C+TC
Sbjct  231  YRAACFCHQELIDIGYVCSICLSIFCKFSPICTTC  265



>gb|KIY74425.1| Tfb4-domain-containing protein [Cylindrobasidium torrendii FP15055 
ss-10]
Length=350

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 97/167 (58%), Gaps = 13/167 (8%)
 Frame = -1

Query  718  GSLSMALCYIQRVFRSG-------------PLHPQPRILCLHGSPDGPGQYVAIMNSIFS  578
             +L+ +LCYI R+  S              P    PRIL L  SPD    Y+ IMNSIFS
Sbjct  123  AALTKSLCYINRLRLSNAGPPTTNSQNAPPPKAADPRILILSVSPDLTASYIPIMNSIFS  182

Query  577  AQRSMVPIDSCAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLH  398
            AQ+  + +D C I    S FLQQA+++T G Y+  +  D L QYL   F +    R  L 
Sbjct  183  AQKLKITVDVCQIYGVDSVFLQQAAHLTGGSYIYLERRDALLQYLVMTFLSSPSVRKILS  242

Query  397  LPRPVGVDFRASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            +P    VDFRA+CFCHKN +D+G++CSVCLSIFCK  P CSTC + F
Sbjct  243  VPTQDKVDFRAACFCHKNIVDIGFVCSVCLSIFCKPVPVCSTCRTKF  289



>ref|XP_010122015.1| PREDICTED: general transcription factor IIH subunit 3, partial 
[Chlamydotis macqueenii]
Length=321

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  721  SGSLSMALCYIQRVFRSGPLHPQ--PRILCLHGSPDGPGQYVAIMNSIFSAQRSMVPIDS  548
            +GSL+ ALCYI ++ +    + +   RIL +  + D   QY+  MN IF+AQ+  + ID+
Sbjct  93   AGSLAKALCYINKMSKEVKANQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQSILIDA  152

Query  547  CAIGAQHSAFLQQASYITNGVYLKPQILDGLFQYLSTVFATDLHSRAFLHLPRPVGVDFR  368
            C + +  S  LQQA  IT G+YLK   +  L QYL  VF  D   R+ L LP PV VD+R
Sbjct  153  CVLDSD-SGLLQQACDITGGIYLKVPHMPSLLQYLLWVFLPDQEQRSQLVLPPPVHVDYR  211

Query  367  ASCFCHKNTIDMGYICSVCLSIFCKHQPQCSTCGSVF  257
            A+CFCH+N I++GY+CSVCLSIFC   P CSTC + F
Sbjct  212  AACFCHRNLIEIGYVCSVCLSIFCNFSPICSTCETAF  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425