BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007J10

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN27149.1|  Phosphoglucan, water dikinase, chloroplastic            391   3e-132   Glycine soja [wild soybean]
gb|KEH27296.1|  phosphoglucan, water dikinase                           399   6e-132   Medicago truncatula
ref|XP_006421072.1|  hypothetical protein CICLE_v10006658mg             390   6e-130   
gb|KDO57836.1|  hypothetical protein CISIN_1g009825mg                   390   7e-130   Citrus sinensis [apfelsine]
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    407   1e-129   Vitis vinifera
gb|KEH27295.1|  phosphoglucan, water dikinase                           399   6e-129   Medicago truncatula
gb|KJB71924.1|  hypothetical protein B456_011G147600                    396   2e-128   Gossypium raimondii
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    404   3e-128   Sesamum indicum [beniseed]
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             402   5e-128   
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    403   6e-128   Populus euphratica
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         401   1e-127   Jatropha curcas
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    401   3e-127   
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      400   4e-127   
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            400   4e-127   Glycine soja [wild soybean]
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    400   1e-126   Nicotiana tomentosiformis
ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    399   2e-126   Solanum lycopersicum
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    397   8e-126   Solanum tuberosum [potatoes]
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    397   8e-126   Solanum tuberosum [potatoes]
gb|KEH27294.1|  phosphoglucan, water dikinase                           397   1e-125   Medicago truncatula
ref|NP_001274870.1|  glucan/water dikinase                              396   2e-125   Solanum tuberosum [potatoes]
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    396   2e-125   Cicer arietinum [garbanzo]
gb|KJB71923.1|  hypothetical protein B456_011G147600                    394   3e-125   Gossypium raimondii
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    395   3e-125   Gossypium arboreum [tree cotton]
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    395   6e-125   
gb|KJB71922.1|  hypothetical protein B456_011G147600                    394   1e-124   Gossypium raimondii
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    394   1e-124   Nicotiana sylvestris
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             394   1e-124   
gb|KJB71921.1|  hypothetical protein B456_011G147600                    394   1e-124   Gossypium raimondii
ref|XP_008777424.1|  PREDICTED: phosphoglucan, water dikinase, ch...    375   2e-124   Phoenix dactylifera
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    392   7e-124   Ricinus communis
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    391   1e-123   Prunus mume [ume]
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             391   2e-123   Prunus persica
ref|XP_010910272.1|  PREDICTED: phosphoglucan, water dikinase, ch...    365   2e-123   Elaeis guineensis
gb|AFO83531.1|  glucan water dikinase 3                                 388   3e-123   Manihot esculenta [manioc]
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    390   4e-123   Nelumbo nucifera [Indian lotus]
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    390   4e-123   Populus euphratica
gb|KEH44553.1|  phosphoglucan, water dikinase, putative                 390   6e-123   Medicago truncatula
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    389   1e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    389   1e-122   Citrus sinensis [apfelsine]
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    389   1e-122   Fragaria vesca subsp. vesca
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    389   1e-122   Pyrus x bretschneideri [bai li]
ref|XP_010107194.1|  Phosphoglucan, water dikinase                      374   1e-121   
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    384   4e-121   Eucalyptus grandis [rose gum]
gb|AAO64153.1|  unknown protein                                         370   1e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54755.1|  phosphoglucan water dikinase chloroplastic-like p...    354   2e-120   Phaseolus vulgaris [French bean]
gb|AAC26246.1|  contains similarity to phosphoenolpyruvate syntha...    370   3e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10310.1|  unnamed protein product                                378   6e-119   Coffea canephora [robusta coffee]
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                379   8e-119   Erythranthe guttata [common monkey flower]
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    375   2e-117   Arabis alpina [alpine rockcress]
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    372   7e-117   Camelina sativa [gold-of-pleasure]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    373   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             373   1e-116   
ref|NP_001141918.1|  uncharacterized protein LOC100274067               351   1e-116   
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    373   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             372   3e-116   Capsella rubella
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    371   5e-116   Camelina sativa [gold-of-pleasure]
emb|CDY19771.1|  BnaA09g04240D                                          370   1e-115   Brassica napus [oilseed rape]
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    371   1e-115   
emb|CDX87051.1|  BnaC09g03660D                                          369   2e-115   
gb|AFW56444.1|  hypothetical protein ZEAMMB73_583770                    351   2e-115   
ref|NP_198009.3|  phosphoglucan, water dikinase                         368   6e-115   Arabidopsis thaliana [mouse-ear cress]
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       368   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    367   2e-114   Brassica rapa
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    366   3e-114   Brassica rapa
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    363   6e-114   Gossypium arboreum [tree cotton]
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...    365   9e-114   
emb|CDY05529.1|  BnaA02g31620D                                          366   1e-113   
gb|KGN53052.1|  hypothetical protein Csa_4G012480                       365   2e-113   Cucumis sativus [cucumbers]
gb|KJB37917.1|  hypothetical protein B456_006G226300                    362   5e-113   Gossypium raimondii
emb|CDY65142.1|  BnaC02g48400D                                          364   6e-113   Brassica napus [oilseed rape]
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    362   8e-113   Cucumis melo [Oriental melon]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    362   9e-113   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    362   9e-113   Tarenaya hassleriana [spider flower]
gb|AFW56442.1|  hypothetical protein ZEAMMB73_583770                    350   3e-112   
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    361   4e-112   Cucumis melo [Oriental melon]
ref|XP_008661639.1|  PREDICTED: uncharacterized protein LOC100274...    350   1e-111   
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    359   2e-111   Setaria italica
gb|EEC69133.1|  hypothetical protein OsI_38056                          355   5e-110   Oryza sativa Indica Group [Indian rice]
gb|EEE53074.1|  hypothetical protein OsJ_35828                          354   7e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    353   2e-109   Tarenaya hassleriana [spider flower]
ref|NP_001066613.1|  Os12g0297500                                       353   2e-109   
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          352   9e-109   Sorghum bicolor [broomcorn]
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    346   1e-106   Oryza brachyantha
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    345   2e-106   Brachypodium distachyon [annual false brome]
gb|EPS62661.1|  hypothetical protein M569_12127                         330   6e-105   Genlisea aurea
gb|AEN83153.1|  AT5G26570-like protein                                  313   1e-104   Capsella grandiflora
gb|AEN83160.1|  AT5G26570-like protein                                  313   3e-104   Capsella rubella
gb|AEN83155.1|  AT5G26570-like protein                                  312   5e-104   Capsella grandiflora
gb|AEN83164.1|  AT5G26570-like protein                                  312   6e-104   Neslia paniculata [ball mustard]
gb|AEN83154.1|  AT5G26570-like protein                                  311   1e-103   Capsella grandiflora
ref|XP_001752167.1|  predicted protein                                  335   2e-103   
emb|CBI39424.3|  unnamed protein product                                316   8e-96    Vitis vinifera
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970          309   2e-93    Amborella trichopoda
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             295   1e-88    
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              293   7e-88    
ref|XP_001758857.1|  predicted protein                                  293   1e-87    
gb|AEW08242.1|  hypothetical protein 2_4077_01                          211   4e-65    Pinus radiata
gb|AEW08243.1|  hypothetical protein 2_4077_01                          210   7e-65    Pinus lambertiana
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770              223   2e-62    Chlorella variabilis
ref|XP_011396449.1|  Phosphoglucan, water dikinase, chloroplastic       214   1e-59    Auxenochlorella protothecoides
ref|XP_005648862.1|  hypothetical protein COCSUDRAFT_47226              213   4e-59    Coccomyxa subellipsoidea C-169
ref|XP_002504762.1|  alpha phosphoglucan water dikinase                 210   2e-58    Micromonas commoda
gb|KFG41401.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    192   7e-56    Toxoplasma gondii FOU
gb|KFG31024.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    192   1e-54    Toxoplasma gondii p89
ref|XP_003080697.1|  chloroplast alpha-glucan water dikinase isof...    191   1e-53    
ref|XP_001417570.1|  predicted protein                                  194   1e-52    Ostreococcus lucimarinus CCE9901
emb|CEG01409.1|  Carbohydrate binding module family 20                  191   3e-51    Ostreococcus tauri
ref|XP_003059536.1|  predicted protein                                  189   7e-51    Micromonas pusilla CCMP1545
ref|XP_002368480.1|  phosphoglucan, water dikinase protein, putative    190   9e-51    
ref|XP_001419310.1|  predicted protein                                  188   9e-51    Ostreococcus lucimarinus CCE9901
gb|EPR59823.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    190   1e-50    Toxoplasma gondii GT1
ref|XP_002502216.1|  alpha phosphoglucan water dikinase                 186   1e-50    Micromonas commoda
gb|KFG62834.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    190   1e-50    Toxoplasma gondii RUB
gb|ESS33912.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    190   1e-50    Toxoplasma gondii VEG
gb|EPT28056.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    190   1e-50    Toxoplasma gondii ME49
ref|XP_003881249.1|  phosphoenolpyruvate synthase, related              189   2e-50    Neospora caninum Liverpool
ref|XP_007511444.1|  predicted protein                                  187   6e-50    Bathycoccus prasinos
ref|XP_003078935.1|  chloroplast alpha-glucan water dikinase isof...    184   3e-49    
emb|CEF97682.1|  Pyruvate phosphate dikinase,PEP/pyruvate-binding       184   6e-49    Ostreococcus tauri
ref|XP_008889223.1|  pyruvate phosphate dikinase, pep/pyruvate bi...    182   6e-48    
ref|XP_005716854.1|  Phosphoglucan water dikinase, PWD                  175   1e-45    Chondrus crispus [carageen]
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            173   3e-45    
ref|XP_005827807.1|  hypothetical protein GUITHDRAFT_164559             166   1e-42    Guillardia theta CCMP2712
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            155   1e-38    Triticum urartu
emb|CDW77583.1|  water chloroplastic-like                               152   6e-38    Stylonychia lemnae
gb|EJY83942.1|  hypothetical protein OXYTRI_18322                       150   6e-37    Oxytricha trifallax
ref|XP_002949771.1|  hypothetical protein VOLCADRAFT_90138              147   4e-36    Volvox carteri f. nagariensis
ref|XP_001697099.1|  phosphoglucan water dikinase                       129   1e-29    Chlamydomonas reinhardtii
gb|KFG99987.1|  pyruvate phosphate dikinase, pep/pyruvate binding...    120   1e-29    Toxoplasma gondii VAND
ref|XP_003058800.1|  predicted protein                                  127   2e-29    Micromonas pusilla CCMP1545
emb|CDJ38268.1|  phosphoglucan, water dikinase protein, putative        127   2e-29    Eimeria tenella
ref|XP_002502953.1|  carbohydrate-binding module family 20 protein      125   2e-28    Micromonas commoda
ref|WP_037040400.1|  phosphoenolpyruvate synthase                       112   3e-24    
ref|XP_009359183.1|  PREDICTED: alpha-glucan water dikinase, chlo...    106   3e-23    
ref|XP_002506750.1|  predicted protein                                  107   2e-22    Micromonas commoda
ref|WP_037893238.1|  phosphoenolpyruvate synthase                       104   2e-22    
ref|XP_010100417.1|  Alpha-glucan water dikinase                        107   3e-22    
ref|WP_003329829.1|  phosphoenolpyruvate synthase                       106   4e-22    Bacillus azotoformans
ref|XP_006841018.1|  hypothetical protein AMTR_s00085p00105120          106   5e-22    
ref|WP_036094414.1|  phosphoenolpyruvate synthase                       106   5e-22    Listeria newyorkensis
ref|NP_001167723.1|  uncharacterized protein LOC100381411               101   6e-22    
ref|WP_036133343.1|  phosphoenolpyruvate synthase                       105   7e-22    Listeria sp. SHR_NRA_18
ref|WP_027321038.1|  phosphoenolpyruvate synthase                       105   7e-22    Bacillus sp. URHB0009
ref|WP_012984865.1|  phosphoenolpyruvate synthase                       105   7e-22    Listeria seeligeri
gb|AAO42141.1|  unknown protein                                         105   8e-22    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194176.3|  phosphoglucan, water dikinase                         105   8e-22    Arabidopsis thaliana [mouse-ear cress]
emb|CAB45080.1|  putative protein                                       105   8e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340080.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    105   9e-22    Malus domestica [apple tree]
ref|XP_008340079.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    105   9e-22    Malus domestica [apple tree]
ref|XP_001765216.1|  predicted protein                                  105   9e-22    
ref|WP_029442716.1|  phosphoenolpyruvate synthase                       104   1e-21    Bacillus cereus group
ref|WP_033799053.1|  phosphoenolpyruvate synthase                       104   1e-21    Bacillus pseudomycoides
ref|WP_031880289.1|  phosphoenolpyruvate synthase                       104   2e-21    Staphylococcus aureus
gb|EEM15911.1|  Pyruvate phosphate dikinase PEP/pyruvate-binding        104   2e-21    Bacillus pseudomycoides DSM 12442
ref|WP_025364920.1|  phosphoenolpyruvate synthase                       104   2e-21    Paenibacillus polymyxa
ref|XP_006285458.1|  hypothetical protein CARUB_v10006877mg             105   2e-21    Capsella rubella
ref|WP_031461485.1|  phosphoenolpyruvate synthase                       104   2e-21    Paenibacillus polymyxa
ref|WP_044785990.1|  phosphoenolpyruvate synthase                       104   2e-21    Paenibacillus polymyxa
ref|WP_039276034.1|  phosphoenolpyruvate synthase                       104   2e-21    Paenibacillus polymyxa
ref|WP_038243108.1|  phosphoenolpyruvate synthase                       104   2e-21    Virgibacillus massiliensis
ref|WP_020061851.1|  phosphoenolpyruvate synthase                       104   2e-21    Bacillus sp. 123MFChir2
dbj|GAF25000.1|  phosphoenolpyruvate synthase/pyruvate phosphate ...    100   2e-21    Moorella thermoacetica Y72
ref|WP_033221227.1|  phosphoenolpyruvate synthase                       104   2e-21    Streptomyces virginiae
ref|WP_021288956.1|  phosphoenolpyruvate synthase                       103   2e-21    Virgibacillus sp. CM-4
ref|WP_029488334.1|  hypothetical protein                               103   3e-21    Epulopiscium sp. 'N.t. morphotype B'
ref|WP_019687309.1|  phosphoenolpyruvate synthase                       103   3e-21    Paenibacillus polymyxa
ref|WP_016122772.1|  pyruvate, water dikinase                           103   3e-21    Bacillus cereus
ref|XP_007227039.1|  hypothetical protein PRUPE_ppa000209mg             104   3e-21    Prunus persica
ref|WP_043070473.1|  phosphoenolpyruvate synthase                       103   3e-21    Aneurinibacillus migulanus
ref|XP_008245479.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-glucan...    104   3e-21    
ref|WP_043065176.1|  phosphoenolpyruvate synthase                       103   3e-21    Aneurinibacillus migulanus
ref|XP_010439040.1|  PREDICTED: alpha-glucan water dikinase 2-lik...    103   4e-21    
ref|XP_009138061.1|  PREDICTED: alpha-glucan water dikinase 2           103   4e-21    Brassica rapa
ref|WP_043652212.1|  phosphoenolpyruvate synthase                       103   4e-21    Nocardia thailandica
ref|WP_009184780.1|  phosphoenolpyruvate synthase                       100   4e-21    Cecembia lonarensis
ref|WP_038978016.1|  phosphoenolpyruvate synthase                       103   4e-21    Paenibacillus polymyxa
ref|WP_028776059.1|  phosphoenolpyruvate synthase                       103   5e-21    Shimazuella kribbensis
ref|WP_021261137.1|  phosphoenolpyruvate synthase                       103   5e-21    Paenibacillus alvei
ref|XP_010695868.1|  PREDICTED: alpha-glucan water dikinase, chlo...    103   5e-21    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_006521265.1|  phosphoenolpyruvate synthase                       103   5e-21    Desulfallas gibsoniae
ref|XP_010695869.1|  PREDICTED: alpha-glucan water dikinase, chlo...    103   5e-21    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_003745508.1|  phosphoenolpyruvate synthase                       103   5e-21    Listeria seeligeri
ref|WP_044356822.1|  phosphoenolpyruvate synthase                       103   5e-21    Paenibacillus sp. E194
ref|XP_010448564.1|  PREDICTED: alpha-glucan water dikinase 2 iso...    103   6e-21    
ref|WP_016820869.1|  phosphoenolpyruvate synthase                       103   6e-21    Paenibacillus polymyxa
gb|KIZ20338.1|  phosphoenolpyruvate synthase                            102   6e-21    
ref|WP_000336998.1|  phosphoenolpyruvate synthase                       102   6e-21    Bacillus cereus
ref|WP_021255564.1|  phosphoenolpyruvate synthase                       102   6e-21    Paenibacillus alvei
ref|XP_008380715.1|  PREDICTED: alpha-glucan water dikinase 2-like    98.2    6e-21    
ref|XP_010439039.1|  PREDICTED: alpha-glucan water dikinase 2-lik...    103   6e-21    Camelina sativa [gold-of-pleasure]
ref|WP_026591119.1|  phosphoenolpyruvate synthase                       102   7e-21    Bacillus sp. UNC437CL72CviS29
ref|XP_010439038.1|  PREDICTED: alpha-glucan water dikinase 2-lik...    103   7e-21    
ref|XP_010433767.1|  PREDICTED: alpha-glucan water dikinase 2-lik...    103   7e-21    Camelina sativa [gold-of-pleasure]
ref|WP_006920798.1|  Phosphoenolpyruvate synthase                       102   7e-21    Bacillus
ref|XP_002869718.1|  ATGWD2/GWD3                                        103   7e-21    
ref|XP_010433768.1|  PREDICTED: alpha-glucan water dikinase 2-lik...    103   7e-21    
emb|CDY61008.1|  BnaA01g35130D                                          103   7e-21    Brassica napus [oilseed rape]
gb|KHN19640.1|  Alpha-glucan water dikinase, chloroplastic            97.8    8e-21    Glycine soja [wild soybean]
ref|WP_020665142.1|  phosphoenolpyruvate synthase                       102   8e-21    Amycolatopsis benzoatilytica
ref|WP_000094226.1|  MULTISPECIES: phosphoenolpyruvate synthase         102   8e-21    Bacillus cereus group
ref|WP_019419540.1|  phosphoenolpyruvate synthase                       102   9e-21    Paenibacillus sp. OSY-SE
ref|XP_006357619.1|  PREDICTED: starch-granule-bound R1 protein i...    102   9e-21    Solanum tuberosum [potatoes]
ref|XP_011398657.1|  Alpha-glucan water dikinase 2                      102   9e-21    Auxenochlorella protothecoides
gb|EEM21989.1|  Pyruvate phosphate dikinase PEP/pyruvate-binding      99.4    1e-20    Bacillus thuringiensis serovar tochigiensis BGSC 4Y1
ref|XP_008389704.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    102   1e-20    
ref|WP_017437798.1|  hypothetical protein                               102   1e-20    Parageobacillus caldoxylosilyticus
ref|WP_031415026.1|  phosphoenolpyruvate synthase                       102   1e-20    Brevibacillus laterosporus
ref|WP_016427973.1|  hypothetical protein                               102   1e-20    Paenisporosarcina sp. HGH0030
ref|WP_018783970.1|  phosphoenolpyruvate synthase                       102   1e-20    Micromonospora sp. CNB394
ref|WP_018782277.1|  phosphoenolpyruvate synthase                       102   1e-20    Bacillus sp. 95MFCvi2.1
gb|AET60043.1|  phosphoenolpyruvate synthase                            102   1e-20    Paenibacillus terrae HPL-003
ref|WP_040118943.1|  MULTISPECIES: phosphoenolpyruvate synthase         102   1e-20    Bacillus pseudomycoides
emb|CDY56576.1|  BnaC01g41540D                                          102   1e-20    Brassica napus [oilseed rape]
ref|WP_000094208.1|  phosphoenolpyruvate synthase                       102   1e-20    Bacillus cereus
ref|WP_040333309.1|  hypothetical protein                               102   2e-20    Candidatus Magnetobacterium casensis
ref|WP_018956345.1|  phosphoenolpyruvate synthase                       101   2e-20    Streptomyces sp. CNB091
gb|AAK11735.1|  starch associated protein R1                            102   2e-20    Solanum tuberosum [potatoes]
ref|WP_038592318.1|  phosphoenolpyruvate synthase                       101   2e-20    Paenibacillus sp. FSL H7-0357
gb|AFH88388.1|  alpha-glucan water dikinase                             102   2e-20    Solanum tuberosum [potatoes]
ref|WP_033102044.1|  phosphoenolpyruvate synthase                       101   2e-20    Thermoactinomyces daqus
ref|WP_000094184.1|  phosphoenolpyruvate synthase                       101   2e-20    Bacillus cereus
ref|WP_035434231.1|  phosphoenolpyruvate synthase                       101   2e-20    Bacillus sp. UNC322MFChir4.1
ref|WP_000094218.1|  phosphoenolpyruvate synthase                       101   2e-20    Bacillus cereus
sp|Q9AWA5.2|GWD1_SOLTU  RecName: Full=Alpha-glucan water dikinase...    102   2e-20    Solanum tuberosum [potatoes]
ref|WP_027095943.1|  hypothetical protein [                             101   2e-20    [Clostridium] viride
ref|WP_016512624.1|  pyruvate, water dikinase                           101   2e-20    Bacillus
ref|WP_000094180.1|  phosphoenolpyruvate synthase                       101   2e-20    Bacillus cereus
ref|WP_040902026.1|  phosphoenolpyruvate synthase                       101   2e-20    Streptomyces auratus
gb|EJJ02620.1|  phosphoenolpyruvate synthase                            101   2e-20    Streptomyces auratus AGR0001
ref|WP_037768841.1|  phosphoenolpyruvate synthase                       101   2e-20    
ref|WP_017151799.1|  phosphoenolpyruvate synthase                       101   2e-20    Bacillus bingmayongensis
ref|WP_031116207.1|  phosphoenolpyruvate synthase                       101   2e-20    
ref|WP_007717764.1|  phosphoenolpyruvate synthase                       101   2e-20    Brevibacillus sp. BC25
ref|WP_030499139.1|  phosphoenolpyruvate synthase                       101   2e-20    Micromonospora purpureochromogenes
ref|WP_006679725.1|  phosphoenolpyruvate synthase                       101   2e-20    Paenibacillus dendritiformis
ref|WP_040209192.1|  MULTISPECIES: phosphoenolpyruvate synthase         101   3e-20    Bacillus
ref|WP_016110265.1|  pyruvate, water dikinase                           100   3e-20    Bacillus
ref|WP_028596808.1|  phosphoenolpyruvate synthase                       100   3e-20    Paenibacillus assamensis
ref|WP_022916315.1|  phosphoenolpyruvate synthase                       100   3e-20    Ruania albidiflava
gb|KGN51777.1|  hypothetical protein Csa_5G599830                       101   3e-20    Cucumis sativus [cucumbers]
ref|XP_004135261.1|  PREDICTED: alpha-glucan water dikinase, chlo...    101   3e-20    
ref|WP_028408914.1|  phosphoenolpyruvate synthase                       100   3e-20    Bacillus sp. 171095_106
gb|EEM08152.1|  Pyruvate phosphate dikinase PEP/pyruvate-binding        100   3e-20    Bacillus pseudomycoides
ref|WP_039810953.1|  phosphoenolpyruvate synthase                       100   3e-20    Nocardia otitidiscaviarum
ref|WP_016124802.1|  pyruvate, water dikinase                           100   3e-20    Bacillus cereus
ref|WP_033796696.1|  phosphoenolpyruvate synthase                       100   3e-20    Bacillus pseudomycoides
ref|WP_018764676.1|  phosphoenolpyruvate synthase                       100   3e-20    Bacillus
ref|WP_042796964.1|  pyruvate phosphate dikinase                        100   3e-20    Achromobacter insolitus
gb|ERN51134.1|  phosphoenolpyruvate synthase                            100   3e-20    Bacillus marmarensis DSM 21297
ref|WP_000094181.1|  phosphoenolpyruvate synthase                       100   3e-20    Bacillus
ref|WP_002636579.1|  phosphoenolpyruvate synthase                       100   3e-20    Myxococcus hansupus
ref|WP_039873360.1|  phosphoenolpyruvate synthase                       100   3e-20    Paenibacillus sp. FSL R7-0273
ref|WP_033798467.1|  phosphoenolpyruvate synthase                       100   3e-20    Bacillus pseudomycoides
gb|EEM02648.1|  Pyruvate phosphate dikinase PEP/pyruvate-binding        100   3e-20    Bacillus pseudomycoides
ref|WP_031222298.1|  phosphoenolpyruvate synthase                       100   4e-20    
ref|WP_000094211.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus cereus group
ref|XP_009775337.1|  PREDICTED: alpha-glucan water dikinase, chlo...    101   4e-20    Nicotiana sylvestris
ref|XP_008648013.1|  PREDICTED: uncharacterized protein LOC100381...    101   4e-20    
ref|WP_033695837.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus cereus
ref|WP_043529514.1|  phosphoenolpyruvate synthase                       100   4e-20    Actinoplanes utahensis
ref|WP_024121694.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus halotolerans
ref|XP_009775339.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   4e-20    Nicotiana sylvestris
ref|WP_039772488.1|  phosphoenolpyruvate synthase                       100   4e-20    
ref|WP_000094185.1|  MULTISPECIES: phosphoenolpyruvate synthase         100   4e-20    Bacillus
ref|WP_000094206.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus cereus
ref|WP_000094182.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus cereus group
ref|WP_030121085.1|  phosphoenolpyruvate synthase                       100   4e-20    Streptomyces californicus
ref|WP_042978995.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus
gb|ADU10187.1|  pyruvate phosphate dikinase PEP/pyruvate-binding ...    100   4e-20    Micromonospora sp. L5
ref|WP_000094186.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus
ref|WP_000094205.1|  phosphoenolpyruvate synthase                       100   4e-20    Bacillus cereus
ref|WP_041784255.1|  phosphoenolpyruvate synthase                       100   4e-20    Micromonospora sp. L5
ref|XP_002315679.2|  hypothetical protein POPTR_0010s05400g             100   4e-20    Populus trichocarpa [western balsam poplar]
ref|NP_001275052.1|  alpha-glucan water dikinase, chloroplastic         100   4e-20    Solanum tuberosum [potatoes]
ref|WP_025719302.1|  phosphoenolpyruvate synthase                       100   4e-20    Paenibacillus sp. 1-18
gb|EST21669.1|  phosphoenolpyruvate synthase                            100   4e-20    Streptomycetaceae bacterium MP113-05
emb|CAX51386.1|  alpha-glucan water dikinase                          96.3    4e-20    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_042205022.1|  phosphoenolpyruvate synthase                       100   4e-20    Paenibacillus durus
ref|WP_016087276.1|  pyruvate, water dikinase                           100   4e-20    Bacillus cereus
ref|WP_041896108.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|WP_016908197.1|  hypothetical protein                               100   5e-20    
ref|WP_019390709.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|WP_029926773.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|XP_002438419.1|  hypothetical protein SORBIDRAFT_10g017820          100   5e-20    
ref|XP_002270485.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   5e-20    
ref|WP_035195832.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|XP_009417660.1|  PREDICTED: alpha-glucan water dikinase 2 iso...    100   5e-20    
ref|XP_009417659.1|  PREDICTED: alpha-glucan water dikinase 2 iso...    100   5e-20    
ref|WP_000094183.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|WP_020540500.1|  hypothetical protein                               100   5e-20    
ref|XP_010651715.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   5e-20    
ref|XP_008446179.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   5e-20    
ref|WP_023975692.1|  phosphoenolpyruvate synthase                       100   5e-20    
ref|WP_027985146.1|  hypothetical protein                               100   5e-20    
ref|WP_016136760.1|  pyruvate, water dikinase                           100   5e-20    
gb|AII04006.1|  phosphoenolpyruvate synthase                            100   6e-20    
ref|WP_016134858.1|  pyruvate, water dikinase                           100   6e-20    
ref|XP_010023489.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   6e-20    
ref|WP_026889611.1|  phosphoenolpyruvate synthase                       100   6e-20    
ref|XP_010248573.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   6e-20    
gb|EEM59317.1|  Pyruvate phosphate dikinase PEP/pyruvate-binding      98.6    6e-20    
ref|XP_010248572.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   6e-20    
ref|WP_030213709.1|  phosphoenolpyruvate synthase                       100   6e-20    
ref|XP_010023490.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   6e-20    
ref|WP_000535221.1|  phosphoenolpyruvate synthase                     99.8    6e-20    
gb|AFO83529.1|  glucan water dikinase 1                                 100   6e-20    
ref|WP_040103687.1|  phosphoenolpyruvate synthase                     99.8    6e-20    
ref|WP_020120232.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|XP_011464045.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    100   7e-20    
ref|WP_013082734.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|XP_011464043.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    100   7e-20    
gb|EHM24479.1|  phosphoenolpyruvate synthase                          99.8    7e-20    
ref|XP_004298987.1|  PREDICTED: alpha-glucan water dikinase 1, ch...    100   7e-20    
ref|WP_000094178.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_000094228.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_030293817.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_032794369.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_000094174.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
gb|KGT40380.1|  phosphoenolpyruvate synthase                          99.8    7e-20    
ref|WP_000094179.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_000094187.1|  phosphoenolpyruvate synthase                     99.8    7e-20    
ref|WP_000094175.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.8    7e-20    
ref|WP_000094172.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|XP_009631515.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   8e-20    
ref|XP_009631505.1|  PREDICTED: alpha-glucan water dikinase, chlo...    100   8e-20    
ref|WP_000094212.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|WP_030727802.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.8    8e-20    
ref|WP_030117040.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.8    8e-20    
gb|EYU28426.1|  hypothetical protein MIMGU_mgv1a000186mg                100   8e-20    
ref|WP_025710070.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|WP_009612903.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|WP_031052413.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|WP_000094173.1|  phosphoenolpyruvate synthase                     99.8    8e-20    
ref|WP_016108712.1|  pyruvate, water dikinase                         99.8    8e-20    
ref|WP_009708600.1|  phosphoenolpyruvate synthase                     99.4    9e-20    
ref|XP_007513802.1|  predicted protein                                  100   9e-20    
ref|WP_044155596.1|  phosphoenolpyruvate synthase                     99.4    9e-20    
ref|WP_040058030.1|  phosphoenolpyruvate synthase                     99.4    9e-20    
ref|WP_030703546.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.4    1e-19    
ref|WP_033293978.1|  phosphoenolpyruvate synthase                     96.3    1e-19    
ref|WP_021727515.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_000094214.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.4    1e-19    
ref|WP_043389905.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_017212796.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_000007792.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_030796904.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_007379572.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
ref|WP_034105517.1|  phosphoenolpyruvate synthase                     99.4    1e-19    
emb|CAX65642.1|  starch excess                                        99.8    1e-19    
gb|AHZ51500.1|  phosphoenolpyruvate synthase                          97.8    1e-19    
ref|WP_037237659.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_023522367.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
dbj|GAF47910.1|  phosphoenolpyruvate synthase                         99.0    1e-19    
ref|WP_014091875.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
gb|EFI65305.1|  phosphoenolpyruvate synthase                          99.0    1e-19    
ref|WP_030663113.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.0    1e-19    
ref|XP_008795998.1|  PREDICTED: alpha-glucan water dikinase, chlo...  99.4    1e-19    
ref|WP_037619962.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_025677284.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_000094204.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_030328743.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_000094227.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|WP_013371306.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
ref|XP_008795997.1|  PREDICTED: alpha-glucan water dikinase, chlo...  99.4    1e-19    
ref|WP_020271047.1|  putative phosphoenolpyruvate synthase            99.0    1e-19    
ref|WP_000094197.1|  phosphoenolpyruvate synthase                     99.0    1e-19    
gb|EPX60933.1|  Phosphoenolpyruvate synthase                          98.6    1e-19    
ref|WP_030190301.1|  MULTISPECIES: phosphoenolpyruvate synthase       99.0    2e-19    
ref|WP_000094202.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|XP_008795996.1|  PREDICTED: alpha-glucan water dikinase, chlo...  99.4    2e-19    
dbj|GAE98522.1|  phosphoenolpyruvate synthase                         97.1    2e-19    
ref|WP_030342108.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_001982136.1|  MULTISPECIES: phosphoenolpyruvate synthase       98.6    2e-19    
ref|WP_025334959.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_000094171.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|XP_003060221.1|  predicted protein                                98.6    2e-19    
ref|WP_030737365.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_000094201.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_033794131.1|  phosphoenolpyruvate synthase                     96.3    2e-19    
ref|XP_005843373.1|  hypothetical protein CHLNCDRAFT_37464            98.6    2e-19    
ref|WP_030026324.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|XP_011045278.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-glucan...  99.0    2e-19    
ref|WP_042411927.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|XP_004965403.1|  PREDICTED: alpha-glucan water dikinase, chlo...  99.0    2e-19    
ref|WP_016131252.1|  pyruvate, water dikinase                         98.6    2e-19    
ref|WP_044584606.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_037403051.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|XP_004965404.1|  PREDICTED: alpha-glucan water dikinase, chlo...  99.0    2e-19    
ref|WP_043430941.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_030047079.1|  phosphoenolpyruvate synthase                     98.6    2e-19    
ref|WP_030264574.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_010502426.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_016113821.1|  pyruvate, water dikinase                         98.2    2e-19    
ref|WP_007933008.1|  MULTISPECIES: phosphoenolpyruvate synthase       98.2    2e-19    
ref|WP_029438839.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_026561897.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_014313553.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_043054338.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
ref|WP_007087983.1|  phosphoenolpyruvate synthase                     98.2    2e-19    
gb|KHG23044.1|  Alpha-glucan water dikinase, chloroplastic            94.7    3e-19    
ref|WP_030410604.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_042176951.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_000094222.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_000094191.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_043831602.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_034103100.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_000094199.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_008849151.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_026701941.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|WP_016118200.1|  pyruvate, water dikinase                         98.2    3e-19    
ref|WP_000094215.1|  MULTISPECIES: phosphoenolpyruvate synthase       98.2    3e-19    
ref|WP_028400606.1|  phosphoenolpyruvate synthase                     98.2    3e-19    
ref|XP_009392287.1|  PREDICTED: alpha-glucan water dikinase, chlo...  98.6    3e-19    
ref|XP_006656964.1|  PREDICTED: alpha-glucan water dikinase, chlo...  98.6    3e-19    
ref|WP_028532923.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_000094190.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_000094166.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_043981886.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_031059890.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_025695476.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_007269720.1|  phosphoenolpyruvate synthase                     95.1    3e-19    
ref|XP_009392285.1|  PREDICTED: alpha-glucan water dikinase, chlo...  98.2    3e-19    
ref|XP_003061452.1|  predicted protein                                98.2    3e-19    
ref|WP_024571440.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_013562038.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_018393136.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_009085022.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_029515196.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
gb|AHE84526.1|  Phosphoenolpyruvate synthase/pyruvate phosphate d...  97.4    3e-19    
ref|XP_009392286.1|  PREDICTED: alpha-glucan water dikinase, chlo...  98.2    3e-19    
gb|EFR88809.1|  phosphoenolpyruvate synthase                          97.8    3e-19    
ref|WP_034652870.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_014460580.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_000094189.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_000094229.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|NP_001057699.1|  Os06g0498400                                     98.2    3e-19    
gb|EFE74285.1|  phosphoenolpyruvate synthase                          97.8    3e-19    
ref|WP_025966059.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_039273092.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
ref|WP_026220640.1|  phosphoenolpyruvate synthase                     97.8    3e-19    
gb|ERI91878.1|  pyruvate phosphate dikinase, PEP/pyruvate binding...  97.8    3e-19    
ref|WP_029632963.1|  phosphoenolpyruvate synthase [                   97.8    3e-19    
ref|XP_008378607.1|  PREDICTED: alpha-glucan water dikinase 2 iso...  98.2    4e-19    
ref|WP_019489658.1|  phosphoenolpyruvate synthase                     97.8    4e-19    
ref|WP_032771380.1|  MULTISPECIES: phosphoenolpyruvate synthase       97.8    4e-19    
gb|EEC80673.1|  hypothetical protein OsI_23085                        98.2    4e-19    
ref|WP_032772632.1|  phosphoenolpyruvate synthase                     97.8    4e-19    
ref|WP_034570972.1|  phosphoenolpyruvate synthase                     97.8    4e-19    
ref|XP_008378608.1|  PREDICTED: alpha-glucan water dikinase 2 iso...  98.2    4e-19    
ref|WP_042512529.1|  phosphoenolpyruvate synthase                     97.8    4e-19    
ref|WP_016081062.1|  pyruvate, water dikinase                         97.4    4e-19    
gb|ESU49816.1|  phosphoenolpyruvate synthase                          97.8    4e-19    
ref|WP_000094195.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
gb|EEE65768.1|  hypothetical protein OsJ_21446                        98.2    4e-19    
ref|WP_013240458.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
ref|WP_025682978.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
ref|WP_019258621.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
gb|EWS91423.1|  phosphoenolpyruvate synthase                          97.4    4e-19    
gb|EMS68547.1|  Alpha-glucan water dikinase, chloroplastic            97.8    4e-19    
ref|WP_023556462.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
ref|XP_011071128.1|  PREDICTED: alpha-glucan water dikinase, chlo...  97.8    4e-19    
ref|WP_000094198.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
ref|WP_017909753.1|  pyruvate phosphate dikinase                      97.1    4e-19    
ref|WP_002199999.1|  phosphoenolpyruvate synthase                     97.4    4e-19    
ref|WP_043937171.1|  MULTISPECIES: phosphoenolpyruvate synthase       97.4    4e-19    
ref|XP_003552035.1|  PREDICTED: alpha-glucan water dikinase, chlo...  97.8    4e-19    
ref|XP_004509565.1|  PREDICTED: alpha-glucan water dikinase, chlo...  97.8    5e-19    
ref|WP_003231379.1|  phosphoenolpyruvate synthase                     97.4    5e-19    
gb|AHG03162.1|  phosphoenolpyruvate synthase                          97.1    5e-19    
gb|KCZ71385.1|  phosphoenolpyruvate synthase/pyruvate phosphate d...  97.4    5e-19    
ref|WP_036590247.1|  phosphoenolpyruvate synthase                     97.4    5e-19    
ref|WP_007268572.1|  phosphoenolpyruvate synthase                     97.4    5e-19    
ref|WP_040407571.1|  phosphoenolpyruvate synthase                     97.4    5e-19    
ref|WP_029974597.1|  MULTISPECIES: phosphoenolpyruvate synthase       97.4    5e-19    
ref|WP_020814774.1|  phosphoenolpyruvate synthase [                   97.4    5e-19    
ref|WP_037808927.1|  phosphoenolpyruvate synthase                     97.4    5e-19    
gb|AFO83530.1|  glucan water dikinase 2                               97.4    5e-19    
ref|WP_028610871.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_010341049.1|  pyruvate phosphate dikinase                      96.7    5e-19    
ref|XP_011071127.1|  PREDICTED: alpha-glucan water dikinase, chlo...  97.4    5e-19    
ref|WP_000094193.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|XP_003061237.1|  carbohydrate-binding module family 45 protein    97.4    5e-19    
ref|WP_014417992.1|  MULTISPECIES: phosphoenolpyruvate synthase       97.1    5e-19    
ref|WP_030832051.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_030874175.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_031087330.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_001968395.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_030902117.1|  phosphoenolpyruvate synthase                     97.1    5e-19    
ref|WP_026582692.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_036677177.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_025704658.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_031113235.1|  phosphoenolpyruvate synthase                     94.0    6e-19    
ref|WP_040274294.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_044876947.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_038571209.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|XP_011071126.1|  PREDICTED: alpha-glucan water dikinase, chlo...  97.4    6e-19    
ref|WP_029321159.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_033574797.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_026310757.1|  phosphoenolpyruvate synthase                     97.1    6e-19    
ref|WP_014184049.1|  phosphoenolpyruvate synthase                     97.1    6e-19    



>gb|KHN27149.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=369

 Score =   391 bits (1004),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/226 (82%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            IE++  +FP   RLIVRSSANVEDLAG+SAAGLYESIPN SPSNP VFG+ +S+VWAS+Y
Sbjct  52   IESIGRIFPSNARLIVRSSANVEDLAGISAAGLYESIPNASPSNPTVFGNAVSQVWASMY  111

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            TRRAVLSRRA GVPQK+A+MAVL+QEMLSP+LSFVLHT+SPT+ D N VEAEIASGLGET
Sbjct  112  TRRAVLSRRATGVPQKEASMAVLIQEMLSPDLSFVLHTVSPTNQDNNCVEAEIASGLGET  171

Query  422  LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            LASGTRGTPW++SS KFD +V+TLAFANFSEE++V G GPADGEVIRLTVDYSKKPLTVD
Sbjct  172  LASGTRGTPWQISSGKFDGQVKTLAFANFSEELLVRGEGPADGEVIRLTVDYSKKPLTVD  231

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             VFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDIFIVQ+RPQP
Sbjct  232  SVFRGQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIFIVQTRPQP  277



>gb|KEH27296.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=651

 Score =   399 bits (1026),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 189/227 (83%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   I +VWASL
Sbjct  424  IIENIGRMFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFADAIGQVWASL  483

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  484  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTMSPTDQDNNSVEAEIASGLGE  543

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWR+S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKPL+V
Sbjct  544  TLASGTRGTPWRISCGKFDGLVQTLAFANFSEELLVRGAGPADGEVIHLTVDYSKKPLSV  603

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            DPVFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  604  DPVFRRQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  650



>ref|XP_006421072.1| hypothetical protein CICLE_v10006658mg, partial [Citrus clementina]
 gb|ESR34312.1| hypothetical protein CICLE_v10006658mg, partial [Citrus clementina]
Length=515

 Score =   390 bits (1001),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE++E +FP    LIVRSSANVEDLAGMSAAGLYESIPNV+PSN  VF + ++RVWASL
Sbjct  288  IIESIERIFPANAHLIVRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASL  347

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD D NSVEAEIA GLGE
Sbjct  348  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDRDHNSVEAEIAPGLGE  407

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLSS KFD  V+T AFANFSEEM+V G GPADG VIRLTVDYSKKPLTV
Sbjct  408  TLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIRLTVDYSKKPLTV  467

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            DP+FR QLGQRL +VGFFLERKFGCPQDVEGCLVGKDI+ VQ+RPQP
Sbjct  468  DPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYAVQTRPQP  514



>gb|KDO57836.1| hypothetical protein CISIN_1g009825mg [Citrus sinensis]
Length=524

 Score =   390 bits (1002),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE++E +FP    LIVRSSANVEDLAGMSAAGLYESIPNV+PSN  VF + ++RVWASL
Sbjct  297  IIESIERIFPANAHLIVRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASL  356

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD D NSVEAEIA GLGE
Sbjct  357  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDRDHNSVEAEIAPGLGE  416

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLSS KFD  V+T AFANFSEEM+V G GPADG VIRLTVDYSKKPLTV
Sbjct  417  TLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIRLTVDYSKKPLTV  476

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            DP+FR QLGQRL +VGFFLERKFGCPQDVEGCLVGKDI+ VQ+RPQP
Sbjct  477  DPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYAVQTRPQP  523



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   407 bits (1047),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/227 (85%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+ LE +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVS SNPIVFG+ +SRVWASL
Sbjct  961   IIQQLEEIFPTNARLIVRSSANVEDLAGMSAAGLYESIPNVSLSNPIVFGNAVSRVWASL  1020

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQE+LSP+LSFVLHTLSPTDHD NSVEAEIA GLGE
Sbjct  1021  YTRRAVLSRRAAGVAQKDATMAVLVQELLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGE  1080

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEE++V G GPADGEVIRLTVDYSKKP+T+
Sbjct  1081  TLASGTRGTPWRLSSGKFDGLVRTLAFANFSEELLVLGAGPADGEVIRLTVDYSKKPMTI  1140

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGFFLERKFGCPQDVEGC+VGKDIFIVQ+RPQP
Sbjct  1141  DPIFRRQLGQRLGAVGFFLERKFGCPQDVEGCVVGKDIFIVQTRPQP  1187



>gb|KEH27295.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=893

 Score =   399 bits (1024),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 189/227 (83%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   I +VWASL
Sbjct  666  IIENIGRMFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFADAIGQVWASL  725

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  726  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTMSPTDQDNNSVEAEIASGLGE  785

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWR+S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKPL+V
Sbjct  786  TLASGTRGTPWRISCGKFDGLVQTLAFANFSEELLVRGAGPADGEVIHLTVDYSKKPLSV  845

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            DPVFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  846  DPVFRRQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  892



>gb|KJB71924.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=848

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +S+VWASL
Sbjct  621  LIDSIMRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFASAVSQVWASL  680

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRAVLSRRAAGV QKDA MAVLVQEML+P+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  681  YTRRAVLSRRAAGVSQKDATMAVLVQEMLAPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  740

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLSS KFD  V+T+AFANFSEEM+V G  PADGEVIRLTVDYSKKPLTV
Sbjct  741  TLASGTRGTPWRLSSGKFDGLVKTVAFANFSEEMVVSGASPADGEVIRLTVDYSKKPLTV  800

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
            DPVFR QL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQPL
Sbjct  801  DPVFRQQLSQRLSAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQPL  848



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   404 bits (1038),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             IE+L  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPI+FGH I+RVWASLY
Sbjct  983   IESLSKLFPENARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIIFGHAIARVWASLY  1042

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGVPQ  A MAVLVQEMLSP++SFVLHTLSPTD +QN VEAEIA GLGET
Sbjct  1043  TRRAVLSRRAAGVPQNKAVMAVLVQEMLSPDISFVLHTLSPTDKNQNLVEAEIAPGLGET  1102

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRLSS KFD  VQTLAFANFSEE++V   GPADGEVI+LTVDYSKKPLTVD
Sbjct  1103  LASGTRGTPWRLSSGKFDGTVQTLAFANFSEELVVRSVGPADGEVIQLTVDYSKKPLTVD  1162

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             P+FR QLGQRLG VGFFLE+KFGCPQDVEGCLVG DIFIVQ+RPQP
Sbjct  1163  PIFRQQLGQRLGAVGFFLEQKFGCPQDVEGCLVGNDIFIVQTRPQP  1208



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   402 bits (1033),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +++ +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVF + +S+VWASL
Sbjct  911   IVDGIGRMFPDNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFANAVSQVWASL  970

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+AAMAVLVQEMLSP LSFVLHTLSPTD DQNSVEAEIA GLGE
Sbjct  971   YTRRAVLSRRAAGVPQKNAAMAVLVQEMLSPELSFVLHTLSPTDRDQNSVEAEIAPGLGE  1030

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD  V+TLAFANFSEEM+V G GPADG+V RLTVDYSKKPLT+
Sbjct  1031  TLASGTRGTPWRLSCGKFDGHVRTLAFANFSEEMLVSGAGPADGDVNRLTVDYSKKPLTI  1090

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FRHQLGQRL ++GFFLERKFGCPQDVEGC+VGKDIF+VQ+RPQP
Sbjct  1091  DPIFRHQLGQRLCSIGFFLERKFGCPQDVEGCVVGKDIFVVQTRPQP  1137



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   403 bits (1035),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +++ +  MFP  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVF + +S+VWASL
Sbjct  951   IVDGIGQMFPDNTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFTNAVSQVWASL  1010

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+AAMAVLVQEMLSP LSFVLHTLSPTD DQNSVEAEIA GLGE
Sbjct  1011  YTRRAVLSRRAAGVPQKNAAMAVLVQEMLSPELSFVLHTLSPTDRDQNSVEAEIAPGLGE  1070

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD  V+TLAFANFSEEM+V G GPADG+V RLTVDYSKKPLT+
Sbjct  1071  TLASGTRGTPWRLSCGKFDGLVRTLAFANFSEEMLVSGAGPADGDVNRLTVDYSKKPLTI  1130

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FRHQLGQRL ++GFFLERKFGCPQDVEGC+VGKDIF+VQ+RPQP
Sbjct  1131  DPIFRHQLGQRLCSIGFFLERKFGCPQDVEGCVVGKDIFVVQTRPQP  1177



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   401 bits (1030),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I+ +  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPSNP VF + + RVWASLY
Sbjct  888   IDGISRIFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSNPTVFANAVGRVWASLY  947

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTDHD N VEAEIA GLGET
Sbjct  948   TRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNLVEAEIAPGLGET  1007

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S KFD  VQTLAFANFSEEM+V G GPADGEVIRLTVDYSKKPLTVD
Sbjct  1008  LASGTRGTPWRLASGKFDGLVQTLAFANFSEEMLVSGAGPADGEVIRLTVDYSKKPLTVD  1067

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             P+FR QLGQRL  VGFFLERKFGCPQDVEGCL+GKDI+IVQ+RPQP
Sbjct  1068  PIFRRQLGQRLCAVGFFLERKFGCPQDVEGCLIGKDIYIVQTRPQP  1113



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VFG+ +S+VWASL
Sbjct  959   IIQSIGRIFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFGNAVSQVWASL  1018

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPT+ D N VEAEIASGLGE
Sbjct  1019  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTVSPTNQDNNCVEAEIASGLGE  1078

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+SS KFD +VQTLAFANFSEE++V G GPADGEVIRLTVDYSKKPLTV
Sbjct  1079  TLASGTRGTPWRISSGKFDGQVQTLAFANFSEELLVRGAGPADGEVIRLTVDYSKKPLTV  1138

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDIFIVQ+RPQPL
Sbjct  1139  DSVFRGQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIFIVQTRPQPL  1186



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   400 bits (1029),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 192/227 (85%), Positives = 207/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VI+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   IS+VWASL
Sbjct  953   VIDSIIRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFSSAISQVWASL  1012

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDAAMAVLVQEMLSP+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  1013  YTRRAVLSRRAAGVTQKDAAMAVLVQEMLSPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  1072

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+SS KFD  V+TLAFANFSEEM+V G GPADGEVIRLTVDYSKKPLTV
Sbjct  1073  TLASGTRGTPWRVSSGKFDGLVRTLAFANFSEEMVVSGAGPADGEVIRLTVDYSKKPLTV  1132

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FRHQL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQP
Sbjct  1133  DPIFRHQLSQRLCAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQP  1179



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   400 bits (1029),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VFG+ +S+VWASL
Sbjct  952   IIQSIGRIFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFGNAVSQVWASL  1011

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPT+ D N VEAEIASGLGE
Sbjct  1012  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTVSPTNQDNNCVEAEIASGLGE  1071

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+SS KFD +VQTLAFANFSEE++V G GPADGE+IRLTVDYSKKPLTV
Sbjct  1072  TLASGTRGTPWRISSGKFDGQVQTLAFANFSEELLVRGAGPADGEIIRLTVDYSKKPLTV  1131

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDIFIVQ+RPQPL
Sbjct  1132  DSVFRGQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIFIVQTRPQPL  1179



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   400 bits (1027),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE+L  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+PI FGH ++RVWASL
Sbjct  975   VIESLGKLFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPIRFGHAVARVWASL  1034

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N VEAEIA GLGE
Sbjct  1035  YTRRAVLSRRAAGVLQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNLVEAEIAPGLGE  1094

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT+
Sbjct  1095  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNSPADGEVIHLTVDYSKKPLTI  1154

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1155  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1201



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   399 bits (1025),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/227 (83%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE+L  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+P+ FGH ++RVWASL
Sbjct  975   VIESLGEIFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPVRFGHAVARVWASL  1034

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N +EAEIA GLGE
Sbjct  1035  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNFIEAEIAPGLGE  1094

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT+
Sbjct  1095  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNSPADGEVIHLTVDYSKKPLTI  1154

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1155  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1201



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   397 bits (1021),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE+L  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+PI FGH ++RVWASL
Sbjct  975   VIESLGEVFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPIRFGHAVARVWASL  1034

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N +EAEIA GLGE
Sbjct  1035  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNFIEAEIAPGLGE  1094

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT+
Sbjct  1095  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNSPADGEVILLTVDYSKKPLTI  1154

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1155  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1201



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   397 bits (1021),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 206/227 (91%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE+L  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+PI FGH ++RVWASL
Sbjct  979   VIESLGEVFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPIRFGHAVARVWASL  1038

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N +EAEIA GLGE
Sbjct  1039  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNFIEAEIAPGLGE  1098

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT+
Sbjct  1099  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNSPADGEVILLTVDYSKKPLTI  1158

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1159  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1205



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   397 bits (1020),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/227 (83%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +IE +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   I +VWASL
Sbjct  975   IIENIGRMFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFADAIGQVWASL  1034

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  1035  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTMSPTDQDNNSVEAEIASGLGE  1094

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKPL+V
Sbjct  1095  TLASGTRGTPWRISCGKFDGLVQTLAFANFSEELLVRGAGPADGEVIHLTVDYSKKPLSV  1154

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DPVFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  1155  DPVFRRQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  1201



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE L  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+PI FGH ++RVWASL
Sbjct  975   VIERLGEVFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPIRFGHAVARVWASL  1034

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N +EAEIA GLGE
Sbjct  1035  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNFIEAEIAPGLGE  1094

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT+
Sbjct  1095  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNSPADGEVILLTVDYSKKPLTI  1154

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1155  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1201



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE++  MFP    LIVRSSANVEDLAGMSAAGLY+SIPNVSPSNP VFG  ISRVWASL
Sbjct  953   VIESIGRMFPSNACLIVRSSANVEDLAGMSAAGLYDSIPNVSPSNPTVFGDAISRVWASL  1012

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPT+ D N VEAEIASGLGE
Sbjct  1013  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTMSPTNQDNNYVEAEIASGLGE  1072

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKPLTV
Sbjct  1073  TLASGTRGTPWRISCGKFDGLVQTLAFANFSEELLVLGAGPADGEVIHLTVDYSKKPLTV  1132

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DPVFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  1133  DPVFRQQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  1179



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   394 bits (1013),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +S+VWASL
Sbjct  900   LIDSIMRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFASAVSQVWASL  959

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEML+P+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  960   YTRRAVLSRRAAGVSQKDATMAVLVQEMLAPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  1019

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+T+AFANFSEEM+V G  PADGEVIRLTVDYSKKPLTV
Sbjct  1020  TLASGTRGTPWRLSSGKFDGLVKTVAFANFSEEMVVSGASPADGEVIRLTVDYSKKPLTV  1079

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPVFR QL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQPL
Sbjct  1080  DPVFRQQLSQRLSAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQPL  1127



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   395 bits (1015),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +S+VWASL
Sbjct  942   IIDSIMRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFASAVSQVWASL  1001

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  1002  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  1061

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+T+AFANFSEEM+V G  PADGEVIRLTVDYSKKPLTV
Sbjct  1062  TLASGTRGTPWRLSSGKFDGLVKTVAFANFSEEMVVSGASPADGEVIRLTVDYSKKPLTV  1121

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPVFR QL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQPL
Sbjct  1122  DPVFRQQLSQRLSAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQPL  1169



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   395 bits (1015),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE++  MFP    LIVRSSANVEDLAGMSAAGLY+SIPNVSPSNP VFG  ISRVWASL
Sbjct  985   VIESIGRMFPSNACLIVRSSANVEDLAGMSAAGLYDSIPNVSPSNPTVFGDAISRVWASL  1044

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A+MA+L+QEMLSP+LSFVLHT+SPT+ D N VEAEIASGLGE
Sbjct  1045  YTRRAVLSRRAAGVPQKEASMAILIQEMLSPDLSFVLHTMSPTNQDNNYVEAEIASGLGE  1104

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKPLTV
Sbjct  1105  TLASGTRGTPWRISCGKFDGLVQTLAFANFSEELLVLGAGPADGEVIHLTVDYSKKPLTV  1164

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DPVFR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  1165  DPVFRQQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  1211



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +S+VWASL
Sbjct  959   LIDSIMRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFASAVSQVWASL  1018

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEML+P+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  1019  YTRRAVLSRRAAGVSQKDATMAVLVQEMLAPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  1078

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+T+AFANFSEEM+V G  PADGEVIRLTVDYSKKPLTV
Sbjct  1079  TLASGTRGTPWRLSSGKFDGLVKTVAFANFSEEMVVSGASPADGEVIRLTVDYSKKPLTV  1138

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPVFR QL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQPL
Sbjct  1139  DPVFRQQLSQRLSAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQPL  1186



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 203/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VIE L  +F G  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPS+PI FGH ++RVWASL
Sbjct  973   VIENLGKLFSGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSPSDPIRFGHAVARVWASL  1032

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ N VEAEIA GLGE
Sbjct  1033  YTRRAVLSRRAAGVLQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNFVEAEIAPGLGE  1092

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFDD V+TLAFANFSEEM+V G  PADGEVI LTVDYSKKPLT 
Sbjct  1093  TLASGTRGTPWRLSSGKFDDTVRTLAFANFSEEMVVGGNTPADGEVIHLTVDYSKKPLTY  1152

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGF+LERKFG PQDVEGCLVG +IFIVQSRPQP
Sbjct  1153  DPIFRRQLGQRLGAVGFYLERKFGSPQDVEGCLVGNEIFIVQSRPQP  1199



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   394 bits (1011),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/226 (83%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I+ +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP  F + +S+VWASLY
Sbjct  934   IDGIGRMFPDNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTAFANAVSQVWASLY  993

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHTLSPTD DQNSVEAEIA GLGET
Sbjct  994   TRRAVLSRRAAGVPQKDATMAVLVQEMLSPDLSFVLHTLSPTDRDQNSVEAEIAPGLGET  1053

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRLS  KFD  V+TLAFANFSEEM+V G GPADG+V RLTVDYSKKPLTVD
Sbjct  1054  LASGTRGTPWRLSCGKFDGHVRTLAFANFSEEMLVSGAGPADGDVTRLTVDYSKKPLTVD  1113

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             P+FRHQLGQRL +VGFFLER+FG PQDVEGC+VGKDI++VQ+RPQP
Sbjct  1114  PIFRHQLGQRLCSVGFFLEREFGSPQDVEGCVVGKDIYVVQTRPQP  1159



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +S+VWASL
Sbjct  959   LIDSIMRVFPGNVRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFASAVSQVWASL  1018

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEML+P+LSFVLHTLSPTDHD N VEAEIA GLGE
Sbjct  1019  YTRRAVLSRRAAGVSQKDATMAVLVQEMLAPDLSFVLHTLSPTDHDHNYVEAEIAPGLGE  1078

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+T+AFANFSEEM+V G  PADGEVIRLTVDYSKKPLTV
Sbjct  1079  TLASGTRGTPWRLSSGKFDGLVKTVAFANFSEEMVVSGASPADGEVIRLTVDYSKKPLTV  1138

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPVFR QL QRL  VGFFLERKFGCPQDVEGC++GKDI++VQ+RPQPL
Sbjct  1139  DPVFRQQLSQRLSAVGFFLERKFGCPQDVEGCVLGKDIYVVQTRPQPL  1186



>ref|XP_008777424.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=484

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            IE +  + P   RLIVRSSANVEDLAGMSAAGLYES+PNVS SN  VF   + RVWASLY
Sbjct  259  IEAIAKILPNNARLIVRSSANVEDLAGMSAAGLYESVPNVSLSNQSVFRAAVGRVWASLY  318

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            TRRA+LSRRAAGVPQKDA MAVLVQEML PNLSFVLHT+ PTDHD   VEAEIA GLGET
Sbjct  319  TRRAILSRRAAGVPQKDAMMAVLVQEMLYPNLSFVLHTVCPTDHDPTLVEAEIAPGLGET  378

Query  422  LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            LASGTRGTPWRLSS KF+ +V+TLAFANFSEE++V   GPA+GEVI LTVDYSKKPLT+D
Sbjct  379  LASGTRGTPWRLSSGKFNGRVKTLAFANFSEELLVLSAGPANGEVIHLTVDYSKKPLTID  438

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             +FR QLGQRL ++GFFLE+KFGCPQDVEGC+VGKDIFIVQ+RPQP
Sbjct  439  SIFRRQLGQRLCSIGFFLEQKFGCPQDVEGCVVGKDIFIVQTRPQP  484



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   392 bits (1006),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +++ +  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPI+F + +S+VWASL
Sbjct  948   IVDGIGRIFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIIFANAVSQVWASL  1007

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTD++ NSVEAEIA GLGE
Sbjct  1008  YTRRAVLSRRAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDNNHNSVEAEIAPGLGE  1067

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  ++TLAFANFSEEM+V   GPADGEVI LTVDYSKKPLTV
Sbjct  1068  TLASGTRGTPWRLSSGKFDGVIRTLAFANFSEEMLVSAAGPADGEVICLTVDYSKKPLTV  1127

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRL  VGFFLERKFGCPQDVEGCLVGKDI+IVQ+RPQP
Sbjct  1128  DPIFRRQLGQRLCAVGFFLERKFGCPQDVEGCLVGKDIYIVQTRPQP  1174



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   391 bits (1005),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I  +  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVS SNP VF + ISRVWASL
Sbjct  965   IINGIGRIFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSVSNPTVFANAISRVWASL  1024

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRR+AGVPQK+A MA+LVQEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  1025  YTRRAVLSRRSAGVPQKEATMAILVQEMLSPDLSFVLHTVSPTDQDHNSVEAEIASGLGE  1084

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEE++  GTGPADGEVI LTVDYSKKPLTV
Sbjct  1085  TLASGTRGTPWRLSSGKFDGNVRTLAFANFSEELL--GTGPADGEVIHLTVDYSKKPLTV  1142

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DP+FR QLGQRL TVGFFLE+KFGCPQD+EGC+VGKDI+IVQ+RPQPL
Sbjct  1143  DPIFRQQLGQRLSTVGFFLEQKFGCPQDIEGCVVGKDIYIVQTRPQPL  1190



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   391 bits (1005),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 207/228 (91%), Gaps = 2/228 (1%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I  +  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVS SNP VF + ISRVWASL
Sbjct  966   IINGIGRIFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSVSNPTVFANAISRVWASL  1025

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRR+AGVPQK+A MA+LVQEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  1026  YTRRAVLSRRSAGVPQKEATMAILVQEMLSPDLSFVLHTVSPTDQDHNSVEAEIASGLGE  1085

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEE++  GTGPADGEVI LTVDYSKKPLTV
Sbjct  1086  TLASGTRGTPWRLSSGKFDGNVRTLAFANFSEELL--GTGPADGEVIHLTVDYSKKPLTV  1143

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DP+FR QLGQRL TVGFFLE+KFGCPQD+EGC+VGKDI+IVQ+RPQPL
Sbjct  1144  DPIFRQQLGQRLSTVGFFLEQKFGCPQDIEGCVVGKDIYIVQTRPQPL  1191



>ref|XP_010910272.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Elaeis guineensis]
Length=302

 Score =   365 bits (938),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            IE +  + P   RLIVRSSANVEDLAGMSAAGLYES+PNVS  N  VF   + RVWASLY
Sbjct  77   IEAIAKILPNNARLIVRSSANVEDLAGMSAAGLYESVPNVSLLNQSVFRAAVGRVWASLY  136

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            TRRA+LSRRAAGVPQK+A MAVLVQEM+ P+LSFVLHT+SPTDHD   VEAEIA GLGET
Sbjct  137  TRRAILSRRAAGVPQKNAMMAVLVQEMMYPDLSFVLHTVSPTDHDPTLVEAEIAPGLGET  196

Query  422  LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            LASGTRGTPWRLSS KFD +V+TLAFANFSEE++V   GPA+GEVI LTVDYSKKPLT+D
Sbjct  197  LASGTRGTPWRLSSGKFDGRVKTLAFANFSEELLVLSAGPANGEVIHLTVDYSKKPLTID  256

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQ  108
             +FR QLGQRL  +GFFLE+KFGCPQDVEGC+VGKDIFIVQ+RPQ
Sbjct  257  SIFRRQLGQRLCAIGFFLEQKFGCPQDVEGCVVGKDIFIVQTRPQ  301



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/227 (81%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +++ +  +FPG  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF + +S+VWASL
Sbjct  858   ILDGIGRIFPGNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFANAVSQVWASL  917

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QKDA+MAVLVQEMLSP++SFVLHT+SPTD + N VEAEIA GLGE
Sbjct  918   YTRRAVLSRRAAGVSQKDASMAVLVQEMLSPDISFVLHTVSPTDREHNLVEAEIAPGLGE  977

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD  V+T+AFANFSEEM+V G GPADGEVIRL VDYSKKPLT+
Sbjct  978   TLASGTRGTPWRLSCGKFDGLVRTMAFANFSEEMLVSGAGPADGEVIRLVVDYSKKPLTI  1037

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGFFLERKFGCPQDVEGC+VG DI+IVQ+RPQP
Sbjct  1038  DPIFRRQLGQRLGAVGFFLERKFGCPQDVEGCVVGNDIYIVQTRPQP  1084



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   390 bits (1002),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 190/228 (83%), Positives = 204/228 (89%), Gaps = 1/228 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPS-NPIVFGHCISRVWASL  606
             I  +  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVS S NP VFG  + RVWASL
Sbjct  970   IVEIAKLFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSASSNPTVFGAAVGRVWASL  1029

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQ++AAMAVLVQEMLSP+LSFVLHTLSPTD DQN VEAEIA GLGE
Sbjct  1030  YTRRAVLSRRAAGVPQREAAMAVLVQEMLSPDLSFVLHTLSPTDRDQNLVEAEIAPGLGE  1089

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD +V TLAFANFSEE++V G GPADGEV+RLTVDYSKKPLTV
Sbjct  1090  TLASGTRGTPWRLSSGKFDGRVSTLAFANFSEELLVLGAGPADGEVMRLTVDYSKKPLTV  1149

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DP+FR QLGQRL  VGFFLE+KFGCPQDVEGC+VGKDIFIVQ+RPQPL
Sbjct  1150  DPIFRRQLGQRLCAVGFFLEQKFGCPQDVEGCVVGKDIFIVQTRPQPL  1197



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   390 bits (1001),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I+ +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP  F + +S+VWASLY
Sbjct  946   IDGIGRMFPDNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTAFTNAVSQVWASLY  1005

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHT+SPTD DQNSVEAEIA GLGET
Sbjct  1006  TRRAVLSRRAAGVPQKDATMAVLVQEMLSPDLSFVLHTVSPTDRDQNSVEAEIAPGLGET  1065

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRLS  KFD  V+TLAFANFSEEM+V G GPADG+V RLTVDYSKKPLTVD
Sbjct  1066  LASGTRGTPWRLSCGKFDGHVRTLAFANFSEEMLVSGAGPADGDVTRLTVDYSKKPLTVD  1125

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             P+FRHQLGQRL +VGFFLER+FG PQDVEGC+VG+DI++VQ+RPQP
Sbjct  1126  PIFRHQLGQRLCSVGFFLEREFGSPQDVEGCVVGEDIYVVQTRPQP  1171



>gb|KEH44553.1| phosphoglucan, water dikinase, putative [Medicago truncatula]
Length=1226

 Score =   390 bits (1002),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 186/227 (82%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +IE +  MFP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   I +VWASL
Sbjct  999   IIENIGRMFPSNARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFADAIGQVWASL  1058

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAG+PQK+A+MA+L+QEMLSP+LSFVLHT+SPTD D NSVEAEIASGLGE
Sbjct  1059  YTRRAVLSRRAAGLPQKEASMAILIQEMLSPDLSFVLHTMSPTDQDNNSVEAEIASGLGE  1118

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPW +S  KFD  VQTLAFANFSEE++V G GPADGEVI LTVDYSKKP TV
Sbjct  1119  TLASGTRGTPWCISCGKFDGLVQTLAFANFSEELLVRGAGPADGEVIHLTVDYSKKPPTV  1178

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DPVFR QLGQRL  VGFFLERKFGCPQD EGCLVGKDI+IVQ+RPQP
Sbjct  1179  DPVFRRQLGQRLCAVGFFLERKFGCPQDAEGCLVGKDIYIVQTRPQP  1225



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP VF   +SRVWASL
Sbjct  962   IIQSIAEIFPSTARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPTVFDSAVSRVWASL  1021

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QK A MAVLVQEMLSP LSFVLHTLSPTD+D+N VEAEIA GLGE
Sbjct  1022  YTRRAVLSRRAAGVAQKKAQMAVLVQEMLSPTLSFVLHTLSPTDNDRNVVEAEIAPGLGE  1081

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEEM+V   GPADGEVI LTVDYSKKPLTV
Sbjct  1082  TLASGTRGTPWRLSSGKFDGSVKTLAFANFSEEMLVGRAGPADGEVIHLTVDYSKKPLTV  1141

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPV+R QLGQRL  VGFFLERKFGCPQDVEGCLVG D++IVQ+RPQPL
Sbjct  1142  DPVYRRQLGQRLCAVGFFLERKFGCPQDVEGCLVGNDVYIVQTRPQPL  1189



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   389 bits (999),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +IE++E +FP    LIVRSSANVEDLAGMSAAGLYESIPNV+PSN  VF + ++RVWASL
Sbjct  963   IIESIERIFPANAHLIVRSSANVEDLAGMSAAGLYESIPNVNPSNLRVFQNAVARVWASL  1022

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSR+AAGV QKDA MAVLVQEMLSP+LSFVLHTLSPTDHD NSVEAEIA GLGE
Sbjct  1023  YTRRAVLSRQAAGVSQKDATMAVLVQEMLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGE  1082

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+T AFANFSEEM+V G GPADG VI LTVDYSKKPLTV
Sbjct  1083  TLASGTRGTPWRLSSGKFDGLVRTQAFANFSEEMLVSGAGPADGVVIHLTVDYSKKPLTV  1142

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRL +VGFFLERKFGCPQDVEGCLVGKDI++VQ+RPQP
Sbjct  1143  DPIFRRQLGQRLCSVGFFLERKFGCPQDVEGCLVGKDIYVVQTRPQP  1189



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 204/228 (89%), Gaps = 2/228 (1%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+ +  +FPG +RLIVRSSANVEDLAGMSAAGLY+SIPNVS SNP VF   ISRVWASL
Sbjct  966   IIDRIAKIFPGNSRLIVRSSANVEDLAGMSAAGLYDSIPNVSLSNPTVFASSISRVWASL  1025

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRR AGVPQKDA MA+LVQEMLSP+LSFVLHT+SPTD D N VEAEIASGLGE
Sbjct  1026  YTRRAVLSRRIAGVPQKDATMAILVQEMLSPDLSFVLHTVSPTDQDHNLVEAEIASGLGE  1085

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+SS KFD  V+TLAFANFSEE++  G GPADGEVI LTVDYSKKPLTV
Sbjct  1086  TLASGTRGTPWRISSGKFDGNVRTLAFANFSEELL--GAGPADGEVIHLTVDYSKKPLTV  1143

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DPVFR QLGQ LG VGFFLE+KFGCPQDVEGC+VGKDIFIVQ+RPQPL
Sbjct  1144  DPVFRRQLGQCLGAVGFFLEQKFGCPQDVEGCVVGKDIFIVQTRPQPL  1191



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/228 (82%), Positives = 206/228 (90%), Gaps = 2/228 (1%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVS SNP VF + ISRVWASL
Sbjct  960   IIDSIGKIFPGNARLIVRSSANVEDLAGMSAAGLYDSIPNVSVSNPTVFANAISRVWASL  1019

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQK+A MA+LVQEMLSP+LSFVLHT+SPTDHD NSVEAEIASGLGE
Sbjct  1020  YTRRAVLSRRAAGVPQKEATMAILVQEMLSPDLSFVLHTVSPTDHDHNSVEAEIASGLGE  1079

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEE++  G   ADGEVI LTVDYSKKPLTV
Sbjct  1080  TLASGTRGTPWRLSSGKFDGSVRTLAFANFSEELV--GAVLADGEVIHLTVDYSKKPLTV  1137

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DP+FR QLGQRL TVGFFLERKFG PQD+EGCLVGKDI+IVQ+RPQPL
Sbjct  1138  DPIFRQQLGQRLSTVGFFLERKFGSPQDIEGCLVGKDIYIVQTRPQPL  1185



>ref|XP_010107194.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14218.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=688

 Score =   374 bits (960),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +I+++E +FP   RLIVRSSANVEDL+G+SAAGLYESIPNVS SNP + G+ ISRVWASL
Sbjct  461  IIDSIEKIFPRDARLIVRSSANVEDLSGLSAAGLYESIPNVSTSNPSILGNAISRVWASL  520

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRA+LSRRAAGVPQ +A+MAVLVQEMLSP+LSFVLHT SPTD D   VEAEIASGLGE
Sbjct  521  YTRRAILSRRAAGVPQGEASMAVLVQEMLSPDLSFVLHTQSPTDQDNKYVEAEIASGLGE  580

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGT WRLSS KFD  V+TL+FANFSEE+ V   G ADGEVI LTVDYSKK LTV
Sbjct  581  TLASGTRGTAWRLSSEKFDGTVRTLSFANFSEELAVLAAGAADGEVIHLTVDYSKKALTV  640

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
            DP+FR Q+GQRLG VGFFLE+KFGCPQDVEGC+VGK IF+VQ+RPQPL
Sbjct  641  DPIFRRQIGQRLGAVGFFLEQKFGCPQDVEGCVVGKYIFVVQTRPQPL  688



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   384 bits (987),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 205/227 (90%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             + E++  +FPG  RLIVRSSANVEDLAGMSAAGLY+SIPNVSPSNP VFG+ IS+VWASL
Sbjct  962   ITESIGKIFPGSPRLIVRSSANVEDLAGMSAAGLYDSIPNVSPSNPGVFGNAISKVWASL  1021

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSR+AA VPQK+A MA+LVQEMLSP+LSFVLHTLSPTD D NSVEAEIA GLGE
Sbjct  1022  YTRRAVLSRQAAKVPQKEATMAILVQEMLSPDLSFVLHTLSPTDRDSNSVEAEIAPGLGE  1081

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD  ++TLAFANFS+E++V G+GPADGEVI+LTVDYS+KPLT 
Sbjct  1082  TLASGTRGTPWRLSCGKFDGVIKTLAFANFSQELLVLGSGPADGEVIKLTVDYSEKPLTT  1141

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLGT+G FLERKFG PQDVEGC+VG DIFIVQ+RPQP
Sbjct  1142  DPIFRRQLGQRLGTLGLFLERKFGSPQDVEGCVVGNDIFIVQTRPQP  1188



>gb|AAO64153.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00535.1| hypothetical protein [Arabidopsis thaliana]
Length=632

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            I ++   F    RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  406  INSISKAFLKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLY  465

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            TRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  466  TRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  525

Query  422  LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            LASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD
Sbjct  526  LASGTRGTPWRLASGKLDGVVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVD  585

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  586  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  632



>gb|AGV54755.1| phosphoglucan water dikinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=200

 Score =   354 bits (909),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -2

Query  701  MSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEM  522
            MSAAGLYESIPNVSPSNP VF + +S+VWASLYTRRAVLSRRAAGVPQ +A+MAVL+QEM
Sbjct  1    MSAAGLYESIPNVSPSNPTVFANAVSKVWASLYTRRAVLSRRAAGVPQIEASMAVLIQEM  60

Query  521  LSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSSKFDDKVQTLAFA  342
            LSP+LSFVLHT+SPT  D N VEAEIASGLGETLASGTRGTPWRLSS KFD +VQTLAFA
Sbjct  61   LSPDLSFVLHTVSPTKQDNNCVEAEIASGLGETLASGTRGTPWRLSSGKFDGQVQTLAFA  120

Query  341  NFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
            N SEE++V G GPADGEVIRL VDYSKKPLTVD  FR QLGQRL  VGFFLERKFGCPQD
Sbjct  121  NLSEELLVRGAGPADGEVIRLIVDYSKKPLTVDSTFRRQLGQRLCAVGFFLERKFGCPQD  180

Query  161  VEGCLVGKDIFIVQSRPQPL  102
            VEGCLVGKDIFIVQ+RPQPL
Sbjct  181  VEGCLVGKDIFIVQTRPQPL  200



>gb|AAC26246.1| contains similarity to phosphoenolpyruvate synthase (ppsA) (GB:AE001056) 
[Arabidopsis thaliana]
Length=662

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            I ++   F    RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  436  INSISKAFLKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLY  495

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            TRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  496  TRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  555

Query  422  LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            LASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD
Sbjct  556  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVD  615

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  616  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  662



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   378 bits (971),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             ++E+L  +F    RL VRSSANVEDLAGMSAAGLYESIPNVS SNP++FG  ISRVW SL
Sbjct  917   IMESLGKVFSANARLYVRSSANVEDLAGMSAAGLYESIPNVSLSNPLIFGRAISRVWTSL  976

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSR+AAGVPQK AAMAVLVQEMLSP LSFVLHTL+PTD D+NSV AEIA GLGE
Sbjct  977   YTRRAVLSRKAAGVPQKQAAMAVLVQEMLSPVLSFVLHTLNPTDLDRNSVAAEIAPGLGE  1036

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V TLAFANFSEE++V G GPADGEV  LTVDYS+KPLTV
Sbjct  1037  TLASGTRGTPWRLSSGKFDALVCTLAFANFSEELVVRGAGPADGEVFHLTVDYSQKPLTV  1096

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             D VFR QLGQ+LG VG+FLERKFGCPQDVEGCL+G DI+IVQ+RPQP
Sbjct  1097  DAVFRQQLGQQLGAVGYFLERKFGCPQDVEGCLLGTDIYIVQTRPQP  1143



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   379 bits (972),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 200/227 (88%), Gaps = 1/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQ-TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             IE+L  +FP + TRLIVRSSANVEDLAGMSAAGLY+SIPNVS SNPIVF   ++RVWASL
Sbjct  963   IESLSKIFPEKNTRLIVRSSANVEDLAGMSAAGLYDSIPNVSLSNPIVFKQAVARVWASL  1022

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV Q +A MAVLVQEMLSP  SFVLHT+SPTD +QN VE+EIA GLGE
Sbjct  1023  YTRRAVLSRRAAGVAQSEAVMAVLVQEMLSPEFSFVLHTVSPTDKNQNLVESEIAPGLGE  1082

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  VQTLAFANFSEEM+V G GPADGEV+RLTVDYSKK LTV
Sbjct  1083  TLASGTRGTPWRLSSGKFDGAVQTLAFANFSEEMVVRGGGPADGEVVRLTVDYSKKALTV  1142

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             D VFR QLGQRLG VG FLE+KFGC QDVEGCLVG+D+FIVQ+RPQP
Sbjct  1143  DSVFRQQLGQRLGAVGLFLEQKFGCAQDVEGCLVGEDVFIVQTRPQP  1189



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   375 bits (962),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  954   INSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLY  1013

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGVPQ++A MAVLVQEMLSP+LSFVLHT+SP D D N VE+EIA GLGET
Sbjct  1014  TRRAVLSRRAAGVPQREATMAVLVQEMLSPDLSFVLHTVSPADPDSNLVESEIAPGLGET  1073

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD
Sbjct  1074  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVD  1133

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D+FIVQSRPQPL
Sbjct  1134  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVFIVQSRPQPL  1180



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   372 bits (956),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASL
Sbjct  899   TINSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSGSVCQVWASL  958

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  959   YTRRAVLSRRAAGVTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1018

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTV
Sbjct  1019  TLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTV  1078

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1079  DSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1126



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   373 bits (957),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASL
Sbjct  955   TINSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSGSVCQVWASL  1014

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1015  YTRRAVLSRRAAGVTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1074

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTV
Sbjct  1075  TLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTV  1134

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1135  DSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1182



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   373 bits (957),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF + + +VWASL
Sbjct  966   TINSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSNSVCQVWASL  1025

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAG+ Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1026  YTRRAVLSRRAAGISQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1085

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTV
Sbjct  1086  TLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTV  1145

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1146  DSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1193



>ref|NP_001141918.1| uncharacterized protein LOC100274067 [Zea mays]
 gb|ACF87306.1| unknown [Zea mays]
 gb|AFW56445.1| hypothetical protein ZEAMMB73_583770 [Zea mays]
Length=374

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE+L+  F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  FG  + +VWASL
Sbjct  147  IIESLKKTFDQNVRLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPRSFGAAVGQVWASL  206

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRA+LSRRAAGVPQ+DA MAVLVQEML P+LSFVLHT+SP DHD   VEAE+A GLGE
Sbjct  207  YTRRAILSRRAAGVPQRDAKMAVLVQEMLQPDLSFVLHTISPVDHDPKLVEAEVAPGLGE  266

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLS  K D KV TLAFANFSEE++V  +GP DGE+ R TVDYSKKPL+V
Sbjct  267  TLASGTRGTPWRLSCHKLDGKVTTLAFANFSEELMVLNSGPTDGEMSRRTVDYSKKPLSV  326

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            D  FR Q GQRL  +G +LE+KFG  QDVEGCLVG DIFIVQSRPQP
Sbjct  327  DATFREQFGQRLAAIGQYLEQKFGSAQDVEGCLVGPDIFIVQSRPQP  373



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   373 bits (957),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  968   INSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSGSVCQVWASLY  1027

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  1028  TRRAVLSRRAAGVTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  1087

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWR++S K D  VQTLAFANFSEE+IV GTGPADG+ +RLTVDYSKK LTVD
Sbjct  1088  LASGTRGTPWRVASGKLDGIVQTLAFANFSEELIVSGTGPADGKYVRLTVDYSKKRLTVD  1147

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1148  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1194



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   372 bits (954),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  969   ISSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLY  1028

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  1029  TRRAVLSRRAAGVTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  1088

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  VQTLAFANFSEE+ V GTGPADG+ +RLTVDYSKK LTVD
Sbjct  1089  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELFVSGTGPADGKYVRLTVDYSKKRLTVD  1148

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1149  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1195



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   371 bits (953),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLY
Sbjct  968   INSISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSGSVCQVWASLY  1027

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  1028  TRRAVLSRRAAGVTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  1087

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWR++S K D  VQTLAFANFSEE+IV GTGPADG+  RLTVDYSKK LTVD
Sbjct  1088  LASGTRGTPWRVASGKLDGIVQTLAFANFSEELIVSGTGPADGKYARLTVDYSKKRLTVD  1147

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1148  SVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1194



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   370 bits (949),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I T+   FP + RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   I +VWASL
Sbjct  952   TINTISKTFPQEARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSICQVWASL  1011

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1012  YTRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1071

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  V+TLAFANFSEE++V G GPADG+ +RLTVDYSKK LTV
Sbjct  1072  TLASGTRGTPWRLASGKLDGIVETLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTV  1131

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1132  DSVFRQKLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1179



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   371 bits (952),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             +E +  + P  TRLIVRSSANVEDLAGMSAAGLYES+PNVS SNP  FG  + RVWASLY
Sbjct  1039  VEAIGKILPINTRLIVRSSANVEDLAGMSAAGLYESVPNVSLSNPGAFGAAVGRVWASLY  1098

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRA+LSRR AG+PQKDA MAVLVQEML P+LSFVLHT+SP D D   VEAEIA GLGET
Sbjct  1099  TRRAILSRRTAGIPQKDAMMAVLVQEMLFPDLSFVLHTVSPIDRDAKVVEAEIAPGLGET  1158

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRLSS KFD KV TLAFANFSEE++V  +GPA+GE IRLTVDYSKKPLT+D
Sbjct  1159  LASGTRGTPWRLSSGKFDGKVTTLAFANFSEELLVLNSGPANGEFIRLTVDYSKKPLTID  1218

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             P++R Q+GQRL T+GFFLE+KFGCPQDVEGC+VGKDIFIVQ+RPQP
Sbjct  1219  PIYRRQIGQRLCTIGFFLEQKFGCPQDVEGCVVGKDIFIVQTRPQP  1264



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   369 bits (948),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I T+   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   I +VWASLY
Sbjct  956   INTISKAFPKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSICQVWASLY  1015

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGET
Sbjct  1016  TRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGET  1075

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  V+TLAFANFSEE++V G GPADG+ +RLTVDYSKK LTVD
Sbjct  1076  LASGTRGTPWRLASGKLDGIVETLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTVD  1135

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1136  SVFRQKLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1182



>gb|AFW56444.1| hypothetical protein ZEAMMB73_583770 [Zea mays]
Length=467

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE+L+  F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  FG  + +VWASL
Sbjct  240  IIESLKKTFDQNVRLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPRSFGAAVGQVWASL  299

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRA+LSRRAAGVPQ+DA MAVLVQEML P+LSFVLHT+SP DHD   VEAE+A GLGE
Sbjct  300  YTRRAILSRRAAGVPQRDAKMAVLVQEMLQPDLSFVLHTISPVDHDPKLVEAEVAPGLGE  359

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLS  K D KV TLAFANFSEE++V  +GP DGE+ R TVDYSKKPL+V
Sbjct  360  TLASGTRGTPWRLSCHKLDGKVTTLAFANFSEELMVLNSGPTDGEMSRRTVDYSKKPLSV  419

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            D  FR Q GQRL  +G +LE+KFG  QDVEGCLVG DIFIVQSRPQP
Sbjct  420  DATFREQFGQRLAAIGQYLEQKFGSAQDVEGCLVGPDIFIVQSRPQP  466



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   368 bits (945),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I ++   F    RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASL
Sbjct  969   TINSISKAFLKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASL  1028

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1029  YTRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1088

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTV
Sbjct  1089  TLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTV  1148

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1149  DSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1196



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   368 bits (945),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I ++   F    RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASL
Sbjct  969   TINSISKAFLKDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASL  1028

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1029  YTRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1088

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTV
Sbjct  1089  TLASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTV  1148

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR QLGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1149  DSVFRQQLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1196



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   367 bits (941),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
              I T+   F  + RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   I +VWASL
Sbjct  957   TINTISKTFSQEARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSICQVWASL  1016

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGE
Sbjct  1017  YTRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGE  1076

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRL+S K D  V+TLAFANFSEE++V G GPADG+ +RLTVDYSKK LTV
Sbjct  1077  TLASGTRGTPWRLASGKLDGIVETLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTV  1136

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             D VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1137  DSVFRQKLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1184



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   366 bits (939),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 197/227 (87%), Gaps = 0/227 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P VF   + RVWASLY
Sbjct  930   INSISKAFPKDTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPSVFSASVCRVWASLY  989

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV Q +A+MAVLVQEMLSP+LSFVLHT+SP+D   N VEAEIA GLGET
Sbjct  990   TRRAVLSRRAAGVSQIEASMAVLVQEMLSPDLSFVLHTVSPSDPGTNLVEAEIAPGLGET  1049

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  VQTLAFANFSEE++V G GPADG+ +RLTVDYSKK LTVD
Sbjct  1050  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTVD  1109

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL
Sbjct  1110  SVFRQRLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL  1156



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   363 bits (931),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             + +++ S+FP + RLIVRSSANVEDL GMSAAGLYESIPNVS SNP VF   +S+VWASL
Sbjct  825   IFDSIMSIFPNEARLIVRSSANVEDLVGMSAAGLYESIPNVSLSNPTVFSDAVSQVWASL  884

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             +TRRAVLSRRAAG+ QKDA MAVLVQEMLSP+LSF+LHTLSPT+ D N VEAEIA GLGE
Sbjct  885   FTRRAVLSRRAAGISQKDATMAVLVQEMLSPDLSFILHTLSPTEQDHNIVEAEIAPGLGE  944

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+ S KFD  V+TLAFANFSEEM V G  PADGEV RLTVDYSKKPLTV
Sbjct  945   TLASGTRGTPWRVLSGKFDRTVRTLAFANFSEEMAVSGADPADGEVHRLTVDYSKKPLTV  1004

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP FR Q  Q LG +G FLE+KFGCPQDVEGC +G+DI++VQ+RPQP
Sbjct  1005  DPKFRQQFSQHLGAIGLFLEQKFGCPQDVEGCCLGEDIYVVQTRPQP  1051



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score =   365 bits (938),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  N  VF + +S+VWASL
Sbjct  990   MIDSVGRIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSLRNKTVFSNAVSKVWASL  1049

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHT SPTD +  SVEAEIA GLGE
Sbjct  1050  YTRRAVLSRRAAGVPQKDALMAVLVQEMLSPDLSFVLHTYSPTDQNDKSVEAEIACGLGE  1109

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD +VQTLAFANFSEE+ V  TGPADGE+ R TVDYSKKPL++
Sbjct  1110  TLASGTRGTPWRLSSGKFDGQVQTLAFANFSEELRVLSTGPADGEMARFTVDYSKKPLSI  1169

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             +P FR QLGQRL  VG+FLE KFGCPQDVEGC VG DI+IVQ+RPQPL
Sbjct  1170  EPKFREQLGQRLCAVGYFLECKFGCPQDVEGCTVGDDIYIVQARPQPL  1217



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   366 bits (940),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 205/251 (82%), Gaps = 4/251 (2%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P VF   + RVWASLY
Sbjct  926   INSISKAFPKDTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPSVFSASVCRVWASLY  985

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV Q +A+MAVLVQEMLSP+LSFVLHT+SP+D   N VEAEIA GLGET
Sbjct  986   TRRAVLSRRAAGVSQIEASMAVLVQEMLSPDLSFVLHTVSPSDPGTNLVEAEIAPGLGET  1045

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  VQTLAFANFSEE++V G GPADG+ +RLTVDYSKK LTVD
Sbjct  1046  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTVD  1105

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL*EYHLSLVF-FFL  66
              VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D++IVQSRPQPL     +  F F  
Sbjct  1106  SVFRQRLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVYIVQSRPQPL---DCNEFFRFHH  1162

Query  65    LEFCPAIHRIF  33
                C  ++ IF
Sbjct  1163  KHICLEVYNIF  1173



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   365 bits (937),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/228 (78%), Positives = 197/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  N  VF + +S+VWASL
Sbjct  1014  MIDSVGRIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSLRNKTVFSNAVSKVWASL  1073

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHT SPTD +  SVEAEIA GLGE
Sbjct  1074  YTRRAVLSRRAAGVPQKDALMAVLVQEMLSPDLSFVLHTYSPTDQNDKSVEAEIACGLGE  1133

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD +VQTLAFANFSEE+ V  TGPADGE+ R TVDYSKKPL++
Sbjct  1134  TLASGTRGTPWRLSSGKFDGQVQTLAFANFSEELRVLSTGPADGEMARFTVDYSKKPLSI  1193

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             +P FR QLGQRL  VG+FLE KFGCPQDVEGC VG DI+IVQ+RPQPL
Sbjct  1194  EPKFREQLGQRLCAVGYFLECKFGCPQDVEGCTVGDDIYIVQARPQPL  1241



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   362 bits (930),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             + +++ SMFP + RLIVRSSANVEDLAGMSAAGLYESIPNVS SNP VF   +S+VWASL
Sbjct  934   IFDSIMSMFPDEARLIVRSSANVEDLAGMSAAGLYESIPNVSLSNPTVFSDAVSQVWASL  993

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             +TRRAVLSRRAAG+ QKDA MAVLVQEML P+LSF+LHTLSPT+ D N VEAEIA GLGE
Sbjct  994   FTRRAVLSRRAAGISQKDATMAVLVQEMLLPDLSFILHTLSPTEQDHNIVEAEIAPGLGE  1053

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWR+ S KFD  V+TLAFANFSEEM V G  PADGEV  LTVDYSKKPLTV
Sbjct  1054  TLASGTRGTPWRVLSGKFDRTVRTLAFANFSEEMAVSGADPADGEVHHLTVDYSKKPLTV  1113

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP FR Q  Q LG +G FLE+KFGCPQDVEGCL+G+DI++VQ+RPQP
Sbjct  1114  DPKFRQQFSQHLGAIGLFLEQKFGCPQDVEGCLLGEDIYVVQTRPQP  1160



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   364 bits (935),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 203/250 (81%), Gaps = 2/250 (1%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I ++   FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P VF   + RVWASLY
Sbjct  929   INSISKAFPQDARLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPSVFSASVCRVWASLY  988

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRAVLSRRAAGV Q++A+MAVLVQEMLSP+LSFVLHT+SP+D   N VEAEIA GLGET
Sbjct  989   TRRAVLSRRAAGVSQREASMAVLVQEMLSPDLSFVLHTVSPSDPKSNLVEAEIAPGLGET  1048

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRL+S K D  VQTLAFANFSEE++V G GPADG+ +RLTVDYSKK LTVD
Sbjct  1049  LASGTRGTPWRLASGKLDGIVQTLAFANFSEELLVSGKGPADGKYVRLTVDYSKKRLTVD  1108

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL*EYHLSLVFFFLL  63
              VFR +LGQRLG+VGFFLER FGC QDVEGCLVG+D+ IVQSRPQPL       + F   
Sbjct  1109  SVFRQRLGQRLGSVGFFLERNFGCAQDVEGCLVGEDVNIVQSRPQPL--DCNEFLRFHHK  1166

Query  62    EFCPAIHRIF  33
               C  ++ IF
Sbjct  1167  HICLEVYNIF  1176



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   362 bits (929),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  N  VF + +S+VWASL
Sbjct  934   IIDSVGRIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSVRNKTVFSNAVSKVWASL  993

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHT SPT+ +  SVEAEIA GLGE
Sbjct  994   YTRRAVLSRRAAGVPQKDALMAVLVQEMLSPDLSFVLHTYSPTNQNDKSVEAEIACGLGE  1053

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V TLAFANFSEE+ V  TGPADGE+ R TVDYSKKPL+V
Sbjct  1054  TLASGTRGTPWRLSSGKFDGVVHTLAFANFSEELRVLSTGPADGEMARFTVDYSKKPLSV  1113

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             +P FR QLGQRL  VG+FLE KFGCPQDVEGC VG DI+IVQ+RPQPL
Sbjct  1114  EPRFREQLGQRLCAVGYFLECKFGCPQDVEGCTVGDDIYIVQARPQPL  1161



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   362 bits (929),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 195/224 (87%), Gaps = 0/224 (0%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             +E  FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP +F   + +VWASLYTRR
Sbjct  951   VEKAFPLDERLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPSIFSRAVCQVWASLYTRR  1010

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             AVLSRRA+GVPQK+A MAVLVQEMLSP+LSFVLHT+SP+D D N +EAEIA G GETLAS
Sbjct  1011  AVLSRRASGVPQKEAMMAVLVQEMLSPDLSFVLHTVSPSDPDSNFLEAEIAPGSGETLAS  1070

Query  413   GTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVF  234
             GTRGTPWR+SS KFD  + TLAFANFSEE+++ G GPADG++I LTVDYSKKPLTVD +F
Sbjct  1071  GTRGTPWRISSGKFDGVMNTLAFANFSEELLLSGAGPADGKLICLTVDYSKKPLTVDAMF  1130

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             R QLG+RLG VGF+LER FGC QDVEGCLVG DI+IVQSRPQPL
Sbjct  1131  RQQLGRRLGAVGFYLERNFGCAQDVEGCLVGTDIYIVQSRPQPL  1174



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   362 bits (929),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 195/224 (87%), Gaps = 0/224 (0%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             +E  FP   RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP +F   + +VWASLYTRR
Sbjct  953   VEKAFPLDERLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPSIFSRAVCQVWASLYTRR  1012

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             AVLSRRA+GVPQK+A MAVLVQEMLSP+LSFVLHT+SP+D D N +EAEIA G GETLAS
Sbjct  1013  AVLSRRASGVPQKEAMMAVLVQEMLSPDLSFVLHTVSPSDPDSNFLEAEIAPGSGETLAS  1072

Query  413   GTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVF  234
             GTRGTPWR+SS KFD  + TLAFANFSEE+++ G GPADG++I LTVDYSKKPLTVD +F
Sbjct  1073  GTRGTPWRISSGKFDGVMNTLAFANFSEELLLSGAGPADGKLICLTVDYSKKPLTVDAMF  1132

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             R QLG+RLG VGF+LER FGC QDVEGCLVG DI+IVQSRPQPL
Sbjct  1133  RQQLGRRLGAVGFYLERNFGCAQDVEGCLVGTDIYIVQSRPQPL  1176



>gb|AFW56442.1| hypothetical protein ZEAMMB73_583770 [Zea mays]
Length=690

 Score =   350 bits (898),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE+L+  F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  FG  + +VWASL
Sbjct  463  IIESLKKTFDQNVRLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPRSFGAAVGQVWASL  522

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRA+LSRRAAGVPQ+DA MAVLVQEML P+LSFVLHT+SP DHD   VEAE+A GLGE
Sbjct  523  YTRRAILSRRAAGVPQRDAKMAVLVQEMLQPDLSFVLHTISPVDHDPKLVEAEVAPGLGE  582

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLS  K D KV TLAFANFSEE++V  +GP DGE+ R TVDYSKKPL+V
Sbjct  583  TLASGTRGTPWRLSCHKLDGKVTTLAFANFSEELMVLNSGPTDGEMSRRTVDYSKKPLSV  642

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            D  FR Q GQRL  +G +LE+KFG  QDVEGCLVG DIFIVQSRPQP
Sbjct  643  DATFREQFGQRLAAIGQYLEQKFGSAQDVEGCLVGPDIFIVQSRPQP  689



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   361 bits (927),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+++  +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  N  VF + +S+VWASL
Sbjct  1010  IIDSVGRIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSVRNKTVFSNAVSKVWASL  1069

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQKDA MAVLVQEMLSP+LSFVLHT SPT+ +  SVEAEIA GLGE
Sbjct  1070  YTRRAVLSRRAAGVPQKDALMAVLVQEMLSPDLSFVLHTYSPTNQNDKSVEAEIACGLGE  1129

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V TLAFANFSEE+ V  TGPADGE+ R TVDYSKKPL+V
Sbjct  1130  TLASGTRGTPWRLSSGKFDGVVHTLAFANFSEELRVLSTGPADGEMARFTVDYSKKPLSV  1189

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             +P FR QLGQRL  VG+FLE KFGCPQDVEGC VG DI+IVQ+RPQPL
Sbjct  1190  EPRFREQLGQRLCAVGYFLECKFGCPQDVEGCTVGDDIYIVQARPQPL  1237



>ref|XP_008661639.1| PREDICTED: uncharacterized protein LOC100274067 isoform X1, partial 
[Zea mays]
Length=762

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            +IE+L+  F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  FG  + +VWASL
Sbjct  535  IIESLKKTFDQNVRLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPRSFGAAVGQVWASL  594

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            YTRRA+LSRRAAGVPQ+DA MAVLVQEML P+LSFVLHT+SP DHD   VEAE+A GLGE
Sbjct  595  YTRRAILSRRAAGVPQRDAKMAVLVQEMLQPDLSFVLHTISPVDHDPKLVEAEVAPGLGE  654

Query  425  TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            TLASGTRGTPWRLS  K D KV TLAFANFSEE++V  +GP DGE+ R TVDYSKKPL+V
Sbjct  655  TLASGTRGTPWRLSCHKLDGKVTTLAFANFSEELMVLNSGPTDGEMSRRTVDYSKKPLSV  714

Query  245  DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            D  FR Q GQRL  +G +LE+KFG  QDVEGCLVG DIFIVQSRPQP
Sbjct  715  DATFREQFGQRLAAIGQYLEQKFGSAQDVEGCLVGPDIFIVQSRPQP  761



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   359 bits (922),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +IE+L++ F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  FG  + +VWASL
Sbjct  980   IIESLKNTFDQNARLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPSSFGAAVGQVWASL  1039

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRAVLSRRAAGVPQ+DA MA+LVQEML P+LSFVLHT+SP+DHD   VEAE+A GLGE
Sbjct  1040  YTRRAVLSRRAAGVPQRDAKMAILVQEMLQPDLSFVLHTVSPSDHDPKLVEAEVAPGLGE  1099

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD +V TLAFANFSEEM+V  +GPADGEV+RLTVDYSKK L+V
Sbjct  1100  TLASGTRGTPWRLSCDKFDGRVTTLAFANFSEEMVVLTSGPADGEVVRLTVDYSKKTLSV  1159

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             D  FR Q GQRL  +G +LE+KFG  QDVEGCLVGKDIFIVQSRPQP
Sbjct  1160  DATFRRQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP  1206



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   355 bits (910),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             L+ +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  +P  FG  + +VWASLYTRR
Sbjct  969   LKRIFPQDVRLIVRSSANVEDLAGMSAAGLYDSIPNVSLMDPCAFGAAVGKVWASLYTRR  1028

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             A+LSRRAAGV Q+DA MAVLVQE+L P+LSFVLHT+ P DHD   V+AE+A GLGETLAS
Sbjct  1029  AILSRRAAGVYQRDATMAVLVQEILQPDLSFVLHTVCPADHDPKVVQAEVAPGLGETLAS  1088

Query  413   GTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVF  234
             GTRGTPWRLS +KFD KV TLAF+NFSEEM+VH +GPA+GEVIRLTVDYSKKPL+VD  F
Sbjct  1089  GTRGTPWRLSCNKFDGKVATLAFSNFSEEMVVHNSGPANGEVIRLTVDYSKKPLSVDTTF  1148

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             R Q GQRL  +G +LE+KFG  QDVEGCLVGKDIFIVQSRPQP
Sbjct  1149  RKQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP  1191



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   354 bits (909),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             L+ +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  +P  FG  + +VWASLYTRR
Sbjct  966   LKRIFPQDVRLIVRSSANVEDLAGMSAAGLYDSIPNVSLMDPCAFGAAVGKVWASLYTRR  1025

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             A+LSRRAAGV Q+DA MAVLVQE+L P+LSFVLHT+ P DHD   V+AE+A GLGETLAS
Sbjct  1026  AILSRRAAGVYQRDATMAVLVQEILQPDLSFVLHTVCPADHDPKVVQAEVAPGLGETLAS  1085

Query  413   GTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVF  234
             GTRGTPWRLS +KFD KV TLAF+NFSEEM+VH +GPA+GEVIRLTVDYSKKPL+VD  F
Sbjct  1086  GTRGTPWRLSCNKFDGKVATLAFSNFSEEMVVHNSGPANGEVIRLTVDYSKKPLSVDTTF  1145

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             R Q GQRL  +G +LE+KFG  QDVEGCLVGKDIFIVQSRPQP
Sbjct  1146  RKQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP  1188



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   353 bits (906),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNP++F   + +VWASLYTRRAVLS
Sbjct  964   FLSGARLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPLIFSRAVCQVWASLYTRRAVLS  1023

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
             RRAAG+ QK+A MA+LVQEMLSP LSFVLHT+SP++ + + VEAEIA G GETLASGTRG
Sbjct  1024  RRAAGLRQKEATMAILVQEMLSPELSFVLHTVSPSEPESDIVEAEIAPGSGETLASGTRG  1083

Query  401   TPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQL  222
             TPWR+SS KF+  V+TLAF NFSEE+ V GTG ADG+++RLTVDYSKKPLTVD VFR QL
Sbjct  1084  TPWRISSGKFNGTVRTLAFGNFSEELRVSGTGLADGQLMRLTVDYSKKPLTVDAVFRQQL  1143

Query  221   GQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             GQRLG VGF+LERKFGC QDVEGC+VG DI+IVQSRPQPL
Sbjct  1144  GQRLGAVGFYLERKFGCAQDVEGCVVGTDIYIVQSRPQPL  1183



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   353 bits (907),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 190/223 (85%), Gaps = 0/223 (0%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             L+ +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  +P  FG  + +VWASLYTRR
Sbjct  984   LKRIFPQDVRLIVRSSANVEDLAGMSAAGLYDSIPNVSLMDPCAFGAAVGKVWASLYTRR  1043

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             A+LSRRAAGV Q+DA MAVLVQE+L P+LSFVLHT+ P DHD   V+AE+A GLGETLAS
Sbjct  1044  AILSRRAAGVYQRDATMAVLVQEILQPDLSFVLHTVCPADHDPKVVQAEVAPGLGETLAS  1103

Query  413   GTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVF  234
             GTRGTPWRLS +KFD KV TLAF+NFSEEM+VH +GPA+GEVIRLTVDYSKKPL+VD  F
Sbjct  1104  GTRGTPWRLSCNKFDGKVATLAFSNFSEEMVVHNSGPANGEVIRLTVDYSKKPLSVDTTF  1163

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             R Q GQRL  +G +LE+KFG  QDVEGCLVGKDIFIVQSRPQP
Sbjct  1164  RKQFGQRLAAIGQYLEQKFGSAQDVEGCLVGKDIFIVQSRPQP  1206



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   352 bits (902),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +IE+L+ +F    RLIVRS+ANVEDLAGMSAAGLYESIPNVS S+P  F   + +VWASL
Sbjct  986   IIESLKRIFDQNVRLIVRSTANVEDLAGMSAAGLYESIPNVSLSDPSSFCAAVGQVWASL  1045

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             YTRRA+LSRRAAGVPQ+DA MAVLVQEML P+LSFVLHT+SP DHD   VEAE+A GLGE
Sbjct  1046  YTRRAILSRRAAGVPQRDAKMAVLVQEMLQPDLSFVLHTVSPVDHDPKLVEAEVAPGLGE  1105

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLS  KFD KV TLAFANFSEEM+V  +GP DGEV R TVDYSKKPL+V
Sbjct  1106  TLASGTRGTPWRLSCHKFDGKVTTLAFANFSEEMVVLNSGPTDGEVTRRTVDYSKKPLSV  1165

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             D  FR Q GQRL  +G +LE+KFG  QDVEGCLVG+DIFIVQSRPQP
Sbjct  1166  DATFRGQFGQRLAAIGQYLEQKFGSAQDVEGCLVGQDIFIVQSRPQP  1212



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   346 bits (887),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             I+ L+ +FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS  N   FG  + +VWASLY
Sbjct  981   IKFLKGLFPHDVRLIVRSSANVEDLAGMSAAGLYDSIPNVSLMNASSFGAAVGKVWASLY  1040

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRA+LSRRAAGV Q+DA MAVLVQEML P LSFVLHT++P DHD   VEAEIA GLGET
Sbjct  1041  TRRAILSRRAAGVSQRDAKMAVLVQEMLQPELSFVLHTVNPIDHDPKLVEAEIAPGLGET  1100

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LASGTRGTPWRLS +KFD KV TLAF+NFSEE+ V  + PA+GEVIRLTVDYSKKPL+VD
Sbjct  1101  LASGTRGTPWRLSCNKFDGKVTTLAFSNFSEEISVGDSDPANGEVIRLTVDYSKKPLSVD  1160

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
               FR Q GQRL  +G +LE+KFG  QDVEGCLVGKDIFIVQSRPQP
Sbjct  1161  ATFRKQFGQRLAAIGQYLEQKFGNAQDVEGCLVGKDIFIVQSRPQP  1206



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   345 bits (885),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 190/226 (84%), Gaps = 0/226 (0%)
 Frame = -2

Query  782   IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
             +E+L+++FP   RLIVRSSANVEDLAGMSAAGLY+SIPNVS S+   FG  ++RVWASLY
Sbjct  957   VESLKTIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSLSDTKSFGAAVARVWASLY  1016

Query  602   TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
             TRRA+LSRR AGVPQ++A MA+LVQEML P LSFVLHT+SP+DHD   VEAE+A GLGET
Sbjct  1017  TRRAILSRRVAGVPQREAKMAILVQEMLEPELSFVLHTVSPSDHDTRVVEAEVAPGLGET  1076

Query  422   LASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
             LA+GTRGTPWRLS  KFD  V T+AFANFSEEM+V  +GPADGEV+ LTVDYSKK L+VD
Sbjct  1077  LAAGTRGTPWRLSCDKFDTNVTTVAFANFSEEMVVLNSGPADGEVVHLTVDYSKKALSVD  1136

Query  242   PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
               FR Q GQRL  +G +LE++ G  QDVEGCLVG+D+FIVQSRPQP
Sbjct  1137  GTFRKQFGQRLAAIGQYLEQRLGSAQDVEGCLVGEDVFIVQSRPQP  1182



>gb|EPS62661.1| hypothetical protein M569_12127, partial [Genlisea aurea]
Length=674

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = -2

Query  779  ETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYT  600
            E L  +FP  TRLIVRSSANVEDLAGMSAAGLYES+PN++ S+P  F   ++RVWASL+T
Sbjct  449  EELSKIFPESTRLIVRSSANVEDLAGMSAAGLYESVPNIALSDPAAFRQVVARVWASLHT  508

Query  599  RRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETL  420
            RRAVLSRRA GVPQ  A MAVLVQEM+SP LSFVLHT+SPTD D N+VEAEIA GLGETL
Sbjct  509  RRAVLSRRAGGVPQGAAVMAVLVQEMISPELSFVLHTVSPTDRDVNAVEAEIAPGLGETL  568

Query  419  ASGTRGTPWRLSSSKFD-DKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVD  243
            ASGTRGTPWR+SS K +  +V+TLAFANFS E++V     A G V + TVDYSKK LTVD
Sbjct  569  ASGTRGTPWRISSKKDEGGRVETLAFANFSHELVVAAKSNAAGVVQQSTVDYSKKGLTVD  628

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
            PV R QLG+RL  +G  LE+K+GCPQDVEGCLVG+DIFIVQ+RPQP
Sbjct  629  PVMRQQLGRRLAAIGLLLEQKYGCPQDVEGCLVGEDIFIVQTRPQP  674



>gb|AEN83153.1| AT5G26570-like protein, partial [Capsella grandiflora]
 gb|AEN83156.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83157.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83158.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83159.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83161.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83162.1| AT5G26570-like protein, partial [Capsella rubella]
 gb|AEN83163.1| AT5G26570-like protein, partial [Capsella rubella]
Length=187

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLYTRRAVLSRRAAG
Sbjct  1    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLYTRRAVLSRRAAG  60

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRL  387
            V QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGETLASGTRGTPWRL
Sbjct  61   VTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRL  120

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
            +S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD VFR QLGQRLG
Sbjct  121  ASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLG  180

Query  206  TVGFFLE  186
            +VGFFLE
Sbjct  181  SVGFFLE  187



>gb|AEN83160.1| AT5G26570-like protein, partial [Capsella rubella]
Length=187

 Score =   313 bits (801),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLYTRRAVLSRRAAG
Sbjct  1    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLYTRRAVLSRRAAG  60

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRL  387
            V QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGETLASGTRGTPWRL
Sbjct  61   VTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRL  120

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
            +S K D  VQTLAFANFSEE+ V GTGPADG+ +RLTVDYSKK LTVD VFR QLGQRLG
Sbjct  121  ASGKLDGIVQTLAFANFSEELFVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLG  180

Query  206  TVGFFLE  186
            +VGFFLE
Sbjct  181  SVGFFLE  187



>gb|AEN83155.1| AT5G26570-like protein, partial [Capsella grandiflora]
Length=187

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLYTRRAVLSRRAAG
Sbjct  1    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSDSVCQVWASLYTRRAVLSRRAAG  60

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRL  387
            V QK+A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGETLASGTRGTPWRL
Sbjct  61   VTQKEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRL  120

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
            +S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD  FR QLGQRLG
Sbjct  121  ASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSAFRQQLGQRLG  180

Query  206  TVGFFLE  186
            +VGFFLE
Sbjct  181  SVGFFLE  187



>gb|AEN83164.1| AT5G26570-like protein, partial [Neslia paniculata]
Length=187

 Score =   312 bits (799),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLYTRRAVLSRRAAG
Sbjct  1    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSGSVCQVWASLYTRRAVLSRRAAG  60

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRL  387
            V Q++A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGETLASGTRGTPWRL
Sbjct  61   VTQREASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRL  120

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
            +S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD VFR QLGQRLG
Sbjct  121  ASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLG  180

Query  206  TVGFFLE  186
            +VGFFLE
Sbjct  181  SVGFFLE  187



>gb|AEN83154.1| AT5G26570-like protein, partial [Capsella grandiflora]
Length=187

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            RLIVRSSANVEDLAGMSAAGLYESIPNVSPS+P+VF   + +VWASLYTRRAVLSRRAAG
Sbjct  1    RLIVRSSANVEDLAGMSAAGLYESIPNVSPSDPLVFSXSVCQVWASLYTRRAVLSRRAAG  60

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRL  387
            V Q +A+MAVLVQEMLSP+LSFVLHT+SP D D N VEAEIA GLGETLASGTRGTPWRL
Sbjct  61   VTQXEASMAVLVQEMLSPDLSFVLHTVSPADPDSNLVEAEIAPGLGETLASGTRGTPWRL  120

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
            +S K D  VQTLAFANFSEE++V GTGPADG+ +RLTVDYSKK LTVD VFR QLGQRLG
Sbjct  121  ASGKLDGIVQTLAFANFSEELLVSGTGPADGKYVRLTVDYSKKRLTVDSVFRQQLGQRLG  180

Query  206  TVGFFLE  186
            +VGFFLE
Sbjct  181  SVGFFLE  187



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   335 bits (860),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 187/220 (85%), Gaps = 1/220 (0%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             FP +TRLIVRSSANVEDLAGMS AGLYESIPNV  S P VFG  +++VWASLYTRRAVLS
Sbjct  875   FPKETRLIVRSSANVEDLAGMSGAGLYESIPNVRLSEPDVFGKAVAQVWASLYTRRAVLS  934

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
             RR AGVPQK+A+MAVLVQE+LSP LSFVLHT+SP D D+N V+AEIA GLGETLASGTRG
Sbjct  935   RRVAGVPQKEASMAVLVQELLSPELSFVLHTVSPIDQDKNVVQAEIAVGLGETLASGTRG  994

Query  401   TPWRLSSSKFDDKVQTLAFANFSEEMIVH-GTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
             TPWRL+++KFD  V+TLAFANFSE+M+V  G   ADG V++  VDYS + L+VD  +R Q
Sbjct  995   TPWRLAANKFDGTVKTLAFANFSEQMMVKGGANVADGSVVKAVVDYSNQRLSVDTEYRQQ  1054

Query  224   LGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             +GQ L TVGFFLE+ FG PQDVEGC++GKD++IVQ+RPQP
Sbjct  1055  IGQYLATVGFFLEKHFGVPQDVEGCVIGKDVYIVQARPQP  1094



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   316 bits (809),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 172/227 (76%), Gaps = 39/227 (17%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             +I+ LE +FP   RLIVRSSANVEDLAG+                               
Sbjct  961   IIQQLEEIFPTNARLIVRSSANVEDLAGI-------------------------------  989

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
                     RRAAGV QKDA MAVLVQE+LSP+LSFVLHTLSPTDHD NSVEAEIA GLGE
Sbjct  990   --------RRAAGVAQKDATMAVLVQELLSPDLSFVLHTLSPTDHDHNSVEAEIAPGLGE  1041

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
             TLASGTRGTPWRLSS KFD  V+TLAFANFSEE++V G GPADGEVIRLTVDYSKKP+T+
Sbjct  1042  TLASGTRGTPWRLSSGKFDGLVRTLAFANFSEELLVLGAGPADGEVIRLTVDYSKKPMTI  1101

Query  245   DPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             DP+FR QLGQRLG VGFFLERKFGCPQDVEGC+VGKDIFIVQ+RPQP
Sbjct  1102  DPIFRRQLGQRLGAVGFFLERKFGCPQDVEGCVVGKDIFIVQTRPQP  1148



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 178/214 (83%), Gaps = 6/214 (3%)
 Frame = -2

Query  743   LIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGV  564
             LIVRSSANVEDLAGMSAAGLY+SIPNV P+ P   G  ++ VWASLYTRRAVLSRRAAGV
Sbjct  969   LIVRSSANVEDLAGMSAAGLYDSIPNVGPT-PEALGPAVASVWASLYTRRAVLSRRAAGV  1027

Query  563   PQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLS  384
             PQ +AAM VLVQEML P++SFVLHT+SP D D + V AE+A GLGETLASGTRGTPWRL+
Sbjct  1028  PQHEAAMGVLVQEMLMPDVSFVLHTVSPFDGDPSCVHAELAPGLGETLASGTRGTPWRLA  1087

Query  383   SSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGT  204
             S K +  V+TLAFANFSEE++V   G     V+R TVDYS++ LTVD + R +LGQRLG 
Sbjct  1088  SGKLEQNVRTLAFANFSEELVVDKGG-----VVRRTVDYSRQSLTVDGLTRLRLGQRLGA  1142

Query  203   VGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             VGFFLERKFGCPQD+EGC+VG DI+IVQSRPQP+
Sbjct  1143  VGFFLERKFGCPQDIEGCVVGGDIYIVQSRPQPV  1176



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   295 bits (756),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 171/219 (78%), Gaps = 0/219 (0%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F    RLIVRSSANVEDLAGMS AGLY+SIPNV  S P  F   ++ VWASLYTRRAVLS
Sbjct  883   FSSDARLIVRSSANVEDLAGMSGAGLYDSIPNVKLSEPEHFCKAVAGVWASLYTRRAVLS  942

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
             RR A VPQK A+MAVLVQE+L+P+LSFVLHT+ P D +   V+ EIA+GLGETLASGTRG
Sbjct  943   RRVAKVPQKAASMAVLVQELLAPDLSFVLHTVDPIDRNAQIVQGEIAAGLGETLASGTRG  1002

Query  401   TPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQL  222
             TPWRLS++K D  V+ +AFANFSEE +    G ADG+V +  VDYS K L+VD  +   L
Sbjct  1003  TPWRLSANKVDGSVKLVAFANFSEEFVAGRDGVADGKVSKRVVDYSTKKLSVDLEYSVAL  1062

Query  221   GQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             GQRL  +G FLE+ FGCPQD+EGC+VG++I+IVQ+RPQP
Sbjct  1063  GQRLAAIGTFLEKSFGCPQDIEGCVVGEEIYIVQARPQP  1101



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   293 bits (751),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 170/219 (78%), Gaps = 0/219 (0%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F    RLIVRSSANVEDLAGMS AGLY+SIPNV  S P  F   ++ VWASLYTRRAVLS
Sbjct  886   FSSDARLIVRSSANVEDLAGMSGAGLYDSIPNVKLSEPENFCKAVAGVWASLYTRRAVLS  945

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
             RR A VPQK A+MAVLVQE+L+P+LSFVLHT+ P D +   V+ E+A+GLGETLASGTRG
Sbjct  946   RRVAKVPQKAASMAVLVQELLAPDLSFVLHTVDPIDRNAQIVQGELAAGLGETLASGTRG  1005

Query  401   TPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQL  222
             TPWRLS++K D  V+ +AFANFSEE +    G ADG+V +  VDYS K L+VD  +   L
Sbjct  1006  TPWRLSANKVDGSVKLVAFANFSEEFVAGRDGVADGKVSKRVVDYSTKKLSVDLEYSVTL  1065

Query  221   GQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             GQRL  +G FLE+ FGCPQD+EGC VG++I+IVQ+RPQP
Sbjct  1066  GQRLAAIGTFLEKSFGCPQDIEGCAVGEEIYIVQARPQP  1104



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score =   293 bits (750),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F   +RLIVRSSA++ED  G     LYESIPNV  S P  F   ++RVWASLYTRRAVLS
Sbjct  907   FSKISRLIVRSSASIEDSTGFPGTWLYESIPNVRLSEPESFSKAVARVWASLYTRRAVLS  966

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
             RR AGVPQK+A+MAVLVQE+LSP LSFVLHT++P DHD   V+AE+A GLGETLASGTRG
Sbjct  967   RRIAGVPQKEASMAVLVQELLSPELSFVLHTVNPIDHDSTVVQAELAVGLGETLASGTRG  1026

Query  401   TPWRLSSSKFDDKVQTLAFANFSEEMIV-HGTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
             TPWRL+++KFD  V+TL FANFSE+++V H +  ADG V+R  VDYS + L+ DP FR +
Sbjct  1027  TPWRLAANKFDGTVRTLGFANFSEQILVRHESKVADGSVMREVVDYSGQRLSSDPAFRER  1086

Query  224   LGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
             +GQRL T+GFFLE+ F  P+D+EGC++G D++IVQ+R QP
Sbjct  1087  VGQRLATIGFFLEQHFKGPRDIEGCIIGDDVYIVQARSQP  1126



>gb|AEW08242.1| hypothetical protein 2_4077_01, partial [Pinus radiata]
 gb|AFG59859.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59860.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59861.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59862.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59863.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59864.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59865.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59866.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
 gb|AFG59867.1| hypothetical protein 2_4077_01, partial [Pinus taeda]
Length=131

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  497  LHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIV  318
            LHT+SP D +   V+AEIA+GLGETLASGTRGTPWRL+ +KFD   +TLAFANFSEE++V
Sbjct  1    LHTVSPIDQNDKVVQAEIAAGLGETLASGTRGTPWRLAVNKFDGTAKTLAFANFSEELVV  60

Query  317  HGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGK  138
               GPADG+V+ LTVDYSKK L++DP++R+QLGQRL T GFFLE+KFGCPQDVEGCLVG 
Sbjct  61   ITGGPADGKVMALTVDYSKKTLSLDPIYRYQLGQRLATTGFFLEQKFGCPQDVEGCLVGN  120

Query  137  DIFIVQSRPQP  105
            DI+IVQ+RPQP
Sbjct  121  DIYIVQTRPQP  131



>gb|AEW08243.1| hypothetical protein 2_4077_01, partial [Pinus lambertiana]
Length=131

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  497  LHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIV  318
            LHT+SP D +   V+AEIASGLGETLASGTRGTPWRL+ +KFD   +TLAFAN SEE++V
Sbjct  1    LHTVSPVDQNDKVVQAEIASGLGETLASGTRGTPWRLAVNKFDGTAKTLAFANLSEELVV  60

Query  317  HGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGK  138
               GPADG+V+ LTVDYSKK L++DP++R+QLGQRL T GFFLE+KFGCPQDVEGCLVG 
Sbjct  61   ITGGPADGKVMALTVDYSKKTLSLDPIYRYQLGQRLATTGFFLEQKFGCPQDVEGCLVGN  120

Query  137  DIFIVQSRPQP  105
            DI+IVQ+RPQP
Sbjct  121  DIYIVQTRPQP  131



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 147/218 (67%), Gaps = 5/218 (2%)
 Frame = -2

Query  758   PGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSR  579
             PG T +IVRSSANVEDLAGMS AGLY+SIPNV   NP      ++ VWASL++RRAVLSR
Sbjct  970   PGAT-VIVRSSANVEDLAGMSGAGLYDSIPNVDSGNPGALQAAVAGVWASLFSRRAVLSR  1028

Query  578   RAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGT  399
              AAGVPQ+ + MAV+VQ  L+P+L FVLHT  P   D + + AE+A GLGETLASGTRGT
Sbjct  1029  HAAGVPQEASCMAVVVQRQLAPDLCFVLHTRHPVTGDADVLSAELAPGLGETLASGTRGT  1088

Query  398   PWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLG  219
             PWR+ + K    V T AFANFS+ ++  G GPA     R  +     P  V    R  +G
Sbjct  1089  PWRMEADKRTSAVTTTAFANFSKALLPPG-GPAVVTAARWLLPC---PPAVSEEVRKGVG  1144

Query  218   QRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
              RL  V   LE +FG  QDVEGC VG D+++VQ+RPQP
Sbjct  1145  MRLLAVAAALEHEFGGAQDVEGCFVGNDLYVVQTRPQP  1182



>ref|XP_011396449.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23575.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=1068

 Score =   214 bits (545),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 149/231 (65%), Gaps = 6/231 (3%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             VI+ L+   P  + +I RSSANVEDLAG+S AGLY+SIP + PS+       I+ VWASL
Sbjct  840   VIKALQDSLPADSPVIARSSANVEDLAGLSGAGLYDSIPGIDPSSATSLQRGIALVWASL  899

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             ++RRAVLSR A G+P + AAMAVL+Q  L P+LSFVLHT  P   D   + AE+A G GE
Sbjct  900   FSRRAVLSRGAGGIPSQAAAMAVLLQPQLCPDLSFVLHTAHPVTRDAGVMWAEVAPGQGE  959

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIV-HGTGPADGEVIRL---TVDYSKK  258
              LA+G+RG  WR+   K  D ++ L+FANFS   +V  GTG   G V  L   TVDYS +
Sbjct  960   ILATGSRGAAWRMEIGKAGDTLRMLSFANFSTAWLVARGTG--KGGVATLAPTTVDYSSQ  1017

Query  257   PLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
              L+     R QL +RL  VG  LE + G  QDVEGC+    ++IVQ+RPQP
Sbjct  1018  ALSGSEEARAQLSRRLLGVGAALEAEMGGAQDVEGCIAAGQLYIVQTRPQP  1068



>ref|XP_005648862.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24318.1| hypothetical protein COCSUDRAFT_47226 [Coccomyxa subellipsoidea 
C-169]
Length=1158

 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 160/244 (66%), Gaps = 17/244 (7%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             V++     F     LI RS+ANVEDLAGMS AGLYES+  +  ++P   G  +  VWASL
Sbjct  915   VLKEACGAFSDGATLIARSTANVEDLAGMSGAGLYESLAGIPAADPEALGTAVKGVWASL  974

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             Y RRAVLSRRAAGV Q DAAMA+L+QE L+   SFVLHT SP + D N + AE+A+GLGE
Sbjct  975   YARRAVLSRRAAGVAQADAAMAILIQEQLASEYSFVLHTRSPVEQDPNLLYAELAAGLGE  1034

Query  425   TLASGTRGTPWRLSSSKFDDKVQTLAFANFS--------EEMIVHGTGPADGEVIR----  282
             TLASGTRG+PWRL+ +K   +V+TLAFANFS        ++++V   G +  +       
Sbjct  1035  TLASGTRGSPWRLAVNKQTGEVKTLAFANFSSALTAGAPKKVLVAAGGGSPSQTSHSASA  1094

Query  281   -----LTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQS  117
                  + +DY K+ L+     R ++G++L  VG  LE  FG PQDVEG L+G +++IVQ+
Sbjct  1095  SGYKPVILDYGKQALSTSEEKRAEVGEQLAKVGKALEEAFGGPQDVEGALIGTEVYIVQT  1154

Query  116   RPQP  105
             RPQP
Sbjct  1155  RPQP  1158



>ref|XP_002504762.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
 gb|ACO66020.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
Length=1001

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 154/230 (67%), Gaps = 11/230 (5%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
              P  + ++VRSSANVEDLAGMSAAGLYES+  VS S+    G  +  VWASLY+RRAV++
Sbjct  773   MPTNSWVVVRSSANVEDLAGMSAAGLYESVLGVSTSSAAELGSAVQEVWASLYSRRAVMA  832

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQN----------SVEAEIASGL  432
             RRAAG+ Q DA MAVLVQEM    +SFVLHT + +  D            ++EAEIA GL
Sbjct  833   RRAAGLKQADAHMAVLVQEMAPATVSFVLHTAAVSGADNTRGADGFAPSRTLEAEIAVGL  892

Query  431   GETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPL  252
             GETLASG RGTPWRL   +    V+T AFA+ S   ++H      G +  + VDYS++ L
Sbjct  893   GETLASGARGTPWRLEIDQTSGDVRTTAFASLSTAFMMHEHAMHLG-MNTVAVDYSRQEL  951

Query  251   TVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             + D   R  LG+RL  VG  LE ++G PQD+EGC+VG D++IVQSRPQPL
Sbjct  952   STDKEKRDTLGRRLAAVGAALEAEYGAPQDIEGCVVGDDVYIVQSRPQPL  1001



>gb|KFG41401.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii FOU]
 gb|KFG42284.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=274

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764  MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
            +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  31   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  90

Query  584  SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
            +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  91   ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  150

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
            RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  151  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  208

Query  278  -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                  +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  209  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  268

Query  113  PQPL  102
            PQP+
Sbjct  269  PQPV  272



>gb|KFG31024.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii p89]
 gb|KFH05197.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii MAS]
Length=386

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764  MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
            +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  143  LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  202

Query  584  SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
            +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  203  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  262

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
            RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  263  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  320

Query  278  -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                  +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  321  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  380

Query  113  PQPL  102
            PQP+
Sbjct  381  PQPV  384



>ref|XP_003080697.1| chloroplast alpha-glucan water dikinase isoform 3 (ISS) [Ostreococcus 
tauri]
Length=475

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            V+E   +      RL+VRSSANVEDL+GMSAAGLYES+  +  ++       I+ VWASL
Sbjct  247  VVEEACATLDQNARLVVRSSANVEDLSGMSAAGLYESVIGIDANDVKGVRLAIAEVWASL  306

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPN-LSFVLHTLSPTDHDQNSVEAEIASGLG  429
            Y+RRAVL+RRAAGVPQ +A MAVLVQE LSPN +SFVLHT SP      SV+AE+  GLG
Sbjct  307  YSRRAVLARRAAGVPQSEARMAVLVQE-LSPNAVSFVLHTQSPI-RGAKSVQAELCVGLG  364

Query  428  ETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLT  249
            +TLASG  GTPWR    +    V  LA+AN S  M      P  G+V    VDYS++ L+
Sbjct  365  DTLASGVDGTPWRFEIDRSTGAVDVLAYANHSTSMRCRYGAPTHGKVTNEAVDYSRQELS  424

Query  248  VDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
                 R +L   L ++   LE   GC QDVEG + G DI IVQ+RPQP+
Sbjct  425  TSEEARTRLAASLLSIATELELDLGCAQDVEGGVCGDDIVIVQTRPQPI  473



>ref|XP_001417570.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95863.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=997

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 143/233 (61%), Gaps = 9/233 (4%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            ++++   F    R++VRSSANVEDL GMSAAGLY+SIPNV P++   F   +  VWASLY
Sbjct  767  LQSVAEKFGPNARVMVRSSANVEDLEGMSAAGLYDSIPNVDPNSEDAFSRAVGEVWASLY  826

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGET  423
            T RAV SR AAGV Q +A M VLVQEMLSP +SFVLHT  P  +D N    E A GLGET
Sbjct  827  TTRAVASRAAAGVDQLEAHMCVLVQEMLSPEVSFVLHTKHPLTNDNNEAYVEFALGLGET  886

Query  422  LASGT-RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTV  246
            LASG  RG+P R+S  K   K    AFA+F    +V     A G +  +  DY+   L  
Sbjct  887  LASGAVRGSPCRVSVDKRSGKATVNAFASFG-TALVRDDDSATG-MKSVAADYASHWLHN  944

Query  245  DPVFRHQLGQRLGTVGFFLERKFG-----CPQDVEGCLV-GKDIFIVQSRPQP  105
            D   R ++  +L  +G  LER+        PQDVEGC++   +I IVQ+RPQP
Sbjct  945  DVAKRDEIATKLLAIGSELERELSPRGETLPQDVEGCILPSGEICIVQARPQP  997



>emb|CEG01409.1| Carbohydrate binding module family 20 [Ostreococcus tauri]
Length=1117

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 146/229 (64%), Gaps = 3/229 (1%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             V+E   +      RL+VRSSANVEDL+GMSAAGLYES+  +  ++       I+ VWASL
Sbjct  889   VVEEACATLDQNARLVVRSSANVEDLSGMSAAGLYESVIGIDANDVKGVRLAIAEVWASL  948

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPN-LSFVLHTLSPTDHDQNSVEAEIASGLG  429
             Y+RRAVL+RRAAGVPQ +A MAVLVQE LSPN +SFVLHT SP      SV+AE+  GLG
Sbjct  949   YSRRAVLARRAAGVPQSEARMAVLVQE-LSPNAVSFVLHTQSPI-RGAKSVQAELCVGLG  1006

Query  428   ETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLT  249
             +TLASG  GTPWR    +    V  LA+AN S  M      P  G+V    VDYS++ L+
Sbjct  1007  DTLASGVDGTPWRFEIDRSTGAVDVLAYANHSTSMRCRYGAPTHGKVTNEAVDYSRQELS  1066

Query  248   VDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
                  R +L   L ++   LE   GC QDVEG + G DI IVQ+RPQP+
Sbjct  1067  TSEEARTRLAASLLSIATELELDLGCAQDVEGGVCGDDIVIVQTRPQPI  1115



>ref|XP_003059536.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56668.1| predicted protein [Micromonas pusilla CCMP1545]
Length=975

 Score =   189 bits (480),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 146/234 (62%), Gaps = 15/234 (6%)
 Frame = -2

Query  770  ESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRA  591
            +S  PG  +++VRSS N EDLAG+SAAGLY+S+ NV PS   V G  ++ VWASLYT RA
Sbjct  745  QSFAPG-AKVMVRSSGNAEDLAGLSAAGLYDSVSNVDPSRIDVLGQAVADVWASLYTPRA  803

Query  590  VLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG  411
            V SR AAGV Q+ AAMAVLVQ+ML P +SF+L T  P  +D N   AE+A G GETLASG
Sbjct  804  VGSRAAAGVGQRGAAMAVLVQQMLVPEVSFILMTRHPMTNDPNVAYAELALGHGETLASG  863

Query  410  T-RGTPWRLSSSKFD-DKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
            + RGTPWR+S  + +    Q  A ++F   ++    G  DG +   TV+ +   LTVD  
Sbjct  864  SVRGTPWRVSMDRQNPGSAQVHAVSSFGSALVPDVDG--DGTLKSATVNCASHWLTVDDQ  921

Query  236  FRHQLGQRLGTVGFFLERKFG---------CPQDVEGCLV-GKDIFIVQSRPQP  105
             R QL  RL   G F+E + G          PQDVEGCL     ++IVQ+RPQP
Sbjct  922  KRAQLAGRLVNAGGFIESRLGGNAGPGGSPLPQDVEGCLTPDGALWIVQARPQP  975



>ref|XP_002368480.1| phosphoglucan, water dikinase protein, putative [Toxoplasma gondii 
ME49]
Length=1222

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  979   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1038

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  1039  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  1098

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1099  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  1156

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1157  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1216

Query  113   PQPL  102
             PQP+
Sbjct  1217  PQPV  1220



>ref|XP_001419310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=918

 Score =   188 bits (478),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 146/231 (63%), Gaps = 5/231 (2%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            ++E   S      RL+VRSSANVEDL+GMSAAGLYES+  +   N       I+ VWASL
Sbjct  690  IVERACSALDASARLVVRSSANVEDLSGMSAAGLYESVVGIDAQNVTEVQRAIADVWASL  749

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPN-LSFVLHTLSPTDHDQNSVEAEIASGLG  429
            Y+RRAVL+RRAAGV Q +A MAVL QE LSPN LSFVLHT SP      SV+AE+  GLG
Sbjct  750  YSRRAVLARRAAGVKQSEARMAVLAQE-LSPNALSFVLHTQSPI-RGAKSVQAEVCVGLG  807

Query  428  ETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLT  249
            ETLASG  GTPWR    +    V  LA+AN +  +      P  G+V   +VDYS++ L+
Sbjct  808  ETLASGIDGTPWRFEIDRATGAVDVLAYANHASSLRCRYGAPTFGKVTMESVDYSRQELS  867

Query  248  VDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKD--IFIVQSRPQPL  102
             +   R +LG+RL      LE   G  QDVEG ++G D  + IVQSRPQP+
Sbjct  868  TNADARARLGRRLLKAAIELETALGAAQDVEGGVLGDDEAVIIVQSRPQPI  918



>gb|EPR59823.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii GT1]
Length=1239

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  996   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1055

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  1056  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  1115

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1116  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  1173

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1174  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1233

Query  113   PQPL  102
             PQP+
Sbjct  1234  PQPV  1237



>ref|XP_002502216.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
 gb|ACO63474.1| alpha phosphoglucan water dikinase [Micromonas sp. RCC299]
Length=612

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 144/225 (64%), Gaps = 12/225 (5%)
 Frame = -2

Query  749  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAA  570
             +++VRS+ N EDLAG+SAAGLY+SI NV+P NP V G  ++ VWASLYT RAV SR AA
Sbjct  390  AKVMVRSTGNAEDLAGLSAAGLYDSISNVAPGNPEVLGSAVAEVWASLYTPRAVASRAAA  449

Query  569  GVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT-RGTPW  393
            GV Q+ A MAVLVQ+ML P++SF+L T  P  +D N+  AE+A G GETLASG+ RGTPW
Sbjct  450  GVGQRGAHMAVLVQQMLVPDVSFILMTRHPMTNDPNTAYAELALGHGETLASGSVRGTPW  509

Query  392  RLSSSKFD-DKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQ  216
            R+S ++ +  + Q   +++F   ++    G  DG +  + V+ +   L+ D   R QL  
Sbjct  510  RMSMNRSNPGESQVHTYSSFGTALVPDLDG--DGTLKSVAVNCAGHWLSTDDGARGQLAA  567

Query  215  RLGTVGFFLERKFGC-------PQDVEGCLV-GKDIFIVQSRPQP  105
            RL   G F+E   G         QD+EGCL     +++VQ+RPQP
Sbjct  568  RLVHAGGFVESTLGSVDGGQLLAQDIEGCLTPDGQLWVVQARPQP  612



>gb|KFG62834.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii RUB]
Length=1239

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  996   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1055

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  1056  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  1115

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1116  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  1173

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1174  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1233

Query  113   PQPL  102
             PQP+
Sbjct  1234  PQPV  1237



>gb|ESS33912.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii VEG]
Length=1239

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  996   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1055

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  1056  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  1115

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1116  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  1173

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1174  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1233

Query  113   PQPL  102
             PQP+
Sbjct  1234  PQPV  1237



>gb|EPT28056.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Toxoplasma gondii ME49]
Length=1239

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 156/244 (64%), Gaps = 25/244 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  996   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1055

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GT
Sbjct  1056  ARRAAGVPQHQACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGT  1115

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1116  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSS  1173

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1174  LVKSRVMDYTIEPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1233

Query  113   PQPL  102
             PQP+
Sbjct  1234  PQPV  1237



>ref|XP_003881249.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
 emb|CBZ51216.1| phosphoenolpyruvate synthase, related [Neospora caninum Liverpool]
Length=1180

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 153/240 (64%), Gaps = 21/240 (9%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS ++   F   +  VWASLY+RRA+L+
Sbjct  938   FGARSRLVVRSSANVEDLKGMSAAGLYESVANVSVADVAAFQSAVVTVWASLYSRRAILA  997

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLA-SGTR  405
             RRAAGVPQ  A MAVL+QE++SP LSF+LHT++P + D + + AEIA GLGET+A +GTR
Sbjct  998   RRAAGVPQHHACMAVLIQELVSPELSFILHTVNPLEKDMHHLYAEIAPGLGETVAGAGTR  1057

Query  404   GTPWRLSSSKFDDKVQTLAFANFSEEMI-----------------VHGTGP---ADGEVI  285
             G+P+R+   K   +V  L+F N+S  ++                 +H   P       V 
Sbjct  1058  GSPYRMLVDKTTGEVTMLSFCNYSTSLVPAMPKNRSFTTLRDGKGMHQATPLLTPSSLVK  1117

Query  284   RLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQP  105
                +DY+ +P+T D  +R  +  RL  +   LE +   PQDVEG + G  I++VQSRPQP
Sbjct  1118  SRVMDYTLEPMTQDLGYRVHIAHRLAGIAVTLEAELDGPQDVEGVISGDAIWVVQSRPQP  1177



>ref|XP_007511444.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17565.1| predicted protein [Bathycoccus prasinos]
Length=1340

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 136/224 (61%), Gaps = 8/224 (4%)
 Frame = -2

Query  755   GQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRR  576
               ++  VRSSANVEDLAGMSAAGLY+SIPNV   +   F   +S+VWASLYT RAV SR+
Sbjct  1118  ANSKAFVRSSANVEDLAGMSAAGLYDSIPNVDLQSYDQFALAVSKVWASLYTARAVASRK  1177

Query  575   AAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT-RGT  399
             AA V QKDA M  LVQ  L P  SFVLHT  P       + AE+A GLGETLASG  RGT
Sbjct  1178  AARVSQKDAKMCALVQVALKPECSFVLHTKHPLTESDQDMYAEMALGLGETLASGNVRGT  1237

Query  398   PWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVI---RLTVDYSKKPLTVDPVFRH  228
             PWR   +K   +V    F++F  EM +     +D   +   R+  D     LT D   R+
Sbjct  1238  PWRFDIAKATKEVTVKTFSSFG-EMYIADDSNSDSSALQMKRVFCDDGNHWLTTDEKRRN  1296

Query  227   Q-LGQRLGTVGFFLERKFG-CPQDVEGCLVGK-DIFIVQSRPQP  105
               +G +LG +G +LE   G  PQDVEGCL+    + +VQ+RPQP
Sbjct  1297  DVVGAKLGGLGIYLESTLGNVPQDVEGCLLSDGTLCVVQARPQP  1340



>ref|XP_003078935.1| chloroplast alpha-glucan water dikinase isoform 3 (ISS), partial 
[Ostreococcus tauri]
Length=969

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 137/227 (60%), Gaps = 10/227 (4%)
 Frame = -2

Query  761  FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
            F    R++VRSSANVEDL GMSAAGLY+SIPNVS  +   FG  ++ VWASLYT RAV S
Sbjct  745  FGPNARVMVRSSANVEDLEGMSAAGLYDSIPNVSLHDEDAFGRAVADVWASLYTTRAVAS  804

Query  581  RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT-R  405
            R AAG+   +A M VLVQEMLSP +SFVLHT  P  +D  S   E A GLGETLASG  R
Sbjct  805  RAAAGIDHLEANMCVLVQEMLSPEVSFVLHTKHPLTNDPKSAYLEFALGLGETLASGAVR  864

Query  404  GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
            GTP R+S  +   +    AFA+F   ++     P+  + +    +Y+   L  D   R  
Sbjct  865  GTPCRVSVDRESRRATVNAFASFGTALVRDDESPSGMKSV--AANYTTHWLQTDAKKRED  922

Query  224  LGQRLGTVGFFLERKFG------CPQDVEGCLV-GKDIFIVQSRPQP  105
            +  +L  +G  LER+          QD+EGC++    I+IVQ+RPQP
Sbjct  923  IVGKLVDIGSMLERELSPSSDELLAQDIEGCILPDGQIYIVQARPQP  969



>emb|CEF97682.1| Pyruvate phosphate dikinase,PEP/pyruvate-binding, partial [Ostreococcus 
tauri]
Length=1107

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 137/227 (60%), Gaps = 10/227 (4%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             F    R++VRSSANVEDL GMSAAGLY+SIPNVS  +   FG  ++ VWASLYT RAV S
Sbjct  883   FGPNARVMVRSSANVEDLEGMSAAGLYDSIPNVSLHDEDAFGRAVADVWASLYTTRAVAS  942

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT-R  405
             R AAG+   +A M VLVQEMLSP +SFVLHT  P  +D  S   E A GLGETLASG  R
Sbjct  943   RAAAGIDHLEANMCVLVQEMLSPEVSFVLHTKHPLTNDPKSAYLEFALGLGETLASGAVR  1002

Query  404   GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
             GTP R+S  +   +    AFA+F   ++     P+  + +    +Y+   L  D   R  
Sbjct  1003  GTPCRVSVDRESRRATVNAFASFGTALVRDDESPSGMKSV--AANYTTHWLQTDAKKRED  1060

Query  224   LGQRLGTVGFFLERKFG------CPQDVEGCLV-GKDIFIVQSRPQP  105
             +  +L  +G  LER+          QD+EGC++    I+IVQ+RPQP
Sbjct  1061  IVGKLVDIGSMLERELSPSSDELLAQDIEGCILPDGQIYIVQARPQP  1107



>ref|XP_008889223.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
 gb|KEP60361.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein [Hammondia hammondi]
Length=1239

 Score =   182 bits (461),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 154/246 (63%), Gaps = 25/246 (10%)
 Frame = -2

Query  764   MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
             +F  ++RL+VRSSANVEDL GMSAAGLYES+ NVS  + + F   +  VWASLY+RRAVL
Sbjct  996   LFGTRSRLVVRSSANVEDLKGMSAAGLYESVANVSVMDAVAFRSAVVTVWASLYSRRAVL  1055

Query  584   SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GT  408
             +RRAA VPQ  A MAVL+QE++SP LSF+LHT+ P + D++ + AEI  GLGETLAS GT
Sbjct  1056  ARRAAAVPQHQACMAVLIQELVSPELSFILHTVDPLEKDKHRLYAEICPGLGETLASAGT  1115

Query  407   RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-----------------  279
             RG+P+R+  +K   ++  L+F N+S  ++     P +   I L                 
Sbjct  1116  RGSPYRMLVNKATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTMQQATPQLTPSS  1173

Query  278   -----TVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   +DY+ +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSR
Sbjct  1174  LVKSRVMDYTIEPMTQDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSR  1233

Query  113   PQPL*E  96
             PQ L E
Sbjct  1234  PQFLSE  1239



>ref|XP_005716854.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
 emb|CDF37035.1| Phosphoglucan water dikinase, PWD [Chondrus crispus]
Length=1033

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 142/229 (62%), Gaps = 8/229 (3%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
             +++ F    R++VRSSAN EDL GMS AGLY+SI NV   +       ++RVWASL+T R
Sbjct  808   VQAEFSKSARVMVRSSANAEDLEGMSGAGLYDSIANVPVGSTDALKSAVARVWASLWTSR  867

Query  593   AVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS  414
             A  SR + GVP  + +MAVL+QEM+S + SFV  +  P      ++  E+A G+GETLAS
Sbjct  868   AASSRGSYGVPHDEVSMAVLIQEMISADFSFVGFSYDPVRKSSEAIYIEVAVGMGETLAS  927

Query  413   GTR-GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
              +  G+P+R    +    V+ L+FA++SE ++   +  +DG  +R TVDYS + +T++  
Sbjct  928   ASSLGSPYRFRVDRKSLDVEVLSFASYSEGLV--PSDDSDGLHVR-TVDYSTQQMTINME  984

Query  236   FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKD----IFIVQSRPQPL  102
             FR ++ Q +      LE +FG PQDVEG +   D    I+IVQ+RPQ L
Sbjct  985   FRTEVVQTIAKTIVLLEEEFGGPQDVEGAITADDTTNRIYIVQARPQVL  1033



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   173 bits (439),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            I++L+ +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVS S+P  FG  ++RVWASLY
Sbjct  880  IKSLKIIFPEDGRLIVRSSANVEDLAGMSAAGLYESIPNVSLSDPTNFGSAVARVWASLY  939

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAE  447
            TRRA+LSRR AGVPQ DA MAVLVQEML P LSFVLHT+SP+DHD   VEAE
Sbjct  940  TRRAILSRRVAGVPQGDAKMAVLVQEMLEPELSFVLHTVSPSDHDTRVVEAE  991



>ref|XP_005827807.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
 gb|EKX40827.1| hypothetical protein GUITHDRAFT_164559 [Guillardia theta CCMP2712]
Length=1011

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 131/228 (57%), Gaps = 13/228 (6%)
 Frame = -2

Query  761   FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
             FP   R++VRSSAN EDL  +S AGLY+SI NV           ISRVW SL+T+RA LS
Sbjct  784   FPADARVMVRSSANCEDLQKVSGAGLYDSIANVEVKEEEALASAISRVWQSLWTKRAALS  843

Query  581   RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GTR  405
             RR+AG+  ++A M VLVQ+M++ +LSF+  + +P   D N V  E+  G+GETLAS G  
Sbjct  844   RRSAGLKHEEAVMGVLVQQMVAGDLSFIAFSSNPITRDPNQVYIEMCVGMGETLASAGQA  903

Query  404   GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADG---EVIRLTVDYSKKPLTVDPVF  234
             GTP+R +  K   +    + A+FS  ++     PADG   E+    +DYS  PL  D   
Sbjct  904   GTPYRFTYDKSKGEAAVSSLASFSFALV-----PADGKGKELKEEVIDYSSIPLHTDEAL  958

Query  233   RHQLGQRLGTVGFFLERKFGCPQDVEGCLV----GKDIFIVQSRPQPL  102
             R  L +R+      L ++ G  QDVEG +V       + IVQ+RP  L
Sbjct  959   RSSLIKRIAKAVMLLAKERGTEQDVEGVVVLDSKEPQVHIVQARPMVL  1006



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  782  IETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLY  603
            I++L+ +FP   RLIVRSSANVEDLAGMSAAGLYESIPNVS S+P  FG  ++RVWASLY
Sbjct  874  IKSLKIIFPEDGRLIVRSSANVEDLAGMSAAGLYESIPNVSLSDPTNFGSAVARVWASLY  933

Query  602  TRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHT  489
            TRRA+LSRR AGVPQ DA MAVLVQEML P LSFVLHT
Sbjct  934  TRRAILSRRVAGVPQGDAKMAVLVQEMLEPELSFVLHT  971



>emb|CDW77583.1| water chloroplastic-like [Stylonychia lemnae]
Length=991

 Score =   152 bits (385),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 84/219 (38%), Positives = 131/219 (60%), Gaps = 9/219 (4%)
 Frame = -2

Query  746  RLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAG  567
            ++ VRSS+ +EDL+ M+ AGL++S  N++  N +     I  VW SL+T RA++SR    
Sbjct  775  QVAVRSSSTLEDLSKMAGAGLFDSYLNITLGNKVQLSQSIIDVWLSLFTERAIISRNQYK  834

Query  566  VPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTR-GTPWR  390
            +P   A M+VL+Q+ +    SF++HT +P + +QN V  E+A GLGETLAS  + GTP+R
Sbjct  835  IPSSQAQMSVLIQQQIHSEFSFIIHTQNPVNKNQNEVYIEVAVGLGETLASANQSGTPYR  894

Query  389  LSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRL  210
            +S  K  + V  L+FAN+   +  + +  +    I   +DYSK   + DP     LG+ L
Sbjct  895  ISYDKKTEVVNVLSFANYQNGLFANKSEISG---IERVLDYSKIEYSSDPTQLLSLGRLL  951

Query  209  GTVGFFLERKF-GCPQDVEGCLVGKD----IFIVQSRPQ  108
            G +G  +E  + G  QD+EG +V ++    I+IVQ+R Q
Sbjct  952  GMIGERIESAYSGQAQDIEGAIVFENSAPKIYIVQTRNQ  990



>gb|EJY83942.1| hypothetical protein OXYTRI_18322 [Oxytricha trifallax]
Length=1101

 Score =   150 bits (378),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 90/234 (38%), Positives = 141/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  785   VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
             V E L+ + P  T + VRSS+ +EDL+ M+ AGL++S  N++  +     + I+ VW SL
Sbjct  871   VQEALKDL-PQDTLVAVRSSSTLEDLSKMAGAGLFDSYLNITLGDREQLINSITDVWLSL  929

Query  605   YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
             +T RA++SR+   +P   A M+VL+Q+ +  + SF++HT +P +++QN +  E+A GLGE
Sbjct  930   FTERAIISRKQYNIPSSQAQMSVLIQQQIHSDFSFIIHTQNPMNNNQNEIYIEVAVGLGE  989

Query  425   TLASGT-RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLT  249
             TLAS   +GTP+RL  +K   +   L+FAN+S  +     G  + E  RL VDY     +
Sbjct  990   TLASANQQGTPYRLCFNKTTQEAHILSFANYSMGLFAQ-KGQKEAEE-RL-VDYGTIQYS  1046

Query  248   VDPVFRHQLGQRLGTVGFFLERKFGC-PQDVEGCLVGK------DIFIVQSRPQ  108
              DP    QLG++LG VG  +E  +G   QD+EG +V +       I++VQ+R Q
Sbjct  1047  QDPQTLIQLGKQLGQVGQAIESSYGGHAQDIEGAIVYEGQTKTPKIYVVQTRNQ  1100



>ref|XP_002949771.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
 gb|EFJ49323.1| hypothetical protein VOLCADRAFT_90138 [Volvox carteri f. nagariensis]
Length=1125

 Score =   147 bits (372),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 132/260 (51%), Gaps = 52/260 (20%)
 Frame = -2

Query  743   LIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISR----------------VWA  612
             L +RSSANVEDLAGMSAAGLY+S+  V   +    G  ++                    
Sbjct  870   LALRSSANVEDLAGMSAAGLYDSVVGVPADDAEAVGKAVAEHSIMSTHLLSPTHPTPTLV  929

Query  611   SLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGL  432
             +++T     + RAA V Q  A MAVL  EM++P+LSFVLHT  P D +   + AE+A G 
Sbjct  930   AVFTD----AFRAARVSQSSARMAVLAMEMVAPDLSFVLHTARPRDGNSEVLLAEVAPGQ  985

Query  431   GETLASGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGP-----------------  303
             GETLASGTRGTPWR   +K    V TLAFANFS  +++ G G                  
Sbjct  986   GETLASGTRGTPWRFEVAKSSGAVTTLAFANFSTALVLPGKGKPVAAFASYGSGAAAAAA  1045

Query  302   ---------ADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKF-GCPQDVEG  153
                          ++   VDY  + ++ D  +R    +++  VG ++E+   G PQD+EG
Sbjct  1046  ASTSTSTHRRSSALVEREVDYGAQRMSADGDWRKATVRQMAAVGSYIEKAMGGVPQDIEG  1105

Query  152   CLV-----GKDIFIVQSRPQ  108
              +V     G  + I Q+RPQ
Sbjct  1106  GVVIRSDGGISLHIFQTRPQ  1125



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 121/252 (48%), Gaps = 78/252 (31%)
 Frame = -2

Query  752  QTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRA  573
            Q  L VRSSANVEDLAGMSA                                        
Sbjct  768  QLLLAVRSSANVEDLAGMSA----------------------------------------  787

Query  572  AGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPW  393
             GV Q  A MAVLV EM++P+LSFVLHT  P D +   + AE+A G GETLASG RGTPW
Sbjct  788  -GVSQSSARMAVLVMEMVAPDLSFVLHTARPRDGNDKVLLAEVAPGQGETLASGVRGTPW  846

Query  392  RLSSSKFDDKVQTLAFANFSEEMIV--------------HGTGPA-------DGE-----  291
            R    K   KV TLA+ANFS  +++              +G+G A        GE     
Sbjct  847  RFEVEKASGKVDTLAYANFSTALMLPAQGTAAAVPAFAAYGSGAATSLIAGSGGEARPLP  906

Query  290  -----VIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKF-GCPQDVEGCLV-GKD-  135
                 ++   VDYS + ++ D  +R    Q+L  VG  +E+   G PQD+EG +V G+D 
Sbjct  907  HVPTALVDREVDYSTQRMSADKDWRVATVQKLAEVGGSIEKAMGGVPQDIEGGVVLGRDG  966

Query  134  ---IFIVQSRPQ  108
               + + Q+RPQ
Sbjct  967  ALALHVFQTRPQ  978



>gb|KFG99987.1| pyruvate phosphate dikinase, pep/pyruvate binding domain-containing 
protein, partial [Toxoplasma gondii VAND]
Length=175

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 100/173 (58%), Gaps = 25/173 (14%)
 Frame = -2

Query  551  AAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLAS-GTRGTPWRLSSSK  375
            A MAVL+QE++SP LSF+LHT++P + D++ + AEI  GLGETLAS GTRG+P+R+  +K
Sbjct  3    ACMAVLIQELVSPELSFILHTVNPLEKDKHRLYAEICPGLGETLASAGTRGSPYRMLVNK  62

Query  374  FDDKVQTLAFANFSEEMIVHGTGPADGEVIRL----------------------TVDYSK  261
               ++  L+F N+S  ++     P +   I L                       +DY+ 
Sbjct  63   ATGEMTMLSFCNYSTSLV--PAMPKNRSFIALREGKTTQQATPQLTPSSLVKSRVMDYTI  120

Query  260  KPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
            +P+T D  +R  +  RL  V   LE +   PQDVEG + G  +++VQSRPQP+
Sbjct  121  EPMTHDLGYRVHIAHRLAGVAVALEAELEGPQDVEGVISGDAVWVVQSRPQPV  173



>ref|XP_003058800.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57255.1| predicted protein [Micromonas pusilla CCMP1545]
Length=693

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 119/224 (53%), Gaps = 17/224 (8%)
 Frame = -2

Query  743  LIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGV  564
            L+ R S+NV+DLAG +  G+Y+ +  V  S+P      + +V AS Y+  AV++R A G+
Sbjct  474  LVARVSSNVDDLAGTAGRGVYDVVVGVPASSPDAVARAVLKVMASAYSETAVINRLACGL  533

Query  563  PQKDAAMAVLVQEMLSPNLSFVLHT---LSPTDHDQNSVEAEIASGLGETLA---SGTRG  402
               DA +A +V E      +F L T    SPT H      A++  G G + A   +G RG
Sbjct  534  DSADARVAAIVSETAPAATAFELDTGGVASPTLH------ADVVVGFGHSHARVGAGARG  587

Query  401  TPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL---TVDYSKKPLTVDPVFR  231
            +PWRL   K D  V+T AFA+ S  + +       G   RL     DYSK+PL++D   R
Sbjct  588  SPWRLRVDKRDGSVETCAFASLSTSLTLRALDENCGGGARLRREAADYSKQPLSLDADAR  647

Query  230  HQLGQRLGTVGFFLERKF-GCPQDVEGCLVGKD-IFIVQSRPQP  105
               G++L  VG  LE +F G  Q VEGC+ G   ++ VQSR  P
Sbjct  648  VDAGRKLAAVGVALEHEFDGAAQIVEGCVDGDGVVWAVQSRNAP  691



>emb|CDJ38268.1| phosphoglucan, water dikinase protein, putative, partial [Eimeria 
tenella]
Length=807

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 124/250 (50%), Gaps = 48/250 (19%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            + F  + RL +RSSANVEDL G SAAGLYES+ NV   +   F   +  VWASLY RRAV
Sbjct  577  NFFGPKARLCLRSSANVEDLQGASAAGLYESVANVPVGDLGAFCSGVQTVWASLYCRRAV  636

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNS-----------------  459
            L+R+ +G+ Q +A MAVL+QE+L P +SF+LHT      +  S                 
Sbjct  637  LARKVSGLSQGEARMAVLMQELLVPEMSFILHTGGIEQQNCRSLNLQDSSSSSSSSSSSR  696

Query  458  ----------VEAEIASGLGETLASG-TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHG  312
                      V AE+A GLGE LA G TRGT +R+   +               E +   
Sbjct  697  KGQQKRAKAQVYAELAPGLGEVLAGGRTRGTGYRMLVDR---------------ETVRDS  741

Query  311  TGPADGEVI-RLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKD  135
             GP++  +  ++T D +          R    +++  +   LE     PQDVEG      
Sbjct  742  GGPSNVPLTQQITYDQTGDTFAASAAARAAAAKQIARLAAALEG----PQDVEGVFTKNG  797

Query  134  IFIVQSRPQP  105
            +++VQ+RPQP
Sbjct  798  LYVVQARPQP  807



>ref|XP_002502953.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO64211.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=1625

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 128/237 (54%), Gaps = 17/237 (7%)
 Frame = -2

Query  773   LESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRR  594
              ES   G   L VR+SANV+D A MS    + S+  V  ++       ++ VWASL+T  
Sbjct  1393  FESGKFGTGLLAVRASANVDDPAQMSGCSGHLSVVGVQANSCAAVAEAVAAVWASLFTPE  1452

Query  593   AVLSRRAAGVPQKDAA-MAVLVQEMLSPNLSFVLHT---------LSPTDHDQNSVEAEI  444
             AV +R AAGV     A MAV+VQEM     SFVLHT         L+P       +E E+
Sbjct  1453  AVQTRAAAGVAASADAHMAVIVQEMAPAATSFVLHTGGRIESVKSLNPGALPDPRLEVEL  1512

Query  443   ASGLGETLA---SGTRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTV  273
             A GLGE LA   SG+RG PWR+          T AF       +     P  G +    V
Sbjct  1513  AVGLGEALARSGSGSRGDPWRVEVDLATGDATTTAFGGVGMARVYQ---PHLG-LRDEAV  1568

Query  272   DYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
             DYSK+ L++D   R +L +RL  VG  LE +FG PQ+VEGCLVG D+++ QSRPQPL
Sbjct  1569  DYSKQELSLDAGARERLCRRLAAVGAALEAEFGGPQNVEGCLVGDDVYVFQSRPQPL  1625



>ref|WP_037040400.1| phosphoenolpyruvate synthase [Pseudonocardia autotrophica]
Length=860

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 109/216 (50%), Gaps = 18/216 (8%)
 Frame = -2

Query  749  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAA  570
            T   VRSSA  EDL   S AG  ++  NV  +  ++ G  + R WASL+T RAV  R   
Sbjct  104  TAYAVRSSATAEDLPTASFAGQQDTYLNVVGAAAVLDG--VRRCWASLFTERAVAYRLRG  161

Query  569  GVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWR  390
            GV  +   MAV+VQEM+ P+ S VL T  P   ++     E   GLGE L SG       
Sbjct  162  GVEHRQVRMAVVVQEMVVPDASGVLFTADPVTSNRRVTSVEAVLGLGEALVSGL------  215

Query  389  LSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLG  219
            +++ +F   D  V   A A  ++E  V  T        ++  +  ++P   D        
Sbjct  216  VNADRFTVHDGTVVDRAIA--TKEWAVRATAGGGTRSQKVPPEARQQPALTDAQV-----  268

Query  218  QRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             RL  +G  +E+ FGCPQD+E CL G+D+ IVQSRP
Sbjct  269  LRLADLGRRIEKYFGCPQDIEWCLAGEDVRIVQSRP  304



>ref|XP_009359183.1| PREDICTED: alpha-glucan water dikinase, chloroplastic [Pyrus 
x bretschneideri]
Length=308

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 96/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632  CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
             I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  110  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  169

Query  452  AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
            AE+  GLGETL     G      S K D D  Q L + +     F +  I+         
Sbjct  170  AEVVKGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  229

Query  314  -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                 G G  D     E  ++ VDYS  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  230  LEGYAGAGLYDSVPMDEEEKVVVDYSSDPLMVDGNFRKTILSSIARAGSAIEELYGSPQD  289

Query  161  VEGCLVGKDIFIVQSRPQ  108
            +EG +    +++VQ+RPQ
Sbjct  290  IEGVIRDGKLYVVQTRPQ  307



>ref|XP_002506750.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68008.1| predicted protein [Micromonas sp. RCC299]
Length=785

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 97/202 (48%), Gaps = 24/202 (12%)
 Frame = -2

Query  635  HCISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSV  456
              + +VWAS +  RA LSR+A GVP     MA L+ E++    +FVLHT +P   D   V
Sbjct  584  QAVKKVWASKWNERAFLSRKACGVPDDSLHMATLLMEVVPAEHAFVLHTANPLTGDAGEV  643

Query  455  EAEIASGLGETLASGTRGTPWRLSSSKFDDKV--------QTLAFANFSEEMIVH-----  315
              E+  GLGE L     G+    +++K    +        + +A       MIV      
Sbjct  644  FGEVCVGLGEALVGNEPGSALSFTAAKTPGSIPMVKQLPSKPIAHRTPYTTMIVRSDSNG  703

Query  314  -------GTGPADGEVIRLT----VDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCP  168
                   G G  D   +  T    V Y+ +PL  D   R +L  RL  +   +E + GCP
Sbjct  704  EDLEGFAGAGLYDSVTVVATEESVVRYADEPLVWDEPMRTRLMSRLAELAVAVEAEMGCP  763

Query  167  QDVEGCLVGKDIFIVQSRPQPL  102
            QD+EGC+VG+ I+++QSR Q L
Sbjct  764  QDIEGCVVGEHIYVLQSRNQVL  785



>ref|WP_037893238.1| phosphoenolpyruvate synthase, partial [Streptomyces sp. Tu 6176]
 gb|EYT80903.1| phosphoenolpyruvate synthase, partial [Streptomyces sp. Tu 6176]
Length=435

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 106/216 (49%), Gaps = 18/216 (8%)
 Frame = -2

Query  749  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAA  570
            T   VRSSA  EDL   S AG  ++  NV  +   V  H ISR WASL+T RAV+ RR  
Sbjct  128  TAYAVRSSATAEDLPTASFAGQQDTYLNVVGTEA-VLAH-ISRCWASLFTERAVVYRRRN  185

Query  569  GVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWR  390
            G+  +   MAV+VQ M+ P  + VL T  P   D+     E A GLGE L SG       
Sbjct  186  GIDHRGVRMAVVVQRMVFPRAAGVLFTADPVTGDRRVATVEAAFGLGEALVSGA------  239

Query  389  LSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLG  219
            ++   F   D++V  ++    ++E  VH   P  G    +  +     L   P       
Sbjct  240  VNPDVFRVRDNEV--VSETTGAKERAVHAL-PGGG----VREEAVAAELRERPALTRAEA  292

Query  218  QRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             RL  +G  +E +FGCPQD+E CL   +  IVQSRP
Sbjct  293  VRLVRLGRRIEERFGCPQDIEWCLADGEFQIVQSRP  328



>ref|XP_010100417.1| Alpha-glucan water dikinase [Morus notabilis]
 gb|EXB82551.1| Alpha-glucan water dikinase [Morus notabilis]
Length=1436

 Score =   107 bits (267),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 92/176 (52%), Gaps = 3/176 (2%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1262  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIY  1321

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFANFSEEMIVHGTGPADGEVIRLT  276
             AE+  GLGETL     G        K D +  Q   + +    + +    P D E  ++ 
Sbjct  1322  AEVVKGLGETLVGAYPGRALSFLCKKNDLNSPQVSGYPSKPIGLFIRRV-PMDEEE-QVV  1379

Query  275   VDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQ  108
             +DYS  PL VD  FRH +   +   G  +E  +G PQD+EG +    +++VQ+RPQ
Sbjct  1380  LDYSSDPLIVDDDFRHSILSSIARAGSAIEELYGSPQDIEGVIRDGKLYVVQTRPQ  1435



>ref|WP_003329829.1| phosphoenolpyruvate synthase [Bacillus azotoformans]
 gb|EKN68655.1| phosphoenolpyruvate synthase [Bacillus azotoformans LMG 9581]
Length=865

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 129/277 (47%), Gaps = 47/277 (17%)
 Frame = -2

Query  785  VIETLE---SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVW  615
            V+ET+    S+F  +    VRSSA  EDL   S AG  ++  NV    PI+  H I + W
Sbjct  96   VVETVTHYLSLFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNVIGKEPIL--HHIKKCW  153

Query  614  ASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASG  435
            ASL+T RAV+ R   G       ++V++Q+M+ P  S +L T+ P   ++  +  + + G
Sbjct  154  ASLFTDRAVIYRMQNGFDHSQVYLSVIIQKMVFPQASGILFTVDPITSNRKLLSIDASFG  213

Query  434  LGETLASGTRGTPWRLSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYS  264
            LGE L SG       +S   F   +DK+     A  ++++ ++G      E   +  +  
Sbjct  214  LGEALVSGL------VSPDYFTVQEDKIVDKRIA--TKKLAIYGRKEGGTEAQEVNPNQQ  265

Query  263  KKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQ----PL*E  96
            +    V  +   Q+ Q L  +G  +E  FGCPQD+E CLV +  +IVQSRP     P+ E
Sbjct  266  E----VQTLTDQQILQ-LARIGRQIEAYFGCPQDIEWCLVDETFYIVQSRPITTLFPIPE  320

Query  95   YH----------------------LSLVFFFLLEFCP  51
             H                      L L FF L  F P
Sbjct  321  AHDEENHVYVSVGHQQMMTDPIKPLGLSFFLLTTFAP  357



>ref|XP_006841018.1| hypothetical protein AMTR_s00085p00105120 [Amborella trichopoda]
 gb|ERN02693.1| hypothetical protein AMTR_s00085p00105120 [Amborella trichopoda]
Length=1385

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 98/198 (49%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R A +      MAVLVQE++S + +FV+HT++P+  D + + 
Sbjct  1187  AIKKVWASKWNERAYFSTRKAKLDHNYLCMAVLVQEIISADYAFVIHTINPSSRDSSEIY  1246

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K + D  + L + +     F +  I+         
Sbjct  1247  AEVVKGLGETLVGAYPGRALSYVCKKTNLDSPKILGYPSKPIGLFIKRSIIFRSDSNGED  1306

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS   L VDP FR+ +   +   G  +E  +G PQD
Sbjct  1307  LEGYAGAGLYDSVPMDEEEKVVLDYSTDRLLVDPGFRNSILSSIAKAGSAIEELYGSPQD  1366

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    IF+VQ+RPQ
Sbjct  1367  IEGVVKDGKIFVVQTRPQ  1384



>ref|WP_036094414.1| phosphoenolpyruvate synthase [Listeriaceae bacterium FSL M6-0635]
 gb|KGL39401.1| phosphoenolpyruvate synthase [Listeriaceae bacterium FSL M6-0635]
Length=866

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 108/220 (49%), Gaps = 16/220 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV   + I+    I + WASL+T RAV
Sbjct  105  SKFGAEHAYAVRSSATAEDLPSASFAGQQDTYLNVIGVDAIL--QHIRKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G   +   ++V+VQ M+ P  S +L T  P   D+  V  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRGVYLSVVVQRMVFPEASGILFTADPITADRKVVSVDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +R+      +KV        ++++ ++G      + + L V   + + LT   + 
Sbjct  223  VSADSYRVRDGAVIEKVIA------TKKLAIYGLVAGGTKTLELDVAQQRMQTLTEAQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   L  +G  +E  FGCPQD+E CLVG D +IVQSR
Sbjct  277  ------ELARIGRLVEAYFGCPQDIEWCLVGDDFYIVQSR  310



>ref|NP_001167723.1| uncharacterized protein LOC100381411 [Zea mays]
 gb|ACN25891.1| unknown [Zea mays]
Length=231

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 96/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632  CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
             I +VWAS +  RA  S R   +  +  +MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  33   AIKKVWASKWNERAYFSTRKVKLDHEYLSMAVLVQEVVNADYAFVIHTTNPSSGDSSEIY  92

Query  452  AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
            AE+  GLGETL     G        K D D  + L + +     F  + I+         
Sbjct  93   AEVVKGLGETLVGAYPGRAMSFVCKKDDLDSPKLLGYPSKPIGLFIRQSIIFRSDSNGED  152

Query  314  -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                 G G  D     E   + +DY+  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  153  LEGYAGAGLYDSVPMDEEDEVVLDYTTDPLIVDRGFRSSILSSIARAGHAIEELYGSPQD  212

Query  161  VEGCLVGKDIFIVQSRPQ  108
            VEG +    I++VQ+RPQ
Sbjct  213  VEGVVKDGKIYVVQTRPQ  230



>ref|WP_036133343.1| phosphoenolpyruvate synthase [Listeriaceae bacterium FSL A5-0209]
 gb|KGL38048.1| phosphoenolpyruvate synthase [Listeriaceae bacterium FSL A5-0209]
Length=866

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 108/220 (49%), Gaps = 16/220 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV   + I+    I + WASL+T RAV
Sbjct  105  SKFGAEHAYAVRSSATAEDLPSASFAGQQDTYLNVIGVDAIL--QHIRKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G   +   ++V+VQ M+ P  S +L T  P   D+  V  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRGVYLSVVVQRMVFPEASGILFTADPITADRKVVSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +R+      +KV        ++++ ++G      + + L V   + + LT   + 
Sbjct  223  VSADSYRVRDGAVIEKVIA------TKKLAIYGLVAGGTKTLELDVAQQRMQTLTEAQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
                   L  +G  +E  FGCPQD+E CLVG D +IVQSR
Sbjct  277  ------ELARIGRLVEAYFGCPQDIEWCLVGDDFYIVQSR  310



>ref|WP_027321038.1| phosphoenolpyruvate synthase [Bacillus sp. URHB0009]
Length=871

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 108/220 (49%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  Q    VRSSA  EDL   S AG + +  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFDDQYAYAVRSSATAEDLPYASFAGQHNTYLNIIGKEAIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R       +   ++V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRIQNQFEHRQVYLSVIVQKMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   K  DK   +A    ++++ ++G      E  +LT D   K    D    
Sbjct  223  VSADCYKVQEDKIVDK--RIA----AKKLAIYGQKEGGTETKQLTPDQQVKQTLTD----  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q   +L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  -QQILKLAHIGRQIEDYFGCPQDIEWCLANDTFYIVQSRP  311



>ref|WP_012984865.1| phosphoenolpyruvate synthase [Listeria seeligeri]
 emb|CBH26519.1| PEP/pyruvate-binding protein [Listeria seeligeri serovar 1/2b 
str. SLCC3954]
Length=865

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 113/219 (52%), Gaps = 16/219 (7%)
 Frame = -2

Query  761  FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
            F       VRSSA  EDL   S AG +++  N+    P +F H I + WASL+T RA++ 
Sbjct  107  FDANEAFAVRSSATAEDLLTASFAGQHDTYLNII-GKPALFRH-IKKCWASLFTERAIIY  164

Query  581  RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TR  405
            R           ++V++Q+M+ P  S +L T  P   ++ S+  + + GLGE L SG   
Sbjct  165  RIQNNFDHSKVYLSVIIQKMVFPQASGILFTADPITANRKSISIDASFGLGEALVSGLVS  224

Query  404  GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-TVDYSKKPLTVDPVFRH  228
               +++  +K  +K+        ++++ ++G      E  ++ ++  +++ LT + +   
Sbjct  225  ADAYKVQENKITEKIIP------TKKIAIYGLTDGGTETRQIDSIKQTEQTLTDEQIL--  276

Query  227  QLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                +L  +G  +E  FG PQD+E CLV  D +IVQSRP
Sbjct  277  ----KLAKLGRKIETHFGKPQDIEWCLVNNDFYIVQSRP  311



>gb|AAO42141.1| unknown protein [Arabidopsis thaliana]
Length=1278

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1081  IKKVWASKWNERAYVSCKKNKLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL     G      + K + K  T+          +S+  I+          
Sbjct  1141  EIVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL +D  FR +L   +   G  +E  +GCPQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIMDKSFRVRLFSAIAEAGNVIESIYGCPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>ref|NP_194176.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q9STV0.3|GWD2_ARATH RecName: Full=Alpha-glucan water dikinase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE84906.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1278

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1081  IKKVWASKWNERAYVSCKKNKLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL     G      + K + K  T+          +S+  I+          
Sbjct  1141  EIVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL +D  FR +L   +   G  +E  +GCPQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIMDKSFRVRLFSAIAEAGNVIESIYGCPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>emb|CAB45080.1| putative protein [Arabidopsis thaliana]
 emb|CAB79355.1| putative protein [Arabidopsis thaliana]
Length=1288

 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1091  IKKVWASKWNERAYVSCKKNKLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1150

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL     G      + K + K  T+          +S+  I+          
Sbjct  1151  EIVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSIIFRSDSNNEDL  1210

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL +D  FR +L   +   G  +E  +GCPQD+
Sbjct  1211  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIMDKSFRVRLFSAIAEAGNVIESIYGCPQDI  1270

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1271  EGVVKGGHIYIVQARPQ  1287



>ref|XP_008340080.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=1403

 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 96/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1205  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1264

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G      S K D D  Q L + +     F +  I+         
Sbjct  1265  AEVVKGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  1324

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ VDYS  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1325  LEGYAGAGLYDSVPMDEEEKVVVDYSSDPLMVDGNFRKTILSSIARAGSAIEELYGSPQD  1384

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    +++VQ+RPQ
Sbjct  1385  IEGVIRDGKLYVVQTRPQ  1402



>ref|XP_008340079.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=1404

 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 96/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1206  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1265

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G      S K D D  Q L + +     F +  I+         
Sbjct  1266  AEVVKGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  1325

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ VDYS  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1326  LEGYAGAGLYDSVPMDEEEKVVVDYSSDPLMVDGNFRKTILSSIARAGSAIEELYGSPQD  1385

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    +++VQ+RPQ
Sbjct  1386  IEGVIRDGKLYVVQTRPQ  1403



>ref|XP_001765216.1| predicted protein [Physcomitrella patens]
 gb|EDQ69944.1| predicted protein [Physcomitrella patens]
Length=1338

 Score =   105 bits (263),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 93/195 (48%), Gaps = 25/195 (13%)
 Frame = -2

Query  620   VWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIA  441
             VWAS +  RA  S R   +   D  MAVLVQE++  + +FV+HT +P+  D+  + AE+ 
Sbjct  1144  VWASKWNERAYFSTRKTNIDHSDLCMAVLVQEIIQADYAFVIHTTNPSTGDETEIYAEVV  1203

Query  440   SGLGETLASGTRGTPWRLSSSKFDDK----------------VQTLAFANFSEEMIVHGT  309
              GLGETL     G      + K D K                 Q++ F + S    + G 
Sbjct  1204  KGLGETLVGAYSGRALSFVTKKSDMKNPKVLGYPSKRVGLFIRQSIIFRSDSNGEDLEGY  1263

Query  308   G--------PADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEG  153
                      P D E  R+ VDYS   L +D  F+  +  ++   G  +E+   C QD+EG
Sbjct  1264  AGAGLYDSVPMDEEEERV-VDYSTDRLILDEAFQKTILTKIAEAGLAIEKNLQCAQDIEG  1322

Query  152   CLVGKDIFIVQSRPQ  108
              +   ++FIVQ+RPQ
Sbjct  1323  VVKDNELFIVQTRPQ  1337



>ref|WP_029442716.1| phosphoenolpyruvate synthase [Bacillus thuringiensis]
Length=869

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 110/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SHFGDEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKENIL--QHIKKCWASLFTNRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V++Q+M+ P++S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPDVSGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   K  +KV        ++++ ++G      E  ++  +  K    V  +  
Sbjct  223  VSADNYKIKEDKIVEKVIA------TKKLAIYGRKEGGTETKKIAPNQQK----VQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_033799053.1| phosphoenolpyruvate synthase [Bacillus pseudomycoides]
Length=871

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 106/210 (50%), Gaps = 14/210 (7%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RA++ R   G   
Sbjct  115  VRSSATAEDLPFASFAGQQDTYLNIIGKDEIL--RYISKCWASLFTDRAIIYRIQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTV  201
             K  DK+        ++++ ++G      E  ++  D  K       +  HQ+ Q L  +
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQK----TQTLTEHQILQ-LARI  281

Query  200  GFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  282  GREIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_031880289.1| phosphoenolpyruvate synthase [Staphylococcus aureus]
 gb|EYQ98655.1| hypothetical protein W284_02225 [Staphylococcus aureus DAR3163]
Length=867

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S+F  +    VRSSA  EDL   S AG +++  NV     I+    IS+ WASL+T RAV
Sbjct  105  SLFGDEHAYAVRSSATAEDLPHASFAGQHDTYLNVIGKEAIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFEHSKVYLSVIIQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK+        ++++ ++G      E + +  D  K     D    
Sbjct  223  VSADCYKVQEEEIIDKMIA------TKKLAIYGRKEGGTETVPIGPDQQKTQKLTD----  272

Query  230  HQLGQ--RLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               GQ  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  ---GQILQLARIGRQIEAYFGCPQDIEWCLVDDIFYIVQSRP  311



>gb|EEM15911.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus pseudomycoides 
DSM 12442]
Length=876

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 106/210 (50%), Gaps = 14/210 (7%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RA++ R   G   
Sbjct  120  VRSSATAEDLPFASFAGQQDTYLNIIGKDEIL--RYISKCWASLFTDRAIIYRIQNGFDH  177

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  178  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  237

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTV  201
             K  DK+        ++++ ++G      E  ++  D  K       +  HQ+ Q L  +
Sbjct  238  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQK----TQTLTEHQILQ-LARI  286

Query  200  GFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  287  GREIEAYFGCPQDIEWCLVDDTFYIVQSRP  316



>ref|WP_025364920.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
 gb|AHM66158.1| pyruvate phosphate dikinase pep/pyruvate-binding protein [Paenibacillus 
polymyxa SQR-21]
Length=872

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G   +   ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPQASGILFTADPINGNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|XP_006285458.1| hypothetical protein CARUB_v10006877mg [Capsella rubella]
 gb|EOA18356.1| hypothetical protein CARUB_v10006877mg [Capsella rubella]
Length=1278

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1081  IKKVWASKWNERAYVSCKKTKLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1141  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKSSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  FR +L   +   G  +E  +G PQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKDFRVRLFSTIAEAGNMIETLYGSPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>ref|WP_031461485.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=868

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G   +   ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPQASGILFTADPINCNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_044785990.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
 gb|KJD40560.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=872

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G   +   ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPQASGILFTADPINCNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_039276034.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
 gb|AIY07122.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=872

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 109/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G   +   ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPQASGILFTADPINCNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_038243108.1| phosphoenolpyruvate synthase [Virgibacillus sp. Vm-5]
 emb|CDQ39174.1| Phosphoenolpyruvate synthase [Virgibacillus sp. Vm-5]
Length=870

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 106/220 (48%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  E+  N+     I+  H I + WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPYASFAGQQETYLNIIGKEAIL-SH-IRKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G   +   ++V+VQ M+ P+ S +L T  P   ++  +    + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPHASGILFTADPITSNRKLLSINASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK+  +      +++ ++G      E  ++  D  K     +    
Sbjct  223  VSADCYKVKEEEIIDKMIAI------KKLAIYGRKEGGTETQQIDADQQKTQTLTEQQIL  276

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            H     L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  H-----LARIGKRIEAYFGCPQDIEWCLVDDTCYIVQSRP  311



>ref|WP_020061851.1| phosphoenolpyruvate synthase [Bacillus sp. 123MFChir2]
Length=871

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SKFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIM--QQISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ M+ P +S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQVSGILFTADPITSNRKLLSIDASYGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  DK+        ++++ ++G      E  ++  D  K + LT   + 
Sbjct  223  VSADCYKVQEEEIVDKMIA------TKKLAIYGLKEGGTETQQINPDQQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>dbj|GAF25000.1| phosphoenolpyruvate synthase/pyruvate phosphate dikinase [Moorella 
thermoacetica Y72]
Length=317

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 121/218 (56%), Gaps = 9/218 (4%)
 Frame = -2

Query  764  MFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVL  585
            M  G   + VRSSA +ED    S AG +E+   ++    ++    +   WAS+Y  RA++
Sbjct  105  MANGGQVVAVRSSATMEDSEAASCAGQHETYLFITGEEQLLTK--VKECWASMYNPRAIV  162

Query  584  SRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTR  405
             R A GV +++AA+AV+VQ+M++   S V+ T++P + +++ +  E   G GE + SG  
Sbjct  163  YRLAKGVAEEEAAIAVVVQKMVTSEKSGVMFTVNPVNKNRDELIIEAVWGQGEGIVSGLI  222

Query  404  GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
             TP     ++ + KV +   A   E M+V G  P  G+V  + V   K  +T   + + +
Sbjct  223  -TPDNYILNRSERKVISEYIAT-KEIMLVAGEEP--GKVCEVQVPSEK--VTARVLTKSE  276

Query  224  LGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            L Q L  +G  +ER FG PQD+E  + G +I+++QSRP
Sbjct  277  L-QALVKLGEQVERYFGVPQDIEWAIEGDNIYLLQSRP  313



>ref|WP_033221227.1| phosphoenolpyruvate synthase [Streptomyces virginiae]
Length=869

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 103/220 (47%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            + F  Q    VRSSA  EDL   S AG  ++  NV    P      ISR WASL+T RAV
Sbjct  106  ARFGEQAAYAVRSSATAEDLPTASFAGQQDTYLNVV--GPAAILRHISRCWASLFTERAV  163

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
              RR  G+  +   MAV+VQ M+ P  S +L T  P   D+     +   GLGE L SG 
Sbjct  164  TYRRRGGIDHRTVLMAVVVQRMVFPQASGILFTADPVTGDRKVATVDAGFGLGEALVSGL  223

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +R+         + +A A  ++E  VH   PA G    + VD  ++     P   
Sbjct  224  VNPDVFRVRDG------EVVARAIAAKERAVHAL-PAGG-TREVAVDARQQE---QPALT  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  L  +G  +E  FG PQD+E CLV  D  IVQSRP
Sbjct  273  DAQAVSLAALGRRIEAHFGRPQDIEWCLVDGDFRIVQSRP  312



>ref|WP_021288956.1| phosphoenolpyruvate synthase [Virgibacillus sp. CM-4]
 gb|EQB37330.1| phosphoenolpyruvate synthase [Virgibacillus sp. CM-4]
Length=870

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 106/220 (48%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  E+  N+     I+  H I + WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPYASFAGQQETYLNIIGKEAIL-SH-IRKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G   +   ++V+VQ M+ P+ S +L T  P   ++  +    + GLGE L SG 
Sbjct  163  IYRMQNGFDHRQVYLSVIVQRMVFPHASGILFTADPITSNRKLLSINASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK+  +      +++ ++G      E  ++  D  K     +    
Sbjct  223  VSADCYKVQEEEIIDKMIAI------KKLAIYGRKEGGTETQQIDADQQKTQTLTEQQIL  276

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            H     L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  H-----LARIGKRIEAYFGCPQDIEWCLVDDTCYIVQSRP  311



>ref|WP_029488334.1| hypothetical protein [Epulopiscium sp. 'N.t. morphotype B']
Length=878

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 113/218 (52%), Gaps = 10/218 (5%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            ++FP  TR  +RSSA  EDL   S AG  ++  N+S  + I++   I   WASLYT R++
Sbjct  99   AIFPASTRFAIRSSATAEDLKHASFAGQQDTYLNISGIDNILY--AIKSCWASLYTDRSI  156

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            L R    +      MAV+VQ+M++ + + ++ T  P   ++  +  +   GLGE+LASGT
Sbjct  157  LYRNQHNIAHDQVFMAVVVQQMINSDSAGIMFTADPVTGNRKYISIDAGFGLGESLASGT  216

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRH  228
               P     +K   K+++   A   +  ++  T     EV    +D ++  +T   V   
Sbjct  217  I-LPDIYKYNKKLSKIKSKHIA-VKKTAVISDTHIGTTEV---ELDVNQSIMT---VLDD  268

Query  227  QLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSR  114
               ++L  +G  LE+ +  PQD+E C+    IFI+Q+R
Sbjct  269  NTIEQLALLGLKLEQMYDAPQDIEWCIDAGKIFILQTR  306



>ref|WP_019687309.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=872

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 108/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G       ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMMFPQASGILFTADPINGNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_016122772.1| pyruvate, water dikinase [Bacillus cereus]
 gb|EOQ12091.1| pyruvate, water dikinase [Bacillus cereus VD184]
Length=868

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASLYT RAV
Sbjct  105  SHFGDKHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKENIL--QHIKKCWASLYTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVVQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +R+   +  +KV        ++++ ++G      E  ++  +  K    +  +  
Sbjct  223  VSADNYRVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQK----IQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|XP_007227039.1| hypothetical protein PRUPE_ppa000209mg [Prunus persica]
 gb|EMJ28238.1| hypothetical protein PRUPE_ppa000209mg [Prunus persica]
Length=1467

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1269  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1328

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G      S K D D  Q L + +     F    I+         
Sbjct  1329  AEVVKGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPVGLFIRRSIIFRSDSNGED  1388

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1389  LEGYAGAGLYDSVPMDEEEKVVLDYSSDPLMVDGNFRKSILSSIARAGSAIEELYGSPQD  1448

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    +++VQ+RPQ
Sbjct  1449  IEGVIRDGKLYVVQTRPQ  1466



>ref|WP_043070473.1| phosphoenolpyruvate synthase [Aneurinibacillus migulanus]
 gb|KIV56383.1| phosphoenolpyruvate synthase [Aneurinibacillus migulanus]
Length=871

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 108/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIM--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   K  DK+        ++++ ++G      E  ++  D  K + LT   + 
Sbjct  223  VSADCYKVQEDKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDKQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|XP_008245479.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucan water dikinase, 
chloroplastic [Prunus mume]
Length=1471

 Score =   104 bits (259),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1273  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1332

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G      S K D D  Q L + +     F    I+         
Sbjct  1333  AEVVKGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPVGLFIRRSIIFRSDSNGED  1392

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1393  LEGYAGAGLYDSVPMDEEEKVMLDYSSDPLMVDGNFRKSILSSIARAGSAIEELYGSPQD  1452

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    +++VQ+RPQ
Sbjct  1453  IEGVIRDGKLYVVQTRPQ  1470



>ref|WP_043065176.1| phosphoenolpyruvate synthase [Aneurinibacillus migulanus]
 gb|KIV57176.1| phosphoenolpyruvate synthase [Aneurinibacillus migulanus]
Length=871

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 108/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIM--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   K  DK+        ++++ ++G      E  ++  D  K + LT   + 
Sbjct  223  VSADCYKVQEDKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDKQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|XP_010439040.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X3 [Camelina 
sativa]
Length=1042

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D   +  
Sbjct  845   IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSTEIYT  904

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  905   EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  964

Query  314   ----GTGPADGEVI----RLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D  ++     + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  965   EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1024

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1025  EGVVKGGHIYIVQARPQ  1041



>ref|XP_009138061.1| PREDICTED: alpha-glucan water dikinase 2 [Brassica rapa]
Length=1281

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   V      MAVLVQE++  + +FV+HT +P   D + +  
Sbjct  1084  IKKVWASKWNERAYVSCKKTRVDHDAVCMAVLVQEVICGDYAFVIHTNNPVTGDPSEIYT  1143

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL  G  G      + K + K  T+          +S+  ++          
Sbjct  1144  EIVKGLGETLVGGYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSVIFRSDSNNEDL  1203

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++ L VD  F+ +L   +   G  +E  +GCPQD+
Sbjct  1204  EGYAGAGLYDSVIMDEAEEVVVDYSREQLIVDKAFQVRLFSAIAEAGHVIETLYGCPQDI  1263

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I++VQ RPQ
Sbjct  1264  EGVVKGGIIYVVQDRPQ  1280



>ref|WP_043652212.1| phosphoenolpyruvate synthase [Nocardia thailandica]
Length=867

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/215 (35%), Positives = 102/215 (47%), Gaps = 14/215 (7%)
 Frame = -2

Query  752  QTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRA  573
             T   VRSSA  EDL   S AG  ++  NV  + P V  H + R WASL+T RAV  R+ 
Sbjct  109  DTACAVRSSATAEDLPTASFAGQQDTYLNVVGAAP-VLAH-VRRCWASLFTERAVTYRQR  166

Query  572  AGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPW  393
             G   +   MAV+VQ M+ P  + +L T  P   D+  V  +   GLGE L SG      
Sbjct  167  NGFGHRAVDMAVVVQRMVFPRAAGILVTADPVTSDRTVVSVDAGFGLGEALVSGL-----  221

Query  392  RLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIR-LTVDYSKKPLTVDPVFRHQLGQ  216
             +++  +  +   +     + + I     P  G  +R L  D  +  +  D         
Sbjct  222  -VNADVYQVRAGAITAKTVATKKIAMEAVPGGGTRVRELDADRQRAQVLTDEEI-----L  275

Query  215  RLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            RL  +G  +E  FG PQDVE CL G+D  IVQSRP
Sbjct  276  RLAALGRRIEAHFGSPQDVEWCLDGEDFRIVQSRP  310



>ref|WP_009184780.1| phosphoenolpyruvate synthase [Cecembia lonarensis]
 gb|EKB49636.1| Phosphoenolpyruvate synthase [Cecembia lonarensis LW9]
Length=359

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/219 (34%), Positives = 120/219 (55%), Gaps = 22/219 (10%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++   V   +  V  H I   WASLYT RA+  R+   +P+
Sbjct  121  VRSSATAEDLPDASFAGQQDTYLWVVGEDE-VLSH-IKMCWASLYTSRAIAYRKDHNIPE  178

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +D  M+V+VQ+M++  ++ V  TL+P++ D+  +  E + GLGE++ SGT  TP    + 
Sbjct  179  EDVHMSVVVQKMVNARVAGVTMTLNPSNGDRTKIAIEASYGLGESVVSGTV-TP---DNY  234

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVD---YSKKPLTVDP-VFRHQLGQRL  210
              D  +  L  ++  ++ I     PA+  VI + VD    ++  LT D  +F  ++ +R 
Sbjct  235  LMDKVIFELVESSIQDKKIALIPDPANKRVIEIEVDPIKATEACLTRDELIFISKIAKR-  293

Query  209  GTVGFFLERKFGCPQDVEGCL----VGKDIF-IVQSRPQ  108
                  +E+ +GCPQD+E  L     G++ F ++QSRP+
Sbjct  294  ------IEKHYGCPQDIEWALDADAEGEEAFTLLQSRPE  326



>ref|WP_038978016.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=872

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 108/222 (49%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G       ++V+VQ M+ P  S +L T  P + ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPINGNRKLLSIDASFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_028776059.1| phosphoenolpyruvate synthase [Shimazuella kribbensis]
Length=876

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKDEIL--RHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRIQNGFDHSQVYLSVIVQKMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   K  DK+        ++++ ++G      E   +  D  K + LT   + 
Sbjct  223  VSADCYKVKEDKIVDKMIA------TKKLAIYGRKEGGTETQEIDPDLQKTQTLTERQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLAHIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_021261137.1| phosphoenolpyruvate synthase [Paenibacillus alvei]
 gb|EPY05558.1| phosphoenolpyruvate synthase [Paenibacillus alvei TS-15]
Length=862

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 108/220 (49%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SRFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       +AV+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSHVYLAVIVQRMVFPQASGILFTADPITSNRKVISIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK   +A    ++++ V+G      E  ++  D  K       +  
Sbjct  223  VSADSYKVKEGEIVDK--RIA----AKKLAVYGRKEGGTETKQIDPDLQK----TQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            HQ+ Q L  +G  +E  FGCPQD+E C V    +IVQSRP
Sbjct  273  HQILQ-LARIGRQIEAYFGCPQDIEWCQVDDTFYIVQSRP  311



>ref|XP_010695868.1| PREDICTED: alpha-glucan water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=1468

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R  G+  +   MAVLVQE++S + +FV+HT +P+  D + + 
Sbjct  1270  SIKKVWASKWNERAYFSTRKVGLDHEHLCMAVLVQEIISADYAFVIHTTNPSSGDSSEIY  1329

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
              E+  GLGETL     G        K D D  + L + +     F +  I+         
Sbjct  1330  TEVVRGLGETLVGAYPGRALAFICKKSDLDSPKVLGYPSKPIGLFIKRSIIFRSDSNGED  1389

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1390  LEGYAGAGLYDSVPMDEEEKVVLDYSADPLINDSNFRQSVLSGIAKAGSAIEELYGSPQD  1449

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    IF+VQ+RPQ
Sbjct  1450  IEGVVKDGKIFVVQTRPQ  1467



>ref|WP_006521265.1| phosphoenolpyruvate synthase [Desulfotomaculum gibsoniae]
 gb|AGL00601.1| phosphoenolpyruvate synthase/pyruvate phosphate dikinase [Desulfotomaculum 
gibsoniae DSM 7213]
Length=881

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 104/209 (50%), Gaps = 12/209 (6%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL G S AG  ++  N+     I+    + + WASL+T RA+  R+  G   
Sbjct  115  VRSSATAEDLPGASFAGQQDTFLNIEGEKNIL--DSVRKCWASLFTDRAIAYRQKNGFRH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
                +AV+VQ M+ P +S ++ T  P   ++  V  + + GLGE L SG       +S+ 
Sbjct  173  DQVLLAVVVQRMVFPEVSGIMFTADPVTGNRKIVSIDASFGLGEALVSGV------VSAD  226

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVG  198
             +  +   L     +++ IV    P +G   ++ ++  ++     P    +   RL  +G
Sbjct  227  LYQVRADKLIKKQIAKKEIVIYARP-EGGTAKVELEGERQ---TAPALSEEQAVRLARMG  282

Query  197  FFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              +E  FG PQD+E CL    IF+VQSRP
Sbjct  283  RSIENHFGSPQDIEWCLADNKIFVVQSRP  311



>ref|XP_010695869.1| PREDICTED: alpha-glucan water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1466

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R  G+  +   MAVLVQE++S + +FV+HT +P+  D + + 
Sbjct  1268  SIKKVWASKWNERAYFSTRKVGLDHEHLCMAVLVQEIISADYAFVIHTTNPSSGDSSEIY  1327

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
              E+  GLGETL     G        K D D  + L + +     F +  I+         
Sbjct  1328  TEVVRGLGETLVGAYPGRALAFICKKSDLDSPKVLGYPSKPIGLFIKRSIIFRSDSNGED  1387

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1388  LEGYAGAGLYDSVPMDEEEKVVLDYSADPLINDSNFRQSVLSGIAKAGSAIEELYGSPQD  1447

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    IF+VQ+RPQ
Sbjct  1448  IEGVVKDGKIFVVQTRPQ  1465



>ref|WP_003745508.1| phosphoenolpyruvate synthase [Listeria seeligeri]
 gb|EFS01275.1| phosphoenolpyruvate synthase [Listeria seeligeri FSL N1-067]
Length=865

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 113/219 (52%), Gaps = 16/219 (7%)
 Frame = -2

Query  761  FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
            F       VRSSA  EDL   S AG +++  N+   + + F H I + WASL+T RA++ 
Sbjct  107  FDANEAFAVRSSATAEDLLTASFAGQHDTYLNIIGKSEL-FLH-IKKCWASLFTERAIIY  164

Query  581  RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TR  405
            R           ++V++Q+M+ P  S +L T  P   ++ S+  + + GLGE L SG   
Sbjct  165  RIQNNFDHSKVYLSVIIQKMVFPQASGILFTADPITANRKSISIDASFGLGEALVSGLVS  224

Query  404  GTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRL-TVDYSKKPLTVDPVFRH  228
               +++  +K  +K+        ++++ ++G      E  ++ ++  +++ LT + +   
Sbjct  225  ADAYKVQENKITEKIIA------TKKIAIYGLTDGGTETRQIDSIKQTEQTLTDEQIL--  276

Query  227  QLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                +L  +G  +E  FG PQD+E CLV  D +IVQSRP
Sbjct  277  ----KLAKLGRKIETHFGKPQDIEWCLVNNDFYIVQSRP  311



>ref|WP_044356822.1| phosphoenolpyruvate synthase, partial [Paenibacillus sp. E194]
 gb|KJB85670.1| phosphoenolpyruvate synthase, partial [Paenibacillus sp. E194]
Length=810

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 107/224 (48%), Gaps = 22/224 (10%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    ISR WASL+T RAV
Sbjct  105  SRFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--KHISRCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       +AV+VQ M+ P  S +L T  P   ++  V  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSHVYLAVIVQRMVFPQASGILFTADPITSNRKVVSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDK---VQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVD  243
                 +R+   +  DK   V+ LA         V+G      E  ++  +  K + LT  
Sbjct  223  VSADCYRVKEGEIADKRIAVKKLA---------VYGRKEGGTETQQIGPELQKTQTLTEQ  273

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             +       +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  274  QIL------QLARIGRQIEAYFGCPQDIEWCLVDDAFYIVQSRP  311



>ref|XP_010448564.1| PREDICTED: alpha-glucan water dikinase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010448565.1| PREDICTED: alpha-glucan water dikinase 2 isoform X2 [Camelina 
sativa]
Length=1278

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1081  IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1141  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>ref|WP_016820869.1| phosphoenolpyruvate synthase [Paenibacillus polymyxa]
Length=872

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 107/222 (48%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SQFGNEYAYAVRSSATAEDLPHASFAGQQDTYLNIIGKESIL--EHIRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G       ++V+VQ M+ P  S +L T  P + ++  +  +   GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPINGNRKLLSIDAGFGLGEALVSG-  221

Query  407  RGTPWRLSSSKFDDKVQTLAFANF---SEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  L S+ +  +VQ     N    +++M ++G      E  +L+ D  K     D  
Sbjct  222  ------LVSADY-YQVQDGVIVNKRVETKKMAIYGRKEGGTETKQLSPDQQKTQTLTD--  272

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               Q+ Q L  +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  273  --QQILQ-LARIGRQIEEHFGCPQDIEWCLADDTFYIVQSRP  311



>gb|KIZ20338.1| phosphoenolpyruvate synthase [Streptomyces sp. MNU77]
Length=870

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 107/220 (49%), Gaps = 18/220 (8%)
 Frame = -2

Query  761  FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
            F  Q    VRSSA  EDL   S AG  ++  NV    P      ISR WAS++T RAV+ 
Sbjct  108  FGEQGAYAVRSSATAEDLPTASFAGQQDTYLNVL--GPTAVLQHISRCWASMFTERAVVY  165

Query  581  RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRG  402
            R+  G+  +   MAV+VQ M+ P+ S +L T  P   ++     +   GLGE L SG   
Sbjct  166  RQRNGIDHRTVDMAVVVQRMVFPDASGILFTADPVTGNRKVATVDAGFGLGEALVSGL--  223

Query  401  TPWRLSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                ++   F   D +V T   A  ++E  VH   PA G    + VD  ++     P   
Sbjct  224  ----VNPDVFTVRDGEVVTRNIA--AKERAVHAL-PAGG-TREVAVDVRQRE---RPALT  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             +   RL  +G  +E  FGCPQD+E CLV     IVQSRP
Sbjct  273  DEQAVRLVGLGRRIEAHFGCPQDIEWCLVDDGFRIVQSRP  312



>ref|WP_000336998.1| phosphoenolpyruvate synthase [Bacillus cereus]
 gb|EJR97807.1| hypothetical protein IKG_02900 [Bacillus cereus VD200]
Length=868

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+   N I+    + + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGENAIL--QHVKKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  MYRMQNGFEHNQVSICVVVQKMVFPQASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK+        ++++ ++G      E  ++     K    +  +  
Sbjct  223  VSADNYKVKEGEIVDKMIA------TKKLAIYGLQEGGTETKQIDPTQQK----IQTLSE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L ++G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  QQILQ-LASIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_021255564.1| phosphoenolpyruvate synthase [Paenibacillus alvei]
 gb|EPY11498.1| phosphoenolpyruvate synthase [Paenibacillus alvei A6-6i-x]
Length=862

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 107/224 (48%), Gaps = 22/224 (10%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    ISR WASL+T RAV
Sbjct  105  SQFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--KHISRCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       +AV+VQ M+ P  S +L T  P   ++  V  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSHVYLAVIVQRMVFPQASGILFTADPITSNRKVVSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDK---VQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVD  243
                 +R+   +  DK   V+ LA         V+G      E  ++  +  K + LT  
Sbjct  223  VSADCYRVKEGEIADKRIAVKKLA---------VYGRKEGGTETQQIGPELQKTQTLTEQ  273

Query  242  PVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             +       +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  274  QIL------QLARIGRQIEAYFGCPQDIEWCLVDDIFYIVQSRP  311



>ref|XP_008380715.1| PREDICTED: alpha-glucan water dikinase 2-like [Malus domestica]
Length=221

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 98/199 (49%), Gaps = 23/199 (12%)
 Frame = -2

Query  635  HCISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSV  456
              I +VWAS +  RA LS R A +  ++  MAVL+QE++  + +FV+HT +P   D + +
Sbjct  22   QAIKKVWASKWNERAFLSCRKANLDHENICMAVLIQEIICADYAFVIHTKNPLSGDTSEI  81

Query  455  EAEIASGLGETLASGT--RGTPWRLSSSKFDDKVQT----LAFANFSEEMIVH-------  315
              EI  GLGETL      R   +    S  +  V T         +S++ I+        
Sbjct  82   YTEIVKGLGETLVGAYPGRALSFITKKSNLNSPVVTGYPSKPIGLYSKQSIIFRSDSNAE  141

Query  314  ------GTGPADGEVI----RLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQ  165
                  G G  D  ++    ++ +DYS+  L +D  F+  +  R+   G  +E  +G PQ
Sbjct  142  DLEGYAGAGLYDSVIMDKEEKIVLDYSRDRLIIDRPFQVSVLSRIAEAGKIVEGIYGHPQ  201

Query  164  DVEGCLVGKDIFIVQSRPQ  108
            D+EG +    I++VQSRPQ
Sbjct  202  DIEGVVKDGVIYVVQSRPQ  220



>ref|XP_010439039.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X2 [Camelina 
sativa]
Length=1278

 Score =   103 bits (256),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D   +  
Sbjct  1081  IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSTEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1141  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>ref|WP_026591119.1| phosphoenolpyruvate synthase [Bacillus sp. UNC437CL72CviS29]
Length=870

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+    PI+    IS+ WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEPIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYISVIIQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   K  DK+        ++++ ++       E  ++  +  K + LT   + 
Sbjct  223  VSADCYKVQEEKIIDKMIA------TKKLAIYALKEGGTETQQIEPNQQKSQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV   ++IVQSRP
Sbjct  277  ------QLARIGSQIEAYFGCPQDIEWCLVDDILYIVQSRP  311



>ref|XP_010439038.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X1 [Camelina 
sativa]
Length=1314

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D   +  
Sbjct  1117  IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSTEIYT  1176

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1177  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  1236

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  1237  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1296

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1297  EGVVKGGHIYIVQARPQ  1313



>ref|XP_010433767.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X1 [Camelina 
sativa]
Length=1278

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D   +  
Sbjct  1081  IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSTEIYT  1140

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1141  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  1200

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  1201  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1260

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1261  EGVVKGGHIYIVQARPQ  1277



>ref|WP_006920798.1| Phosphoenolpyruvate synthase [Bacillus sp. GeD10]
 emb|CCW05416.1| Phosphoenolpyruvate synthase [Bacillus sp. GeD10]
Length=868

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASLYT RAV
Sbjct  105  SHFGDKHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKENIL--QHIKKCWASLYTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVVQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  +KV        ++++ ++G      E  ++  +  K    +  +  
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQK----IQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|XP_002869718.1| ATGWD2/GWD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45977.1| ATGWD2/GWD3 [Arabidopsis lyrata subsp. lyrata]
Length=1291

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 100/197 (51%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +   +  MAVL+QE++  + +FV+HT +P   D + +  
Sbjct  1094  IKKVWASKWNERAYVSCKKTKLDHDEVCMAVLIQEVICGDYAFVIHTNNPVSGDSSEIYT  1153

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKV-QTLAFAN-----FSEEMIVH---------  315
             EI  GLGETL     G      + K + K    +++ +     +S+  I+          
Sbjct  1154  EIVKGLGETLVGAYPGRAMSFITKKTNLKSPMVISYPSKRIGLYSKPSIIFRSDSNNEDL  1213

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL +D  ++ +L   +   G  +E  +GCPQD+
Sbjct  1214  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIMDKSYQVRLFSAIAEAGNVIETLYGCPQDI  1273

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1274  EGVVKGGHIYIVQARPQ  1290



>ref|XP_010433768.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X2 [Camelina 
sativa]
Length=1269

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   +      MAVL+QE++  + +FV+HT +P   D   +  
Sbjct  1072  IKKVWASKWNERAYVSCKKTRLDHDAVCMAVLIQEVICGDYAFVIHTNNPVSGDSTEIYT  1131

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             E+  GLGETL     G      + K + K  T+        A +S+  I+          
Sbjct  1132  EVVKGLGETLVGAYPGRAMSFITKKTNLKSPTVISYPSKRIALYSKPSIIFRSDSNNEDL  1191

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++PL VD  F+ +L   +   G  +E  +G PQD+
Sbjct  1192  EGNAGAGLYDSVIMDEAEEVVVDYSREPLIVDKAFQMRLFSTIAEAGNVIETLYGSPQDI  1251

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I+IVQ+RPQ
Sbjct  1252  EGVVKGGHIYIVQARPQ  1268



>emb|CDY61008.1| BnaA01g35130D [Brassica napus]
Length=1488

 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 97/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   V      MAVLVQE++  + +FV+HT +P   D + +  
Sbjct  1291  IKKVWASKWNERAYVSCKKTRVDHDAVCMAVLVQEVICGDYAFVIHTNNPVTGDPSEIYT  1350

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL  G  G      + K + K  T+          +S+  ++          
Sbjct  1351  EIVKGLGETLVGGYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSVIFRSDSNNEDL  1410

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++ L VD  F+ +L   +   G  +E  +GCPQD+
Sbjct  1411  EGYAGAGLYDSVIMDEAEEVMVDYSREQLIVDKAFQVRLFSAIAEAGNVIETLYGCPQDI  1470

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I++VQ+RPQ
Sbjct  1471  EGVVKGGIIYVVQARPQ  1487



>gb|KHN19640.1| Alpha-glucan water dikinase, chloroplastic [Glycine soja]
Length=221

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 94/198 (47%), Gaps = 23/198 (12%)
 Frame = -2

Query  632  CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
             I +VW S +  RA  S R   +  +  +MAVLVQE+++ + +FV+HT +P   D + + 
Sbjct  23   AIKKVWGSKWNERAYFSTRKVKLDHEYLSMAVLVQEVINADYAFVIHTTNPASGDSSEIY  82

Query  452  AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
            AE+  GLGETL     G        K D +  Q L + +     F  + I+         
Sbjct  83   AEVVKGLGETLVGAYPGRALSFICKKRDLNSPQVLGYPSKPVGLFIRQSIIFRSDSNGED  142

Query  314  -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                 G G  D     E  ++ +DYS   L +D  FR  +   +   G  +E  +G PQD
Sbjct  143  LEGYAGAGLYDSVPMDEAEKVVLDYSSDKLILDGSFRQSILSSIARAGNEIEELYGTPQD  202

Query  161  VEGCLVGKDIFIVQSRPQ  108
            +EG +    +++VQ+RPQ
Sbjct  203  IEGVIKDGKVYVVQTRPQ  220



>ref|WP_020665142.1| phosphoenolpyruvate synthase [Amycolatopsis benzoatilytica]
Length=852

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/218 (34%), Positives = 105/218 (48%), Gaps = 18/218 (8%)
 Frame = -2

Query  755  GQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRR  576
            G+T   VRSSA  EDL   S AG  ++  N+    P      +SR WASL+T RAV  R+
Sbjct  100  GETAYAVRSSATAEDLPTASFAGQQDTYLNIR--TPAAVLRHVSRCWASLFTERAVTYRQ  157

Query  575  AAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTP  396
              G+  +  +MAV+VQ+M+ P  S +L T  P   D+     + + GLGE L SG     
Sbjct  158  RNGIDHRTVSMAVVVQQMVFPRTSGILFTADPVTGDRTVATVDASFGLGEALVSGL----  213

Query  395  WRLSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQ  225
              ++   F   D  V     A     ++    G  +  V+    D +++ L   P     
Sbjct  214  --VNPDVFKVRDGTVIAKTIAAKERAILAKPEGGTEETVL----DAARQSL---PALTDA  264

Query  224  LGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               RL  +G  +E +FGCPQD+E CL   +  IVQSRP
Sbjct  265  QVIRLVELGRRIEAEFGCPQDIEWCLADDEFQIVQSRP  302



>ref|WP_000094226.1| MULTISPECIES: phosphoenolpyruvate synthase [Bacillus cereus group]
 gb|EEM47329.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus thuringiensis 
serovar pakistani str. T13001]
 gb|EJR76089.1| hypothetical protein IK5_01052 [Bacillus cereus VD154]
 gb|KIU75567.1| phosphoenolpyruvate synthase [Bacillus thuringiensis Sbt003]
Length=868

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+   N I+    + + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGENAIL--QHVKKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  MYRMQNGFEHNQVSICVVVQKMVFPQASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK+        ++++ ++G      E  ++     K    +  +  
Sbjct  223  VSADNYKVKEGEIVDKMIA------TKKLAIYGLQEGGTETKQIDPAQQK----IQTLSE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L ++G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  QQILQ-LASIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_019419540.1| phosphoenolpyruvate synthase [Paenibacillus sp. OSY-SE]
Length=862

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGEEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTNRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       +AV+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSHVYLAVIVQRMVFPQASGILFTADPITSNRKVISIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  DK   +A    ++++ V+G      E  ++  +  K + LT   + 
Sbjct  223  VSADCYKVKEGEIVDK--RIA----AKKLAVYGRKEGGTETQQIDPEQQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLARIGRHIEANFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|XP_006357619.1| PREDICTED: starch-granule-bound R1 protein isoform X1 [Solanum 
tuberosum]
Length=1464

 Score =   102 bits (255),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1266  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIY  1325

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D +  Q L + +     F +  I+         
Sbjct  1326  AEVVRGLGETLVGAYPGRALSFICKKKDLNSTQVLGYPSKPIGLFIKRSIIFRSDSNGED  1385

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1386  LEGYAGAGLYDSVPMDEEEKVVIDYSSDPLITDGNFRQTILSSIARAGHAIEELYGSPQD  1445

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    I++VQ+RPQ
Sbjct  1446  IEGVVRDGKIYVVQTRPQ  1463



>ref|XP_011398657.1| Alpha-glucan water dikinase 2 [Auxenochlorella protothecoides]
 gb|KFM25761.1| Alpha-glucan water dikinase 2 [Auxenochlorella protothecoides]
Length=1252

 Score =   102 bits (255),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 96/185 (52%), Gaps = 10/185 (5%)
 Frame = -2

Query  635   HCISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSV  456
               I  VWAS +T RA LSRRA  +P  D +MAVL+Q ++  + +FVLH+  P    + SV
Sbjct  1065  QAICTVWASKWTDRAWLSRRAQAIPDADLSMAVLLQPIVPADYAFVLHSADPLTGQRGSV  1124

Query  455   EAEIASGLGETLASGTRGTPWRLSSSKFDDKVQTLAFA----NFSEEMIVHGTGPAD---  297
               E+  G+GE L +     P +     + D  Q L  A    N  +     G G  +   
Sbjct  1125  HGEVVLGMGEALDAALLALPSK-RLGLYPDPSQALLIARSDSNGEDLEAYAGAGLYESVP  1183

Query  296   -GEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKF-GCPQDVEGCLVGKDIFIV  123
                ++  T+DY+ +PL  D  FR  L  RL ++   +E  F G PQD+EG L G  +++V
Sbjct  1184  LAPLLPRTLDYAAEPLVWDAAFRADLLHRLTSLAAGVEAAFGGVPQDIEGVLSGDRLYVV  1243

Query  122   QSRPQ  108
             Q+RPQ
Sbjct  1244  QARPQ  1248



>gb|EEM21989.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus thuringiensis 
serovar tochigiensis BGSC 4Y1]
Length=351

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 106/220 (48%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    + + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKEAIL--QHVRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S ++ T  P    +  +  + + GLGE L SG 
Sbjct  163  MYRMQNGFEHNQVSICVVVQKMVFPEASGIMFTADPITASRKILSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   K  DKV +      ++++ ++       E  ++     K    +  +  
Sbjct  223  VSADNYKVKEGKIVDKVIS------TKKVAIYALKEGGTETKQINSAQQK----IQTLSE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  QQILQ-LAQIGRQIEAYFGCPQDIEWCLVDNTFYIVQSRP  311



>ref|XP_008389704.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic-like 
[Malus domestica]
Length=1408

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 94/194 (48%), Gaps = 23/194 (12%)
 Frame = -2

Query  620   VWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIA  441
             VWAS +  RA  S R   +  +   MAVLVQE+++ + +FV+HT +P+  D + + AE+ 
Sbjct  1214  VWASKWNERAYFSTRKVKLDHEYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEVV  1273

Query  440   SGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH------------  315
              GLGETL     G      S K D D  Q L + +     F    I+             
Sbjct  1274  KGLGETLVGAYPGRALSFISKKNDLDSPQVLGYPSKPIGLFIRRSIIFRSDSNGEDLEGY  1333

Query  314   -GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGC  150
              G G  D     E  ++ VDYS  PL VD  FR  +   +   G  +E  +G PQD+EG 
Sbjct  1334  AGAGLYDSVPMDEEEKVLVDYSSDPLMVDGNFRKTILSSIARAGSAIEELYGSPQDIEGV  1393

Query  149   LVGKDIFIVQSRPQ  108
             +    +++VQ+RPQ
Sbjct  1394  IRDGKLYVVQTRPQ  1407



>ref|WP_017437798.1| hypothetical protein [Geobacillus caldoxylosilyticus]
Length=880

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 105/213 (49%), Gaps = 20/213 (9%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+     ++    I + WASL+T RA+  R   G   
Sbjct  114  VRSSATAEDLPTASFAGQQDTYLNIKGQEELL--QHIRKCWASLFTDRAISYRAKNGFDH  171

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +   ++V+VQ M++P ++ ++ T  P   ++  V  + + GLGE + SG       +S+ 
Sbjct  172  RQVYLSVVVQRMVNPEIAGIMFTADPVSGNRKVVSIDASFGLGEAIVSGM------VSAD  225

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQ----RL  210
             +  K   +   N SE+ I   + P  G V        KK L  D   +  L      RL
Sbjct  226  LYKVKAGKIIHKNVSEKKIAIYSLPEGGTV--------KKDLPPDQQTKQALTDIQILRL  277

Query  209  GTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              +G  +E+ FG PQD+E C+   +IFIVQSRP
Sbjct  278  AELGKRIEKHFGSPQDIEFCMENGEIFIVQSRP  310



>ref|WP_031415026.1| phosphoenolpyruvate synthase [Brevibacillus laterosporus]
Length=868

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 109/223 (49%), Gaps = 20/223 (9%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  102  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTDRAV  159

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G       ++V+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  160  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  219

Query  407  RGTPWRLSSSKFDDKVQTLAFAN---FSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDP  240
                  +S+  +  KVQ     N    +++M ++G      E  ++  D  K + LT   
Sbjct  220  ------VSADCY--KVQEGEIVNKRIATKKMAIYGLKEGGTETKQIDPDQQKTQTLTEQQ  271

Query  239  VFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +       +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  272  IL------QLARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  308



>ref|WP_016427973.1| hypothetical protein [Paenisporosarcina sp. HGH0030]
 gb|EPD52111.1| hypothetical protein HMPREF1210_01464 [Paenisporosarcina sp. 
HGH0030]
Length=871

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG +++  N++    I+    I + WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPYASFAGQHDTYLNITGKEGIL--RHIRKCWASLFTDRAVVYRMQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  NQVYLSVVVQQMVFPQASGILFTADPVTSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDQQKTQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  281  TGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_018783970.1| phosphoenolpyruvate synthase [Micromonospora sp. CNB394]
Length=863

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  NV+ +  ++    +SR WASL+T RAV  RR  G+  
Sbjct  115  VRSSATAEDLPAASFAGQQDTYLNVAGTAEVL--RHVSRCWASLFTDRAVTYRRRHGIDD  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +   MAV+VQ M+ P+ + ++ T  P   D+  V  E   GLGE L SG       ++  
Sbjct  173  RAVDMAVVVQRMVVPDAAGIMFTADPVTGDRTVVSVEAGLGLGEALVSGL------VNPD  226

Query  377  KFDDKVQTLAFANF-SEEMIVHGTGPADGEVIRLT-VDYSKKPLTVDPVFRHQLGQRLGT  204
             F  +   +      ++ + VH   P  G   R T VD +++   V P        R+  
Sbjct  227  VFTVRDGVVVGRTIGAKSVAVH---PVPGGGTRETSVDPARR---VQPALTDAQAVRIAA  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E   GCPQD+E  + G D+ I+QSRP
Sbjct  281  LGRRIEAHLGCPQDIEWAVTGDDVHILQSRP  311



>ref|WP_018782277.1| phosphoenolpyruvate synthase [Bacillus sp. 95MFCvi2.1]
Length=871

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RA++ R   G   
Sbjct  115  VRSSATAEDLPFASFAGQQDTYLNIIGKDEIL--RYISKCWASLFTDRAIIYRIQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQKTQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  281  IGREIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>gb|AET60043.1| phosphoenolpyruvate synthase [Paenibacillus terrae HPL-003]
Length=848

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 110/221 (50%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RAV
Sbjct  82   SQFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGVDAIL--QHISKCWASLFTERAV  139

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  140  IYRMQTGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  199

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  DK   +A    ++++ ++G      E  +L  D  K + LT   + 
Sbjct  200  VSADCYQVQEGEIVDK--RIA----TKKLAIYGRKEGGTETRQLDPDQQKTQTLTEQQIL  253

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  254  ------QLARIGRQIEAYFGCPQDIEWCLVDDTFYIVQSRP  288



>ref|WP_040118943.1| MULTISPECIES: phosphoenolpyruvate synthase [Bacillus cereus group]
 gb|AIK38043.1| PEP-utilizing enzyme, mobile domain protein [Bacillus mycoides]
 gb|AJI15300.1| PEP-utilizing enzyme, mobile domain protein [Bacillus cereus]
Length=871

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RA++ R   G   
Sbjct  115  VRSSATAEDLPFASFAGQQDTYLNIIGKDEIL--RYISKCWASLFTDRAIIYRIQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQKTQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  281  IGREIEAYFGCPQDIEWCLVDDTFYIVQSRP  311



>emb|CDY56576.1| BnaC01g41540D [Brassica napus]
Length=1456

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 96/197 (49%), Gaps = 23/197 (12%)
 Frame = -2

Query  629   ISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEA  450
             I +VWAS +  RA +S +   V      MAVLVQE++  + +FV+HT +P   D   +  
Sbjct  1259  IKKVWASKWNERAYISCKKTRVDHDAVCMAVLVQEVICGDYAFVIHTNNPVTGDPLEIYT  1318

Query  449   EIASGLGETLASGTRGTPWRLSSSKFDDKVQTLA------FANFSEEMIVH---------  315
             EI  GLGETL  G  G      + K + K  T+          +S+  ++          
Sbjct  1319  EIVKGLGETLVGGYPGRAMSFITKKTNLKSPTVISYPSKRIGLYSKPSVIFRSDSNNEDL  1378

Query  314   ----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQDV  159
                 G G  D     E   + VDYS++ L VD  F+ +L   +   G  +E  +GCPQD+
Sbjct  1379  EGYAGAGLYDSVIMDEAEEVVVDYSREQLIVDKAFQVRLFSAIAEAGNVIETLYGCPQDI  1438

Query  158   EGCLVGKDIFIVQSRPQ  108
             EG + G  I++VQ+RPQ
Sbjct  1439  EGVVKGGIIYVVQARPQ  1455



>ref|WP_000094208.1| phosphoenolpyruvate synthase [Bacillus cereus]
 gb|EEK61746.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus cereus 
172560W]
Length=868

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGEEAIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  +KV        ++++ ++G      E  ++  +  K    V  +  
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNKQK----VQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|WP_040333309.1| hypothetical protein [Candidatus Magnetobacterium casensis]
Length=1054

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 105/222 (47%), Gaps = 37/222 (17%)
 Frame = -2

Query  665   VSPSNPIVFG-HCISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHT  489
             +SP +    G  CI +V+AS +  RA LSRR  G+P +  +MAVL+Q ++    +FV+HT
Sbjct  836   ISPPDDWTEGWRCIKQVYASAWNERAYLSRRNMGIPHEALSMAVLIQGVIEAEYAFVIHT  895

Query  488   LSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSSKFDDKVQTLAF------------  345
             L+P ++ ++ + AE+  GLGETL     G     + +K D  +  + +            
Sbjct  896   LNPLNNSRDELYAEVVLGLGETLVGNFPGRALSFTCNKADKTLSPIFYPSKGVGLYGARS  955

Query  344   --------------ANFSEEMIVHGTG-------PADGEVIRLTVDYSKKPLTVDPVFRH  228
                            N  + M   G G       PA  EV+   +DY+ +PL  D  F+ 
Sbjct  956   VLERKRSGLIFRSDTNAEDLMGYAGAGLYDSILLPASREVV---LDYADEPLLWDKQFQE  1012

Query  227   QLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRPQPL  102
              L + +  +G  +E   G PQD+EG       ++VQSR Q L
Sbjct  1013  GLMRAIAEIGISIEDITGSPQDIEGAYCKGTYYVVQSRAQML  1054



>ref|WP_018956345.1| phosphoenolpyruvate synthase [Streptomyces sp. CNB091]
Length=883

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/222 (35%), Positives = 106/222 (48%), Gaps = 18/222 (8%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            + F GQ    VRSSA  EDL   S AG  ++  NV    PI   H ISR WAS++T RAV
Sbjct  106  ARFGGQAAYAVRSSATAEDLPTASFAGQQDTYLNVL--GPIAVLHHISRCWASMFTERAV  163

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R+  G+  +   MAV+VQ M+ P+ S +L T  P   ++ +   +   GLGE L  G 
Sbjct  164  VYRQQNGIDHRTVHMAVVVQRMVFPHASGILFTADPVTGNRKAATVDAGFGLGEALVCGL  223

Query  407  RGTPWRLSSSKF---DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPV  237
                  ++   F   D +V T   A  ++E  +H      G   +  VD  ++     P 
Sbjct  224  ------VNPDVFTVRDGEVVTRTIA--AKERAIHAL--PTGGTRKAPVDARQRER---PA  270

Query  236  FRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
               +   RL   G  +E  FG PQD+E CLV      VQSRP
Sbjct  271  LTDEQAVRLVGFGRSIEAHFGRPQDIEWCLVDDGFRFVQSRP  312



>gb|AAK11735.1| starch associated protein R1 [Solanum tuberosum]
Length=1464

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1266  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIY  1325

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D +  Q L + +     F +  I+         
Sbjct  1326  AEVVRGLGETLVGAYPGRALSFICKKKDLNSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  1385

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1386  LEGYAGAGLYDSVPMDEEEKVVIDYSSDPLITDGNFRQTILSNIARAGHAIEELYGSPQD  1445

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    I++VQ+RPQ
Sbjct  1446  IEGVVRDGKIYVVQTRPQ  1463



>ref|WP_038592318.1| phosphoenolpyruvate synthase [Paenibacillus sp. FSL H7-0357]
 gb|AIQ18503.1| phosphoenolpyruvate synthase [Paenibacillus sp. FSL H7-0357]
Length=871

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 107/211 (51%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  NV     I+    IS+ WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPHASFAGQQDTYLNVIGKKAIL--QHISKCWASLFTERAVIYRMQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTP-WRLSS  381
                ++V+VQ+M+ P  S +L T  P  +++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIVQKMVFPQASGILFTADPISNNRKLLSIDASFGLGEALVSGLVSPDCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             +  DK+ +      ++++ ++G      E  +L  D  K + LT   +       +L  
Sbjct  233  EEIVDKIIS------TKQLAIYGLPEGGTETRQLDPDQQKAQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  281  IGRQIEAYFGCPQDIEWCLDHDTFYIVQSRP  311



>gb|AFH88388.1| alpha-glucan water dikinase [Solanum tuberosum]
Length=1464

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1266  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIY  1325

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D +  Q L + +     F +  I+         
Sbjct  1326  AEVVRGLGETLVGAYPGRALSFICKKKDLNSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  1385

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1386  LEGYAGAGLYDSVPMDEEEKVVIDYSSDPLITDGNFRQTILSNIARAGHAIEELYGSPQD  1445

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    I++VQ+RPQ
Sbjct  1446  IEGVVRDGKIYVVQTRPQ  1463



>ref|WP_033102044.1| phosphoenolpyruvate synthase [Thermoactinomyces daqus]
Length=871

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 102/212 (48%), Gaps = 18/212 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  E+  N+     I+    IS+ WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPHASFAGQQETYLNIIGKEAIL--RHISKCWASLFTDRAVIYRMLNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V+VQ M+ P  S +L T  P   ++     E   GLGE L +G      +++  
Sbjct  173  SQVHLSVIVQRMVFPQASGILFTADPVTTNRKLQLIEAGFGLGEALVAGLASADCYKVQE  232

Query  380  SKF-DDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKP-LTVDPVFRHQLGQRLG  207
             K  + ++ T  +A       ++G      E  ++  D  K P LT   +F      RL 
Sbjct  233  DKIVEKRIATKKWA-------IYGLKEGGTETRQIDPDQQKIPALTDQQIF------RLA  279

Query  206  TVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             +G  +E  FGCPQD+E CL     +IVQSRP
Sbjct  280  RIGRQIEAYFGCPQDIEWCLADDTFYIVQSRP  311



>ref|WP_000094184.1| phosphoenolpyruvate synthase [Bacillus cereus]
 gb|ACK61736.1| pyruvate, water dikinase [Bacillus cereus B4264]
 gb|KIZ27547.1| phosphoenolpyruvate synthase [Bacillus cereus]
Length=868

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 110/221 (50%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV     I+    I + WASL+T RAV
Sbjct  105  SHFGDEHAYAVRSSATAEDLPYASFAGQQDTYLNVIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
            + R   G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  407  RGTP-WRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
              T  +++   +  +KV        ++++ ++G      E  ++  +  K + LT   + 
Sbjct  223  VSTDNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQKFQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|WP_035434231.1| phosphoenolpyruvate synthase [Bacillus sp. UNC322MFChir4.1]
Length=870

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 108/220 (49%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--RHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V++Q M+ P  S +L T  P   ++  +  + + GLGETL SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIIQRMVFPQASGILFTADPITSNRKLLSIDASFGLGETLVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   K  DK+        ++++ ++       E  ++  ++ K     D    
Sbjct  223  VSADCYKVQEEKIIDKMIA------TKKLAIYALKEGGTETQQIEPNHQKSQTLTD----  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  F CPQD+E CLV +  +IVQSRP
Sbjct  273  QQILQ-LARIGKQVEAYFACPQDIEWCLVDETFYIVQSRP  311



>ref|WP_000094218.1| phosphoenolpyruvate synthase [Bacillus cereus]
 gb|EJQ30126.1| hypothetical protein IE9_02784 [Bacillus cereus BAG4X12-1]
 gb|EOP84269.1| pyruvate, water dikinase [Bacillus cereus BAG5X12-1]
Length=868

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 109/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  +KV        ++++ ++G      E  ++  +  K    V  +  
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNKQK----VQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>sp|Q9AWA5.2|GWD1_SOLTU RecName: Full=Alpha-glucan water dikinase, chloroplastic; AltName: 
Full=Starch-related R1 protein; Flags: Precursor [Solanum 
tuberosum]
 emb|CAA70725.1| R1 [Solanum tuberosum]
Length=1464

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 94/198 (47%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1266  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIY  1325

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D +  Q L + +     F +  I+         
Sbjct  1326  AEVVRGLGETLVGAYPGRALSFICKKKDLNSPQVLGYPSKPIGLFIKRSIIFRSDSNGED  1385

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DYS  PL  D  FR  +   +   G  +E  +G PQD
Sbjct  1386  LEGYAGAGLYDSVPMDEEEKVVIDYSSDPLITDGNFRQTILSNIARAGHAIEELYGSPQD  1445

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +    I++VQ+RPQ
Sbjct  1446  IEGVVRDGKIYVVQTRPQ  1463



>ref|WP_027095943.1| hypothetical protein [[Clostridium] viride]
Length=874

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/219 (32%), Positives = 104/219 (47%), Gaps = 11/219 (5%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S FP  T   VRSSA  EDL G S AG  ++  NV   + +   H +   WASLYT RA+
Sbjct  91   SKFPKNTFFGVRSSATAEDLEGASFAGQQDTYLNVRAQDVL---HAVRNCWASLYTDRAI  147

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
              R    +P +   M+V+VQ+M+  +LS +L T  P    +N +  +   GLGE L SG 
Sbjct  148  QYRNKNHIPHQSVHMSVVVQKMVHSDLSGILFTADPLTESRNVISIDAGYGLGEALVSGL  207

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRH  228
                      K+  + + +   + SE+ +     P  G     TVD   +      +   
Sbjct  208  VSP----DIYKYGKRERAILSKDISEKKLAILPLPEGGTK---TVDLPPEQAKSQALSDQ  260

Query  227  QLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            Q+ + L  +G  +E  +  PQD+E C     +++VQSRP
Sbjct  261  QITE-LAQIGLKIEEYYKKPQDIEWCFEDGILYVVQSRP  298



>ref|WP_016512624.1| pyruvate, water dikinase [Bacillus cereus]
 gb|EPF12444.1| pyruvate, water dikinase [Bacillus cereus BAG1O-3]
Length=868

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 107/220 (49%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    I + WASL+T RAV
Sbjct  105  SHFGNEYAYAVRSSATAEDLPYASFAGQQDTYLNIIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVVQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +R+   +   KV        ++++ ++G      E  ++  +  K    V  +  
Sbjct  223  VSADNYRVKEDEIVKKVIA------TKKLAIYGRKEGGTETKKIAPNQQK----VQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  QQILQ-LARIGRQIEVYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_000094180.1| phosphoenolpyruvate synthase [Bacillus cereus]
 gb|EJR36507.1| hypothetical protein IIE_01893 [Bacillus cereus VD045]
Length=868

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 110/221 (50%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV     I+    I + WASL+T RAV
Sbjct  105  SHFGDEHAYAVRSSATAEDLPYASFAGQQDTYLNVIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R  +G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQSGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  +KV        ++++ ++G      E  ++  +  K + LT   + 
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQKFQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|WP_040902026.1| phosphoenolpyruvate synthase [Streptomyces auratus]
Length=865

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 107/221 (48%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S    Q    VRSSA  EDL   S AG  ++  NV     I+    +SR WASL+T RAV
Sbjct  106  SQLGEQAAYAVRSSATAEDLPTASFAGQQDTYLNVVGRTAIL--QHVSRCWASLFTERAV  163

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
              R+  G+  +   MAVLVQ+M+ P+++ +L T  P   ++     +   GLGETL SG 
Sbjct  164  TYRQRNGIDHRTVHMAVLVQQMVFPDVAGILFTADPVTGNRKVATVDAGFGLGETLVSGL  223

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDP--VF  234
                      K  D  + +A A  +++  VH       + + +     ++P   D   V 
Sbjct  224  VNP----DVFKVRDG-EVVAKAIAAKQRAVHALPAGGTQEVAIDRQRQERPALTDAQVVR  278

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              QLG+R       +E  FG PQD+E CLV  D  IVQSRP
Sbjct  279  LVQLGRR-------IEAHFGRPQDIEWCLVDDDFQIVQSRP  312



>gb|EJJ02620.1| phosphoenolpyruvate synthase [Streptomyces auratus AGR0001]
Length=864

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/221 (35%), Positives = 107/221 (48%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S    Q    VRSSA  EDL   S AG  ++  NV     I+    +SR WASL+T RAV
Sbjct  105  SQLGEQAAYAVRSSATAEDLPTASFAGQQDTYLNVVGRTAIL--QHVSRCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGT  408
              R+  G+  +   MAVLVQ+M+ P+++ +L T  P   ++     +   GLGETL SG 
Sbjct  163  TYRQRNGIDHRTVHMAVLVQQMVFPDVAGILFTADPVTGNRKVATVDAGFGLGETLVSGL  222

Query  407  RGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDP--VF  234
                      K  D  + +A A  +++  VH       + + +     ++P   D   V 
Sbjct  223  VNP----DVFKVRDG-EVVAKAIAAKQRAVHALPAGGTQEVAIDRQRQERPALTDAQVVR  277

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              QLG+R       +E  FG PQD+E CLV  D  IVQSRP
Sbjct  278  LVQLGRR-------IEAHFGRPQDIEWCLVDDDFQIVQSRP  311



>ref|WP_037768841.1| phosphoenolpyruvate synthase [Streptomyces olindensis]
 gb|KDN73471.1| phosphoenolpyruvate synthase [Streptomyces olindensis]
Length=865

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 104/209 (50%), Gaps = 12/209 (6%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  NV    P V  H ISR WASL+T RAV  RR  G+  
Sbjct  116  VRSSATAEDLPTASFAGQQDTYLNVM-GTPSVLRH-ISRCWASLFTERAVTYRRRNGIDH  173

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +   MAV+VQ M+ P  + +L T  P   ++ +   +   GLGE L SG    P   +  
Sbjct  174  RTVHMAVVVQRMVFPRAAGILFTADPVTGNRKTATVDAGFGLGEALVSGL-VNPDVFTVR  232

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVG  198
              +   +T+A    +++  VH   P  G    +T+D  ++     P        RL  +G
Sbjct  233  DGEVVARTIA----AKQRAVHAL-PGGG-TQEVTIDAERQE---QPALTDAQAVRLVRLG  283

Query  197  FFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              +E  FG PQD+E CLV  D  IVQSRP
Sbjct  284  RRIEAHFGRPQDIEWCLVDDDFRIVQSRP  312



>ref|WP_017151799.1| phosphoenolpyruvate synthase [Bacillus sp. FJAT-13831]
Length=871

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 107/221 (48%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGDEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIM--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSQVYLSVIVQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  DK+        ++++ ++G      E  ++  D  K + LT   + 
Sbjct  223  VSADCYKVQEEEIVDKMIA------TKKLAIYGLKEGGTETQQIDPDQQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L   G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  277  ------QLARTGRQIETYFGCPQDIEWCLVDDTFYIVQSRP  311



>ref|WP_031116207.1| phosphoenolpyruvate synthase [Streptomyces sp. NRRL WC-3641]
Length=865

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 104/209 (50%), Gaps = 12/209 (6%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  NV    P V  H ISR WASL+T RAV  RR  G+  
Sbjct  116  VRSSATAEDLPTASFAGQQDTYLNVM-GTPSVLRH-ISRCWASLFTERAVTYRRRNGIDH  173

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +   MAV+VQ M+ P  + +L T  P   ++ +   +   GLGE L SG    P   +  
Sbjct  174  RTVHMAVVVQRMVFPRAAGILFTADPVTGNRKTATVDAGFGLGEALVSGL-VNPDVFTVR  232

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVG  198
              +   +T+A    +++  VH   P  G    +T+D  ++     P        RL  +G
Sbjct  233  DGEVVARTIA----AKQRAVHAL-PGGG-TQEVTIDAERQE---QPALTDAQAVRLVRLG  283

Query  197  FFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              +E  FG PQD+E CLV  D  IVQSRP
Sbjct  284  RRIEAHFGRPQDIEWCLVDDDFRIVQSRP  312



>ref|WP_007717764.1| phosphoenolpyruvate synthase [Brevibacillus sp. BC25]
 gb|EJL31064.1| phosphoenolpyruvate synthase/pyruvate phosphate dikinase [Brevibacillus 
sp. BC25]
Length=871

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 110/220 (50%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGKEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G   +   ++V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHRHVYLSVIVQKMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  DK   +A    ++++ ++G      E  ++  D  K     +P   
Sbjct  223  VSADCYKVQEGEIVDK--RIA----TKKLAIYGRKEGGTETQQIDPDQQKTQTLTEP---  273

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV     IVQSRP
Sbjct  274  -QILQ-LARIGRQIEAYFGCPQDIEWCLVDDTFSIVQSRP  311



>ref|WP_030499139.1| phosphoenolpyruvate synthase [Micromonospora purpureochromogenes]
Length=864

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 101/209 (48%), Gaps = 12/209 (6%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AGL ++  NV  +  ++    +SR WASL+T RAV  RR  G+  
Sbjct  116  VRSSATAEDLPAASFAGLQDTYLNVVGTAEVL--RHVSRCWASLFTDRAVTYRRRHGIDD  173

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASGTRGTPWRLSSS  378
            +   MAV+VQ M+ P+ + VL T  P   D+  V  E   GLGE L +G       ++  
Sbjct  174  RAVDMAVVVQRMVFPDAAGVLFTADPVTGDRRVVSVEAGFGLGEALVAGL------VNPD  227

Query  377  KFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVG  198
             F  +   +       +       P  G   +  VD +++     P        RL  +G
Sbjct  228  VFTVRDGAVVGRRIGAKSRAAHAAPGGG-TRQAPVDPARQ---AQPALTDAQAVRLAALG  283

Query  197  FFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
              +E +FG PQDVE  L G D+ I+QSRP
Sbjct  284  RRIEARFGRPQDVEWALAGDDVHILQSRP  312



>ref|WP_006679725.1| phosphoenolpyruvate synthase [Paenibacillus dendritiformis]
 gb|EHQ59260.1| phosphoenolpyruvate synthase [Paenibacillus dendritiformis C454]
Length=862

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV
Sbjct  105  SQFGEEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       +AV+VQ M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHSHVYLAVIVQRMVFPQASGILFTADPITSNRKVISIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  DK   +A    ++++ V+G      E  ++  +  K + LT   + 
Sbjct  223  VSADCYKVKEGEIVDK--RIA----AKKLAVYGRKEGGTETQQIDPEQQKTQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV    +I+QSRP
Sbjct  277  ------QLARIGRHIEAYFGCPQDIEWCLVDDTFYIIQSRP  311



>ref|WP_040209192.1| MULTISPECIES: phosphoenolpyruvate synthase [Bacillus]
Length=866

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 105/220 (48%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+  H IS+ WASL+T RAV
Sbjct  105  SQFGEEHAYAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--HHISKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G       ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMHNGFDHSQVYLSVIIQRMVFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++  +K  DK  T       +++ ++       + + +  D  K     D    
Sbjct  223  VSADCYKVLENKIVDKRIT------GKKLAIYARKEGGTDTVPIDPDQQKTQTLTD----  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q    L  +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  273  -QQIIELARIGRQIEFFFGCPQDIEWCLVDATFYIVQSRP  311



>ref|WP_016110265.1| pyruvate, water dikinase [Bacillus cereus]
 gb|EOO34142.1| pyruvate, water dikinase [Bacillus cereus VD133]
Length=868

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 108/220 (49%), Gaps = 14/220 (6%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  N+     I+    + + WASL+T RAV
Sbjct  105  SRFGNEHAYAVRSSATAEDLPYASFAGQQDTYLNIIGEEAIL--QHVRKCWASLFTERAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
              R   G      ++ V+VQ+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  TYRMQNGFEHNQVSICVVVQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFR  231
                 +++   +  +KV  +      +++ ++G      E  ++  +  K    V  +  
Sbjct  223  VSADNYKVKEDEIVEKVIAM------KKLAIYGRKEGGTERKKIAPNQQK----VQTLTE  272

Query  230  HQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             Q+ Q L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  273  QQILQ-LARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|WP_028596808.1| phosphoenolpyruvate synthase [Paenibacillus assamensis]
Length=872

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+     I+    +S+ WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPYASFAGQQDTYLNIIGQEAIL--EHVSKCWASLFTERAVIYRMQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
            +   ++V++Q+M+ P  S +L T  P + ++  +  + + GLGE L SG      +++  
Sbjct  173  RHVYLSVIIQKMVFPQASGILFTADPINCNRKLLSIDASYGLGEALVSGLVSADCYKVQD  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
                DK   L      +++ ++G      E  +L  +  K + LT   +       +L  
Sbjct  233  GHIVDKRIAL------KKLAIYGRKEGGTETKQLNPEQQKSQTLTEQQIL------QLAQ  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CLV    +IVQSRP
Sbjct  281  IGRQIEAYFGCPQDIEWCLVDGTFYIVQSRP  311



>ref|WP_022916315.1| phosphoenolpyruvate synthase [Ruania albidiflava]
Length=873

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 109/226 (48%), Gaps = 30/226 (13%)
 Frame = -2

Query  761  FPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLS  582
            FP  T   VRSSA  EDL   S AG  +S  NV  +  ++  H I   WASL+T RAV  
Sbjct  116  FPAGTAFAVRSSATAEDLPWASFAGQQDSFLNVIGTEAVL--HRIRSCWASLFTERAVAY  173

Query  581  RRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TR  405
            R   G+  + A MAV+VQ+ML+P  S VL T  P   ++   + E   GLGE L SG   
Sbjct  174  RVRHGIDHRAAQMAVVVQQMLAPEASGVLFTADPMTGNRTVTQVEATLGLGEALVSGQVD  233

Query  404  GTPWRLSSSK-FDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRH  228
               +R+S ++  D +V     A+++      G+G               +P TV PV + 
Sbjct  234  PDSYRVSDAQVVDRRVTRKTTASYAV-----GSG-------------GTRPQTV-PVHQQ  274

Query  227  QL-----GQRLGTVGF--FLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                    Q L  VG    +E  FG PQD+E CLV     +VQSRP
Sbjct  275  DAPVLTEAQVLALVGLGRRVEAHFGRPQDIEWCLVAGAFHLVQSRP  320



>gb|KGN51777.1| hypothetical protein Csa_5G599830 [Cucumis sativus]
Length=1471

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1273  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1332

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D D  + L + +     F    I+         
Sbjct  1333  AEVVKGLGETLVGAYPGRALSFICKKNDLDTPKVLGYPSKPIGLFIRRSIIFRSDSNGED  1392

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DY+  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1393  LEGYAGAGLYDSVPMDEEEKVVLDYTTDPLIVDDNFRKSILSSIARAGNAIEELYGSPQD  1452

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +   ++++VQ+RPQ
Sbjct  1453  IEGVIRDGEVYVVQTRPQ  1470



>ref|XP_004135261.1| PREDICTED: alpha-glucan water dikinase, chloroplastic-like [Cucumis 
sativus]
Length=1482

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 95/198 (48%), Gaps = 23/198 (12%)
 Frame = -2

Query  632   CISRVWASLYTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVE  453
              I +VWAS +  RA  S R   +      MAVLVQE+++ + +FV+HT +P+  D + + 
Sbjct  1284  AIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIY  1343

Query  452   AEIASGLGETLASGTRGTPWRLSSSKFD-DKVQTLAFAN-----FSEEMIVH--------  315
             AE+  GLGETL     G        K D D  + L + +     F    I+         
Sbjct  1344  AEVVKGLGETLVGAYPGRALSFICKKNDLDTPKVLGYPSKPIGLFIRRSIIFRSDSNGED  1403

Query  314   -----GTGPADG----EVIRLTVDYSKKPLTVDPVFRHQLGQRLGTVGFFLERKFGCPQD  162
                  G G  D     E  ++ +DY+  PL VD  FR  +   +   G  +E  +G PQD
Sbjct  1404  LEGYAGAGLYDSVPMDEEEKVVLDYTTDPLIVDDNFRKSILSSIARAGNAIEELYGSPQD  1463

Query  161   VEGCLVGKDIFIVQSRPQ  108
             +EG +   ++++VQ+RPQ
Sbjct  1464  IEGVIRDGEVYVVQTRPQ  1481



>ref|WP_028408914.1| phosphoenolpyruvate synthase [Bacillus sp. 171095_106]
Length=868

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 107/226 (47%), Gaps = 15/226 (7%)
 Frame = -2

Query  785  VIETLESMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASL  606
            VI +L S F  +    VRSSA  EDL   S AG +++  N+     I+    IS+ WASL
Sbjct  100  VIHSL-SQFGEEHAYAVRSSATAEDLPHASFAGQHDTYLNIRGKEAIL--EHISKCWASL  156

Query  605  YTRRAVLSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGE  426
            +T RAV  R   G       ++V+VQ M+ P  S +L T  P   ++  +  +   GLGE
Sbjct  157  FTNRAVTYRIKNGFDHSQVHVSVIVQRMVFPQASGILFTADPITSNRKLLSIDAGFGLGE  216

Query  425  TLASG-TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLT  249
             L SG      +++   +  DK   +A    ++++ ++G      E   +  D  K    
Sbjct  217  ALVSGLVSADCYKVKEGEIVDK--KIA----AKKLAIYGLKEGGTETKEVHSDLQKMQAL  270

Query  248  VDPVFRHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
             +P   H     L  VG  LE  F CPQD+E CL     +IVQSRP
Sbjct  271  TEPQILH-----LARVGRELEAYFDCPQDIEWCLADDRFYIVQSRP  311



>gb|EEM08152.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus mycoides 
Rock3-17]
Length=876

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RAV+ R   G   
Sbjct  120  VRSSATAEDLPFASFAGQQDTYLNIIGKDAIL--RHISKCWASLFTDRAVIYRIQNGFDH  177

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  178  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  237

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  238  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQKTQTLTEQQIL------QLAR  285

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CL  +  +IVQSRP
Sbjct  286  IGREIEAYFGCPQDIEWCLADETFYIVQSRP  316



>ref|WP_039810953.1| phosphoenolpyruvate synthase [Nocardia otitidiscaviarum]
Length=869

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 102/215 (47%), Gaps = 16/215 (7%)
 Frame = -2

Query  749  TRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAA  570
            T   VRSSA  EDL   S AG  +S  NV+    I+    I R WASL+T RA+  R+  
Sbjct  110  TACAVRSSATAEDLPTASFAGQQDSYLNVTGVRAIL--EHIGRCWASLFTERAITYRQRN  167

Query  569  GVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPW  393
            G   +   MAV+VQ M+ P  + ++ T  P   D+  V  +   GLGE L SG      +
Sbjct  168  GFGHRAIDMAVVVQRMVFPRAAGIMVTADPVTSDRKVVSIDAGFGLGEALVSGLVNADVY  227

Query  392  RLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIR-LTVDYSKKPLTVDPVFRHQLGQ  216
            R+      D+  T+A    + E       PA G  +R +  +   + +  D         
Sbjct  228  RVRDDAITDR--TVATKKLTVE-----ANPAGGTQVREIEPERQHRQVLTDAQI-----L  275

Query  215  RLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            RL  +G  +E  FGCPQDVE CL   D  IVQSRP
Sbjct  276  RLARLGRDIEAHFGCPQDVEWCLDDTDFRIVQSRP  310



>ref|WP_016124802.1| pyruvate, water dikinase [Bacillus cereus]
 gb|EOO67682.1| pyruvate, water dikinase [Bacillus cereus VD196]
Length=868

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV     I+    I + WASL+T RAV
Sbjct  105  SHFGDEHAYAVRSSATAEDLPYASFAGQQDTYLNVIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  +KV        ++++ ++G      E  ++  +  K + LT   + 
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQKFQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



>ref|WP_033796696.1| phosphoenolpyruvate synthase [Bacillus mycoides]
Length=871

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPFASFAGQQDTYLNIIGKDAIL--RHISKCWASLFTDRAVIYRIQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQKTQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CL  +  +IVQSRP
Sbjct  281  IGREIEAYFGCPQDIEWCLADETFYIVQSRP  311



>ref|WP_018764676.1| phosphoenolpyruvate synthase [Bacillus sp. 105MF]
Length=871

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 106/211 (50%), Gaps = 16/211 (8%)
 Frame = -2

Query  737  VRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGVPQ  558
            VRSSA  EDL   S AG  ++  N+   + I+    IS+ WASL+T RAV+ R   G   
Sbjct  115  VRSSATAEDLPFASFAGQQDTYLNIIGKDAIL--RHISKCWASLFTDRAVIYRIQNGFDH  172

Query  557  KDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGTPWRLSS  381
                ++V++Q M+ P  S +L T  P   ++  +  + + GLGE L SG      +++  
Sbjct  173  SQVYLSVIIQRMIFPQASGILFTADPITSNRKLLSIDASFGLGEALVSGLVSADCYKVQE  232

Query  380  SKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVFRHQLGQRLGT  204
             K  DK+        ++++ ++G      E  ++  D  K + LT   +       +L  
Sbjct  233  DKIVDKMIA------TKKLAIYGLKEGGTETQQIDPDRQKTQTLTEQQIL------QLAR  280

Query  203  VGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            +G  +E  FGCPQD+E CL  +  +IVQSRP
Sbjct  281  IGREIEAYFGCPQDIEWCLADETFYIVQSRP  311



>ref|WP_042796964.1| pyruvate phosphate dikinase [Achromobacter xylosoxidans]
 gb|KGY28752.1| pyruvate phosphate dikinase [Achromobacter xylosoxidans]
Length=665

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 109/213 (51%), Gaps = 15/213 (7%)
 Frame = -2

Query  743  LIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRRAAGV  564
            + VRSS+N EDL G S AGLY ++PNV+   P      +  VWAS+Y   A  +RRAAG+
Sbjct  460  VFVRSSSNSEDLPGFSGAGLYTTVPNVT--QPEALTQAVQTVWASVYNYEAYEARRAAGI  517

Query  563  PQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIAS-GLGETLASGTRGTPWRL  387
             Q    MAVLVQ+  +   S V+ T  P D  +  V    A  GLG  +  G R    +L
Sbjct  518  GQDGVVMAVLVQQAAASESSGVMITRDPFDASRRYVTYLSAKRGLGIKVVEGKRQAE-QL  576

Query  386  SSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLGQRLG  207
              S +   VQ L+ +    +++      A G V  + ++ S++      V    L  RL 
Sbjct  577  MYSSWSKAVQVLSRSAEDTQLVAD----AAGGVREVPIEGSRQ------VLNDALVARLA  626

Query  206  TVGFFLERKF-GCPQDVEGCLVGKDIFIVQSRP  111
             VG  ++++  G  QD+E  + G++I I+Q+RP
Sbjct  627  AVGSHIKQRLGGVDQDIEWAVQGENILILQARP  659



>gb|ERN51134.1| phosphoenolpyruvate synthase [Bacillus marmarensis DSM 21297]
Length=787

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 106/216 (49%), Gaps = 14/216 (6%)
 Frame = -2

Query  755  GQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAVLSRR  576
            G+    VRSSA  EDL   S AG  ++  N+     I+    IS+ WASL+T RAV+ R 
Sbjct  48   GEDAFAVRSSATAEDLPHASFAGQQDTYLNIIGKEAIL--QHISKCWASLFTDRAVIYRM  105

Query  575  AAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-TRGT  399
              G   +   ++V+VQ M  P  S +L T  P   ++  +  + + GLGE L SG     
Sbjct  106  QNGFDHRQIYLSVVVQRMAFPQASGILFTADPITSNRKLLTIDASYGLGEALVSGLVSAD  165

Query  398  PWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSKKPLTVDPVFRHQLG  219
             +++   K  DK+        ++++ ++G      E++ +  D  K     D     Q+ 
Sbjct  166  NYKVQEDKIVDKMIA------AKKLAIYGLKDGGTEILPIDPDQQKIQTLTD----QQIL  215

Query  218  QRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
            Q L  +G  +E  FG PQD+E CLV    +IVQSRP
Sbjct  216  Q-LARIGRQIEAYFGFPQDIEWCLVDDIFYIVQSRP  250



>ref|WP_000094181.1| phosphoenolpyruvate synthase [Bacillus cereus]
 ref|NP_832830.1| phosphoenolpyruvate synthase [Bacillus cereus ATCC 14579]
 gb|AAP10031.1| Phosphoenolpyruvate synthase [Bacillus cereus ATCC 14579]
 gb|EEL11141.1| Pyruvate phosphate dikinase PEP/pyruvate-binding [Bacillus cereus 
BDRD-Cer4]
Length=868

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 109/221 (49%), Gaps = 16/221 (7%)
 Frame = -2

Query  767  SMFPGQTRLIVRSSANVEDLAGMSAAGLYESIPNVSPSNPIVFGHCISRVWASLYTRRAV  588
            S F  +    VRSSA  EDL   S AG  ++  NV     I+    I + WASL+T RAV
Sbjct  105  SHFGDEHAYAVRSSATAEDLPYASFAGQQDTYLNVIGKENIL--QHIKKCWASLFTDRAV  162

Query  587  LSRRAAGVPQKDAAMAVLVQEMLSPNLSFVLHTLSPTDHDQNSVEAEIASGLGETLASG-  411
            + R   G      ++ V++Q+M+ P  S +L T  P   ++  +  + + GLGE L SG 
Sbjct  163  IYRMQNGFDHNQVSICVVIQKMVFPEASGILFTADPITSNRKVLSIDASFGLGEALVSGL  222

Query  410  TRGTPWRLSSSKFDDKVQTLAFANFSEEMIVHGTGPADGEVIRLTVDYSK-KPLTVDPVF  234
                 +++   +  +KV        ++++ ++G      E  ++  +  K + LT   + 
Sbjct  223  VSADNYKVKEDEIVEKVIA------TKKLAIYGRKEGGTERKKIAPNQQKFQTLTEQQIL  276

Query  233  RHQLGQRLGTVGFFLERKFGCPQDVEGCLVGKDIFIVQSRP  111
                  +L  +G  +E  FGCPQD+E CLV   I+IVQSRP
Sbjct  277  ------QLARIGRQIEAYFGCPQDIEWCLVDDTIYIVQSRP  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360