BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007I03

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD94118.1|  putative endosomal protein                             182   6e-54   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                194   1e-53   Erythranthe guttata [common monkey flower]
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    193   2e-53   
dbj|BAH20237.1|  AT2G01970                                              186   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01680.1|  unnamed protein product                                192   3e-53   Coffea canephora [robusta coffee]
gb|KJB15314.1|  hypothetical protein B456_002G170500                    184   5e-53   Gossypium raimondii
gb|KJB15315.1|  hypothetical protein B456_002G170500                    185   5e-53   Gossypium raimondii
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         192   5e-53   Nicotiana tomentosiformis
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         192   6e-53   Nicotiana sylvestris
dbj|BAK08235.1|  predicted protein                                      186   1e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    191   1e-52   Solanum tuberosum [potatoes]
emb|CDP01681.1|  unnamed protein product                                191   2e-52   Coffea canephora [robusta coffee]
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         191   2e-52   Solanum lycopersicum
emb|CDY52038.1|  BnaA08g31510D                                          188   2e-52   Brassica napus [oilseed rape]
gb|AAF79217.1|AC006917_2  F10B6.3                                       185   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006372422.1|  endomembrane protein 70                            190   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    190   2e-52   Populus euphratica
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             190   3e-52   Populus trichocarpa [western balsam poplar]
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...    179   3e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         189   3e-52   Eucalyptus grandis [rose gum]
ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         189   4e-52   Nicotiana tomentosiformis
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         189   4e-52   Nicotiana sylvestris
gb|AFK34316.1|  unknown                                                 185   4e-52   Medicago truncatula
gb|ACR33947.1|  unknown                                                 187   4e-52   Zea mays [maize]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    189   4e-52   Populus euphratica
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    189   5e-52   Fragaria vesca subsp. vesca
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         189   5e-52   Solanum lycopersicum
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    189   5e-52   Solanum tuberosum [potatoes]
emb|CDX84018.1|  BnaC08g16270D                                          189   5e-52   
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                189   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         189   5e-52   Brassica rapa
emb|CDY52035.1|  BnaA08g31480D                                          189   6e-52   Brassica napus [oilseed rape]
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         189   6e-52   Brassica rapa
emb|CDY56297.1|  BnaC09g52300D                                          187   7e-52   Brassica napus [oilseed rape]
ref|XP_006649701.1|  PREDICTED: putative phagocytic receptor 1b-like    186   8e-52   
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         188   8e-52   Malus domestica [apple tree]
gb|KHN43674.1|  Putative phagocytic receptor 1b                         188   9e-52   Glycine soja [wild soybean]
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    188   9e-52   Cicer arietinum [garbanzo]
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    188   1e-51   Glycine max [soybeans]
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         188   1e-51   Solanum lycopersicum
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    188   1e-51   
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             188   1e-51   Capsella rubella
gb|AAF63170.1|AC010657_6  T5E21.15                                      187   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    188   1e-51   Cicer arietinum [garbanzo]
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             188   1e-51   Phaseolus vulgaris [French bean]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    188   1e-51   Cucumis melo [Oriental melon]
gb|KHN28892.1|  Putative phagocytic receptor 1b                         188   1e-51   Glycine soja [wild soybean]
gb|EMS68537.1|  Putative phagocytic receptor 1b                         187   1e-51   Triticum urartu
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    188   1e-51   Cucumis melo [Oriental melon]
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    188   1e-51   Glycine max [soybeans]
emb|CDY03085.1|  BnaC07g21420D                                          187   2e-51   
ref|XP_004137376.1|  PREDICTED: putative phagocytic receptor 1b-like    187   2e-51   Cucumis sativus [cucumbers]
ref|NP_001148980.1|  LOC100282600 precursor                             187   2e-51   Zea mays [maize]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    187   2e-51   Elaeis guineensis
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Brachypodium distachyon [annual false brome]
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    187   2e-51   Glycine max [soybeans]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    187   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             187   2e-51   Capsella rubella
gb|KJB08470.1|  hypothetical protein B456_001G083100                    187   2e-51   Gossypium raimondii
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          187   2e-51   Sorghum bicolor [broomcorn]
gb|AGT15903.1|  transmembrane 9 superfamily protein                     187   2e-51   Saccharum hybrid cultivar R570
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    187   2e-51   Setaria italica
dbj|BAJ89640.1|  predicted protein                                      187   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Nicotiana tomentosiformis
gb|KDP38192.1|  hypothetical protein JCGZ_04835                         187   2e-51   Jatropha curcas
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG09925.1|  Putative phagocytic receptor 1b                         187   2e-51   Gossypium arboreum [tree cotton]
emb|CDX81659.1|  BnaC08g39420D                                          187   2e-51   
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    187   2e-51   Vitis vinifera
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         187   2e-51   Nelumbo nucifera [Indian lotus]
emb|CDY41095.1|  BnaC05g10860D                                          187   2e-51   Brassica napus [oilseed rape]
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         187   3e-51   Medicago truncatula
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             187   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             187   3e-51   Eutrema salsugineum [saltwater cress]
ref|NP_172919.1|  putative endomembrane protein 70                      187   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    187   3e-51   Arabis alpina [alpine rockcress]
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         187   3e-51   Nicotiana sylvestris
ref|NP_001049492.1|  Os03g0237000                                       187   3e-51   
emb|CDY15803.1|  BnaC02g34220D                                          187   3e-51   Brassica napus [oilseed rape]
gb|AFK33397.1|  unknown                                                 184   3e-51   Medicago truncatula
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         187   3e-51   Prunus mume [ume]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             187   3e-51   Prunus persica
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             187   3e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         187   3e-51   Cucumis melo [Oriental melon]
ref|NP_178306.1|  putative endomembrane protein 70                      187   4e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    187   4e-51   Arabis alpina [alpine rockcress]
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         187   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         187   4e-51   Nelumbo nucifera [Indian lotus]
gb|KHG03505.1|  Putative phagocytic receptor 1b                         186   4e-51   Gossypium arboreum [tree cotton]
gb|KHN24548.1|  Putative phagocytic receptor 1b                         186   4e-51   Glycine soja [wild soybean]
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             186   4e-51   Phaseolus vulgaris [French bean]
ref|XP_007031333.1|  Endomembrane protein 70 protein family             186   5e-51   
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    186   5e-51   Elaeis guineensis
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         186   5e-51   Tarenaya hassleriana [spider flower]
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         186   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         186   5e-51   
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    186   5e-51   Fragaria vesca subsp. vesca
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    186   5e-51   Zea mays [maize]
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    186   5e-51   Zea mays [maize]
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         186   5e-51   Eucalyptus grandis [rose gum]
ref|XP_002521898.1|  transporter, putative                              185   5e-51   
gb|KJB15313.1|  hypothetical protein B456_002G170500                    186   6e-51   Gossypium raimondii
ref|XP_004170088.1|  PREDICTED: putative phagocytic receptor 1b-like    186   6e-51   
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    186   7e-51   Morus notabilis
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    186   7e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         186   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         186   7e-51   Phoenix dactylifera
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             186   8e-51   Prunus persica
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             186   8e-51   
ref|XP_002521900.1|  transporter, putative                              186   8e-51   Ricinus communis
ref|XP_002305925.2|  endomembrane protein 70                            186   8e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    186   8e-51   Populus euphratica
ref|XP_002870515.1|  transporter                                        186   9e-51   Arabidopsis lyrata subsp. lyrata
gb|KJB15310.1|  hypothetical protein B456_002G170500                    186   1e-50   Gossypium raimondii
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    185   1e-50   Populus euphratica
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         185   1e-50   Malus domestica [apple tree]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         185   1e-50   Eucalyptus grandis [rose gum]
gb|AHA84153.1|  phagocytic receptor 1b                                  185   1e-50   Phaseolus vulgaris [French bean]
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             185   1e-50   Capsella rubella
ref|XP_002521899.1|  transporter, putative                              185   1e-50   Ricinus communis
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             185   1e-50   
gb|KHG00678.1|  Putative phagocytic receptor 1b                         184   1e-50   Gossypium arboreum [tree cotton]
gb|KHG04463.1|  Putative phagocytic receptor 1b                         186   1e-50   Gossypium arboreum [tree cotton]
gb|KJB60873.1|  hypothetical protein B456_009G329300                    184   1e-50   Gossypium raimondii
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    185   1e-50   Elaeis guineensis
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    185   1e-50   
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    185   1e-50   
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    185   2e-50   Elaeis guineensis
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         185   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY62621.1|  BnaC08g46810D                                          185   2e-50   Brassica napus [oilseed rape]
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         185   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         185   2e-50   Brassica rapa
gb|KDP38191.1|  hypothetical protein JCGZ_04834                         184   2e-50   Jatropha curcas
emb|CDY47549.1|  BnaA08g07380D                                          184   2e-50   Brassica napus [oilseed rape]
gb|KJB60874.1|  hypothetical protein B456_009G329300                    184   2e-50   Gossypium raimondii
ref|XP_004150159.1|  PREDICTED: putative phagocytic receptor 1b-like    185   2e-50   
emb|CDP05457.1|  unnamed protein product                                184   2e-50   Coffea canephora [robusta coffee]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         184   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         184   3e-50   
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         184   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         184   4e-50   Phoenix dactylifera
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             183   4e-50   
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         184   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    184   5e-50   Citrus sinensis [apfelsine]
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             184   5e-50   Citrus clementina [clementine]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         184   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         183   6e-50   
gb|KHN39489.1|  Putative phagocytic receptor 1b                         183   7e-50   Glycine soja [wild soybean]
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    183   7e-50   Sesamum indicum [beniseed]
gb|EPS73142.1|  hypothetical protein M569_01612                         182   9e-50   Genlisea aurea
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             183   9e-50   Citrus clementina [clementine]
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    182   1e-49   Phoenix dactylifera
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    182   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    182   2e-49   Glycine max [soybeans]
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         182   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             182   2e-49   Phaseolus vulgaris [French bean]
gb|KHN41041.1|  Putative phagocytic receptor 1b                         182   2e-49   Glycine soja [wild soybean]
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         181   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         181   5e-49   Tarenaya hassleriana [spider flower]
ref|NP_001064040.1|  Os10g0112600                                       180   7e-49   
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         181   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         180   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    180   8e-49   Glycine max [soybeans]
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    180   8e-49   Glycine max [soybeans]
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               180   1e-48   Chlamydomonas reinhardtii
ref|NP_198547.3|  putative endomembrane protein 70                      180   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         180   1e-48   Nelumbo nucifera [Indian lotus]
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    180   1e-48   Zea mays [maize]
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         179   1e-48   Phoenix dactylifera
gb|ADQ43185.1|  endomemebrane protein 70                                179   2e-48   Schrenkiella parvula
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         179   2e-48   Brachypodium distachyon [annual false brome]
dbj|BAJ89513.1|  predicted protein                                      179   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310          180   2e-48   
gb|EMS60954.1|  Putative phagocytic receptor 1b                         179   2e-48   Triticum urartu
gb|EMT19161.1|  Putative phagocytic receptor 1b                         179   2e-48   
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         179   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    179   3e-48   Elaeis guineensis
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         178   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    178   5e-48   Oryza brachyantha
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    178   5e-48   
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         177   7e-48   Phoenix dactylifera
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    177   7e-48   Oryza brachyantha
gb|EEC82941.1|  hypothetical protein OsI_27915                          177   7e-48   Oryza sativa Indica Group [Indian rice]
dbj|BAC57816.1|  putative syntaxin SYP111                               177   7e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    177   8e-48   Setaria italica
gb|EEC74833.1|  hypothetical protein OsI_10676                          181   1e-47   Oryza sativa Indica Group [Indian rice]
gb|ABR25749.1|  transmembrane 9 superfamily protein member 1            165   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    178   1e-47   
gb|KJB43178.1|  hypothetical protein B456_007G188200                    176   2e-47   Gossypium raimondii
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    177   2e-47   
gb|KJB43179.1|  hypothetical protein B456_007G188200                    176   2e-47   Gossypium raimondii
gb|AAF01248.1|AF187853_1  putative multispanning membrane protein       164   2e-47   Populus tremula x Populus alba [gray poplar]
gb|ABK24901.1|  unknown                                                 176   3e-47   Picea sitchensis
gb|AES99151.2|  transmembrane 9 family protein                          176   4e-47   Medicago truncatula
gb|ABR16201.1|  unknown                                                 175   7e-47   Picea sitchensis
ref|XP_006849485.1|  hypothetical protein AMTR_s00024p00115620          175   8e-47   
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    174   1e-46   
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             174   1e-46   
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             174   1e-46   
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    174   1e-46   Nicotiana tomentosiformis
gb|KHG20583.1|  Putative phagocytic receptor 1b                         174   2e-46   Gossypium arboreum [tree cotton]
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    174   2e-46   
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    174   2e-46   Nicotiana tomentosiformis
ref|XP_001775546.1|  predicted protein                                  173   3e-46   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...    172   3e-46   Nicotiana sylvestris
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    172   3e-46   Nicotiana sylvestris
ref|XP_001770691.1|  predicted protein                                  173   4e-46   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    172   4e-46   Nicotiana sylvestris
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   173   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    172   5e-46   Cicer arietinum [garbanzo]
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    172   5e-46   Nicotiana sylvestris
gb|EEC66468.1|  hypothetical protein OsI_32547                          173   5e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              171   8e-46   Volvox carteri f. nagariensis
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         172   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005650801.1|  putative endosomal protein                         171   2e-45   Coccomyxa subellipsoidea C-169
gb|EEE68090.1|  hypothetical protein OsJ_26137                          173   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         171   2e-45   Eucalyptus grandis [rose gum]
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    171   2e-45   Solanum tuberosum [potatoes]
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             170   5e-45   Volvox carteri f. nagariensis
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               170   6e-45   Chlamydomonas reinhardtii
ref|XP_010523530.1|  PREDICTED: putative phagocytic receptor 1b         163   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         167   5e-44   Eucalyptus grandis [rose gum]
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     166   6e-44   Eucalyptus grandis [rose gum]
ref|XP_003059958.1|  predicted protein                                  165   2e-43   Micromonas pusilla CCMP1545
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               164   7e-43   Coccomyxa subellipsoidea C-169
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         164   7e-43   Solanum lycopersicum
ref|XP_002505642.1|  predicted protein                                  162   1e-42   Micromonas commoda
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    163   1e-42   Nicotiana tomentosiformis
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    163   1e-42   Nicotiana tomentosiformis
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             162   2e-42   Selaginella moellendorffii
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             162   3e-42   Selaginella moellendorffii
ref|XP_001755694.1|  predicted protein                                  162   4e-42   
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              161   6e-42   Chlorella variabilis
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    159   2e-41   Nicotiana sylvestris
gb|KDD75073.1|  endomembrane protein 70                                 159   2e-41   Helicosporidium sp. ATCC 50920
gb|ACF74283.1|  putative endosomal protein                              148   2e-41   Arachis hypogaea [goober]
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    159   2e-41   Nicotiana sylvestris
ref|XP_001783681.1|  predicted protein                                  159   3e-41   
ref|XP_007512838.1|  predicted protein                                  159   5e-41   Bathycoccus prasinos
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             155   5e-40   
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             155   5e-40   
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    154   1e-39   
ref|XP_011003771.1|  PREDICTED: transmembrane 9 superfamily membe...    152   7e-39   Populus euphratica
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    152   7e-39   Populus euphratica
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    151   1e-38   
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    151   1e-38   
gb|EPS73381.1|  hypothetical protein M569_01372                         151   1e-38   Genlisea aurea
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         152   2e-38   
gb|KIY97757.1|  Putative phagocytic receptor 1b                         141   5e-38   Monoraphidium neglectum
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    150   5e-38   Auxenochlorella protothecoides
ref|XP_001422764.1|  predicted protein                                  148   2e-37   Ostreococcus lucimarinus CCE9901
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     148   3e-37   Ostreococcus tauri
emb|CDP05446.1|  unnamed protein product                                142   2e-35   Coffea canephora [robusta coffee]
emb|CDP05453.1|  unnamed protein product                                142   3e-35   Coffea canephora [robusta coffee]
emb|CDP05450.1|  unnamed protein product                                138   5e-35   Coffea canephora [robusta coffee]
ref|XP_006849484.1|  hypothetical protein AMTR_s00024p00115000          138   6e-34   Amborella trichopoda
ref|XP_006448059.1|  hypothetical protein CICLE_v10017699mg             135   1e-33   
emb|CDP05443.1|  unnamed protein product                                136   3e-33   Coffea canephora [robusta coffee]
gb|EWM25418.1|  Nonaspanin (TM9SF)                                      134   1e-32   Nannochloropsis gaditana
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             132   8e-32   Guillardia theta CCMP2712
emb|CDY09399.1|  BnaA02g26110D                                          124   9e-32   Brassica napus [oilseed rape]
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         132   1e-31   Prunus mume [ume]
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    131   2e-31   Fragaria vesca subsp. vesca
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         131   2e-31   
ref|XP_009043049.1|  hypothetical protein AURANDRAFT_39530              130   2e-31   Aureococcus anophagefferens
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         131   2e-31   
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         131   2e-31   
ref|XP_010066535.1|  PREDICTED: putative phagocytic receptor 1b i...    130   3e-31   Eucalyptus grandis [rose gum]
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             130   3e-31   Guillardia theta CCMP2712
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     130   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    130   4e-31   Eucalyptus grandis [rose gum]
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             130   4e-31   
emb|CBN73993.1|  conserved unknown protein                              130   7e-31   Ectocarpus siliculosus
ref|XP_009041654.1|  hypothetical protein AURANDRAFT_55500              129   2e-30   Aureococcus anophagefferens
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    128   2e-30   Glycine max [soybeans]
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 127   5e-30   Medicago truncatula
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    127   7e-30   Cicer arietinum [garbanzo]
gb|ETM31493.1|  hypothetical protein L914_20950                         124   8e-29   
gb|ETL25017.1|  hypothetical protein L916_21077                         124   9e-29   
ref|XP_008898687.1|  hypothetical protein PPTG_06513                    124   9e-29   
ref|XP_002906883.1|  endomembrane protein 70-like protein, putative     124   9e-29   
gb|KJB55631.1|  hypothetical protein B456_009G086000                    123   1e-28   
gb|ETL78232.1|  hypothetical protein L917_20933                         124   1e-28   
gb|KDO37844.1|  hypothetical protein CISIN_1g034896mg                   115   1e-28   
gb|KJB55630.1|  hypothetical protein B456_009G086000                    124   1e-28   
gb|KGN64925.1|  hypothetical protein Csa_1G162610                       120   4e-28   
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             122   4e-28   
gb|KDO36860.1|  hypothetical protein CISIN_1g029473mg                   117   4e-28   
ref|XP_003083100.1|  putative syntaxin SYP111 (ISS)                     120   9e-28   
gb|KDP33127.1|  hypothetical protein JCGZ_13574                         121   9e-28   
gb|KHG11801.1|  Putative phagocytic receptor 1b                         121   9e-28   
ref|XP_007045411.1|  Endomembrane protein 70 protein family isofo...    119   9e-28   
gb|EJK56326.1|  hypothetical protein THAOC_23816                        122   1e-27   
ref|XP_011088889.1|  PREDICTED: transmembrane 9 superfamily membe...    119   1e-27   
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    121   1e-27   
ref|XP_004159113.1|  PREDICTED: putative phagocytic receptor 1b-like    119   1e-27   
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    120   2e-27   
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    120   2e-27   
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b         120   2e-27   
emb|CBI28324.3|  unnamed protein product                                120   2e-27   
ref|XP_008617593.1|  hypothetical protein SDRG_13291                    120   2e-27   
ref|XP_009516022.1|  hypothetical protein PHYSODRAFT_552451             120   3e-27   
ref|XP_011088888.1|  PREDICTED: transmembrane 9 superfamily membe...    119   4e-27   
ref|XP_004139482.1|  PREDICTED: putative phagocytic receptor 1b-like    119   5e-27   
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    119   5e-27   
gb|KDO18538.1|  hypothetical protein SPRG_16087                         119   6e-27   
gb|KDO24186.1|  hypothetical protein SPRG_10614                         119   7e-27   
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         118   9e-27   
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    118   1e-26   
ref|XP_004341571.1|  Endomembrane protein 70 subfamily                  118   1e-26   
ref|XP_002181450.1|  predicted protein                                  117   2e-26   
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             117   2e-26   
emb|CAN67239.1|  hypothetical protein VITISV_004804                     119   2e-26   
ref|XP_006487944.1|  PREDICTED: putative phagocytic receptor 1b-l...    116   3e-26   
ref|XP_010089827.1|  Putative phagocytic receptor 1b                    117   3e-26   
ref|XP_009831493.1|  hypothetical protein H257_07606                    117   4e-26   
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   116   4e-26   
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    116   4e-26   
ref|XP_008878196.1|  hypothetical protein, variant                      117   5e-26   
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             116   5e-26   
ref|XP_008878197.1|  hypothetical protein H310_12781                    117   6e-26   
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...    115   6e-26   
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...    115   7e-26   
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    116   7e-26   
emb|CDP06928.1|  unnamed protein product                                116   7e-26   
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360               115   1e-25   
ref|XP_002167759.2|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-25   
ref|NP_563812.1|  endomembrane protein 70                               114   2e-25   
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                115   2e-25   
ref|XP_002890068.1|  predicted protein                                  114   2e-25   
ref|WP_041515112.1|  hypothetical protein                               106   3e-25   
gb|ELT97180.1|  hypothetical protein CAPTEDRAFT_172435                  113   3e-25   
gb|AAK74038.1|  At1g08350/T27G7_4                                       113   3e-25   
ref|NP_001077489.1|  endomembrane protein 70                            114   4e-25   
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    114   6e-25   
ref|XP_010475630.1|  PREDICTED: putative phagocytic receptor 1b i...    112   6e-25   
ref|XP_004997982.1|  transmembrane 9 superfamily member 1               113   7e-25   
gb|KDD73327.1|  hypothetical protein H632_c2295p0                       105   7e-25   
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...    112   8e-25   
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             113   9e-25   
gb|ETO29447.1|  EMP/nonaspanin domain family protein                    110   1e-24   
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    112   1e-24   
ref|XP_008461519.1|  PREDICTED: putative phagocytic receptor 1b i...    112   1e-24   
ref|XP_008461510.1|  PREDICTED: putative phagocytic receptor 1b i...    111   2e-24   
ref|XP_008461501.1|  PREDICTED: putative phagocytic receptor 1b i...    111   2e-24   
ref|XP_002892454.1|  endomembrane protein 70 family protein             112   2e-24   
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...    112   2e-24   
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             111   2e-24   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    112   2e-24   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1    112   3e-24   
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...    112   4e-24   
ref|XP_003385405.1|  PREDICTED: transmembrane 9 superfamily membe...    111   4e-24   
ref|XP_642757.1|  TM9 protein B                                         109   5e-24   
emb|CDX95066.1|  BnaC05g06050D                                          110   5e-24   
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1    111   6e-24   
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...    111   7e-24   
ref|XP_010488760.1|  PREDICTED: putative phagocytic receptor 1b i...    109   9e-24   
ref|XP_642756.1|  TM9 protein B                                         109   1e-23   
ref|XP_005109383.1|  PREDICTED: transmembrane 9 superfamily membe...    109   1e-23   
gb|AAQ95660.1|  Phg1B                                                   109   1e-23   
ref|XP_001638325.1|  predicted protein                                  108   1e-23   
emb|CAD47840.1|  putative phagocytic receptor 1b                        109   1e-23   
ref|XP_004363702.2|  transmembrane 9 superfamily member 1               109   2e-23   
gb|ETO15621.1|  hypothetical protein RFI_21749                          108   2e-23   
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...    109   2e-23   
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030              108   3e-23   
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b         108   5e-23   
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b         107   5e-23   
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like    107   6e-23   
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...    107   7e-23   
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...    107   7e-23   
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...    107   7e-23   
emb|CBY36864.1|  unnamed protein product                                106   9e-23   
ref|XP_010521658.1|  PREDICTED: putative phagocytic receptor 1b i...    106   1e-22   
ref|XP_003726766.1|  PREDICTED: transmembrane 9 superfamily membe...    103   1e-22   
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...    106   1e-22   
ref|XP_009052622.1|  hypothetical protein LOTGIDRAFT_174735             106   1e-22   
emb|CBY22138.1|  unnamed protein product                                106   2e-22   
gb|EFX74144.1|  hypothetical protein DAPPUDRAFT_324641                  106   2e-22   
ref|NP_001121353.1|  transmembrane 9 superfamily member 1               105   2e-22   
ref|XP_007444445.1|  PREDICTED: transmembrane 9 superfamily member 1    105   2e-22   
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    105   3e-22   
emb|CDX93569.1|  BnaA06g04790D                                          105   4e-22   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    105   5e-22   
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...    105   5e-22   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    105   5e-22   
ref|XP_009024297.1|  hypothetical protein HELRODRAFT_157541             105   5e-22   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    105   5e-22   
ref|XP_010686010.1|  PREDICTED: transmembrane 9 superfamily membe...    103   6e-22   
ref|XP_007065454.1|  PREDICTED: transmembrane 9 superfamily member 1    103   8e-22   
ref|XP_005290178.1|  PREDICTED: transmembrane 9 superfamily member 1    103   8e-22   
ref|XP_002125091.1|  PREDICTED: transmembrane 9 superfamily member 1    104   9e-22   
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...    104   9e-22   
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1    104   1e-21   
gb|EAW66074.1|  transmembrane 9 superfamily member 1, isoform CRA_b     102   1e-21   
ref|NP_001275935.1|  transmembrane 9 superfamily member 1 isoform c     102   2e-21   
ref|XP_004421248.1|  PREDICTED: transmembrane 9 superfamily membe...    102   2e-21   
ref|XP_004055038.1|  PREDICTED: transmembrane 9 superfamily membe...    102   2e-21   
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    103   2e-21   
dbj|BAG65421.1|  unnamed protein product                                102   2e-21   
ref|XP_007984500.1|  PREDICTED: transmembrane 9 superfamily membe...    102   2e-21   
ref|XP_006739630.1|  PREDICTED: transmembrane 9 superfamily membe...    102   2e-21   
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    103   2e-21   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    103   2e-21   
emb|CDP05442.1|  unnamed protein product                                101   3e-21   
ref|XP_006835460.1|  PREDICTED: charged multivesicular body prote...    102   3e-21   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    103   3e-21   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1    103   3e-21   
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    103   3e-21   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    103   3e-21   
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...    102   3e-21   
ref|XP_006883245.1|  PREDICTED: transmembrane 9 superfamily membe...    102   3e-21   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    102   3e-21   
gb|AAC51782.1|  multispanning membrane protein                          102   3e-21   
gb|AAH07187.1|  Tm9sf1 protein                                          102   3e-21   
ref|XP_007947408.1|  PREDICTED: transmembrane 9 superfamily membe...    102   3e-21   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    102   4e-21   
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    102   4e-21   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    102   4e-21   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    102   4e-21   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    102   4e-21   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    102   4e-21   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    102   4e-21   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    102   4e-21   
dbj|BAF84799.1|  unnamed protein product                                102   4e-21   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    102   4e-21   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     102   5e-21   
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     102   5e-21   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    102   5e-21   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor     102   5e-21   
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    102   5e-21   
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    102   5e-21   
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2          102   6e-21   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_002401275.1|  endosomal membrane protein EMP70, putative         102   6e-21   
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_008156682.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1    102   6e-21   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    102   6e-21   
emb|CDQ70386.1|  unnamed protein product                                102   6e-21   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-21   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     102   7e-21   
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor        102   7e-21   
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-21   
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-21   
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                  102   7e-21   
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-21   
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...    102   7e-21   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    101   7e-21   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    101   8e-21   
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor     101   8e-21   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    101   8e-21   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    101   8e-21   
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1    101   8e-21   
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...    102   9e-21   
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   101   9e-21   
ref|XP_010739918.1|  PREDICTED: transmembrane 9 superfamily membe...    101   9e-21   
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b         101   9e-21   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    101   1e-20   
dbj|BAH13215.1|  unnamed protein product                                102   1e-20   
ref|XP_004010946.1|  PREDICTED: LOW QUALITY PROTEIN: importin-4         102   1e-20   
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1    101   1e-20   
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    101   1e-20   
ref|XP_002678482.1|  predicted protein                                95.1    1e-20   
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1    101   1e-20   
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    100   2e-20   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-20   
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...    101   2e-20   
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    100   2e-20   



>dbj|BAD94118.1| putative endosomal protein [Arabidopsis thaliana]
Length=124

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  5    ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  64

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  65   YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  124



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE
Sbjct  533  YSYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  592



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  592



>dbj|BAH20237.1| AT2G01970 [Arabidopsis thaliana]
Length=311

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  192  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  251

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  252  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  311



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  535  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYAFFLMLGTVGFRAALFFVRHIYRSIKCE  594



>gb|KJB15314.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=281

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  162  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  221

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL+LG VGFRA+LFFVRHIYRSIKCE
Sbjct  222  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  281



>gb|KJB15315.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=290

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  171  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  230

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL+LG VGFRA+LFFVRHIYRSIKCE
Sbjct  231  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  290



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>dbj|BAK08235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  262  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  321

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  322  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  381



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSF+CGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFVCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  476  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  536  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRAALFFVRHIYRSIKCE  595



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSF+CGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFVCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGTVGFRAALFFVRHIYRSIKCE  596



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  361  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  420

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  421  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  480



>gb|AAF79217.1|AC006917_2 F10B6.3 [Arabidopsis thaliana]
Length=336

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  217  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  276

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  277  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  336



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>gb|ABR26036.1| transmembrane 9 superfamily protein member 1 precursor [Oryza 
sativa Indica Group]
Length=166

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTG F+
Sbjct  47   ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGFFV  106

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  107  FAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALLFVRHIYKSIKCE  166



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILF+VFIIL+I TAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFVVFIILLIVTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL F+RHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFIRHIYRSIKCE  592



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  535  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  594



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  593



>gb|AFK34316.1| unknown [Medicago truncatula]
Length=381

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  262  ASVWGHRIYTIYSILFIVFIILSIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  321

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FF MLG+VGFRA+L FVRHIYRSIKCE
Sbjct  322  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFFMLGSVGFRASLLFVRHIYRSIKCE  381



>gb|ACR33947.1| unknown [Zea mays]
Length=467

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  348  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  407

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  408  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  467



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG +GFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTIGFRASLFFVRHIYRSIKCE  592



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVF+IL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFLILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYKSIKCE  592



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  479  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  538

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  539  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  598



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  479  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  538

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  539  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  598



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMA VCYAFFLMLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMASVCYAFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>emb|CDY56297.1| BnaC09g52300D [Brassica napus]
Length=535

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  416  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  475

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  476  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  535



>ref|XP_006649701.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=467

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  348  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  407

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG +GFRAALFFVRHIY+SIKCE
Sbjct  408  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMIGFRAALFFVRHIYKSIKCE  467



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  534  YTYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  529  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  588



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  592



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  468  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  528  YTYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  587



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  478  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  537

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG+VGFRAALFFVRHIYRSIKCE
Sbjct  538  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGSVGFRAALFFVRHIYRSIKCE  597



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG+VGFRAALFFVRHIYRSIKCE
Sbjct  529  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGSVGFRAALFFVRHIYRSIKCE  588



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLGAVGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGAVGFRAALLFVRHIYRSIKCE  592



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  427  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  486

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  487  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  546



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  592



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  592



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLGA+GFRAAL FVRHIYRSIKCE
Sbjct  532  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  591



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  485  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  544

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  545  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  604



>gb|EMS68537.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=540

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  421  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  480

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  481  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  540



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  482  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  541

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLGA+GFRAAL FVRHIYRSIKCE
Sbjct  542  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  601



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  485  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  544

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  545  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  604



>emb|CDY03085.1| BnaC07g21420D [Brassica napus]
Length=535

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  416  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  475

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  476  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  535



>ref|XP_004137376.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 ref|XP_004171887.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLGA+GFRAAL FVRHIYRSIKCE
Sbjct  532  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGAIGFRAALLFVRHIYRSIKCE  591



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG +GFRAAL FVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTIGFRAALLFVRHIYRSIKCE  596



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  482  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  541

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  542  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASLLFVRHIYRSIKCE  601



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFLMLGA+GFRA+L FVRHIYRSIKCE
Sbjct  533  YTYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  592



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  476  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  536  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  595



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAALFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALFFVRHIYKSIKCE  593



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIILVI TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILVIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  534  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGNVGFRAALFFVRHIYRSIKCE  593



>gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  532  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  591



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLF+
Sbjct  478  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFV  537

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  538  YGYCWYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  597



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFLMLGA+GFRA+L FVRHIYRSIKCE
Sbjct  533  YAYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  592



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  532  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  589



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+C+ FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  529  YAYCLYYYYARSDMSGFMQTSFFFGYMACICFGFFLMLGTVGFRAALFFVRHIYRSIKCE  588



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRS+KCE
Sbjct  534  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGNVGFRAALFFVRHIYRSVKCE  593



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  476  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG +GFRAALFFVRHIY+SIKCE
Sbjct  536  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMIGFRAALFFVRHIYKSIKCE  595



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>gb|AFK33397.1| unknown [Medicago truncatula]
Length=419

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTGLFI
Sbjct  300  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLVAEDHEWWWRSFLCGGSTGLFI  359

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQT FFFGYMAC+C+ FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  360  YAYCLYYYYARSDMSGFMQTPFFFGYMACICFGFFLMLGTVGFRAALFFVRHIYRSIKCE  419



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  532  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  532  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTGLFI
Sbjct  483  ASVWGHKIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGLFI  542

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  543  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  602



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHQWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFRAALLFVRHIYRSIKCE  592



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            +SV GHRIYTIYSILFIVFIIL+I TAF+TVA+TYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  SSVWGHRIYTIYSILFIVFIILLIVTAFVTVAMTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY ARSDMSGFMQTSFFFGYMAC+CY FFLMLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  533  YAYCLYYYNARSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  592



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  467  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  527  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  586



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  535  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  594



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIV IIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  442  ASVWGHRIYTIYSILFIVVIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  501

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLY Y ARSDMSGFMQTSFFFG MAC+CY FFLMLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  502  YAYCLYSYNARSDMSGFMQTSFFFGCMACICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  561



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL++ TAFIT+ALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLVVTAFITIALTYFQLAAEDHEWWWRAFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  592



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  492  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  551

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  552  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  611



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  480  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFI  539

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRAAL FVRHIYRSIKCE
Sbjct  540  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRAALLFVRHIYRSIKCE  599



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRASLFFVRHIYKSIKCE  593



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRASLFFVRHIYKSIKCE  593



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  471  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  531  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  590



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  406  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  465

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  466  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  525



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  441  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  500

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL+LG VGFRA+LFFVRHIYRSIKCE
Sbjct  501  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  560



>ref|XP_004170088.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTGLFI
Sbjct  470  ASVWGHKIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  530  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  589



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  532  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  591



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  592



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  477  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFL+LGA+GFRAAL FVRHIYRSIKCE
Sbjct  537  YGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLLLGAIGFRAALLFVRHIYRSIKCE  596



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIY SIKCE
Sbjct  533  YGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  529  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIY SIKCE
Sbjct  533  YGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   186 bits (471),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIY SIKCE
Sbjct  533  YGYCLYYYFARSDMSGFMQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  592



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLGA+GFRA+L FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFRASLLFVRHIYRSIKCE  593



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFL+LG VGFRA+LFFVRHIYRSIKCE
Sbjct  535  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLLLGTVGFRASLFFVRHIYRSIKCE  594



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGF QTSFFFGYMACVCY FFLMLG++GFRA+LFFVRHIYRSIKCE
Sbjct  533  YGYCLYYYFARSDMSGFRQTSFFFGYMACVCYGFFLMLGSIGFRASLFFVRHIYRSIKCE  592



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  592



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  479  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  538

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  539  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRASLLFVRHIYKSIKCE  598



>gb|AHA84153.1| phagocytic receptor 1b [Phaseolus vulgaris]
Length=588

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  529  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  588



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL +VF+ILVI TAFIT+ALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  471  ASVWGHRIYTIYSILSVVFLILVIVTAFITIALTYFQLAAEDHEWWWRSFLCGGSTGLFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  531  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  590



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIILVI TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILVIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY+ARS+MSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+LFFVRHIY+SIKCE
Sbjct  533  YAYCLYYYHARSEMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYKSIKCE  592



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLA+EDH+WWWRS LCGGSTGLFI
Sbjct  476  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLASEDHEWWWRSLLCGGSTGLFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLGA+GFRA+LFFVRHIYRSIKCE
Sbjct  536  YAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGAIGFRASLFFVRHIYRSIKCE  595



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  409  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFI  468

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  469  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  528



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSF+CGGSTGLFI
Sbjct  510  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFVCGGSTGLFI  569

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  570  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLFFVRHIYRSIKCE  629



>gb|KJB60873.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=537

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  418  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFI  477

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  478  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  537



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILF+VFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLF+
Sbjct  490  ASVWGHRIYTIYSILFVVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFV  549

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  550  YGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  609



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  535  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  535  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  478  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  537

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  538  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  597



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLF+
Sbjct  480  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFV  539

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  540  YGYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  599



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTG+F+
Sbjct  473  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGVFV  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTGLFI
Sbjct  470  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGLFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG++GFRA+L FVRHIYRSIKCE
Sbjct  530  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  589



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTG+F+
Sbjct  473  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGVFV  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  532  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTG+F+
Sbjct  473  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGVFV  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLGAVGFRA+LFFVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGAVGFRASLFFVRHIYRSIKCE  592



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  475  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGIFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  535  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  594



>ref|XP_004150159.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus]
Length=654

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTGLFI
Sbjct  535  ASVWGHKIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGLFI  594

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  595  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGTVGFRAALFFVRHIYRSIKCE  654



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLAAEDH WWWRSFLCGGSTG+FI
Sbjct  488  ASVWGHKIYTIYSILFIVFIILLIVTAFVTVALTYFQLAAEDHNWWWRSFLCGGSTGIFI  547

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLGAVGFRAAL FVRHIYRSIKCE
Sbjct  548  YSYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGAVGFRAALVFVRHIYRSIKCE  607



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG++GFRA+L FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  593



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR+FLCGGSTGLFI
Sbjct  476  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRAFLCGGSTGLFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  536  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  595



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSF+CGGSTG+FI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFVCGGSTGVFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  593



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVF+IL+I TAFIT+ALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFIVFLILLIVTAFITIALTYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGF+QTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YGYCLYYYHARSDMSGFLQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_006448062.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61302.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=531

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG FI
Sbjct  412  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGAFI  471

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  472  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  531



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGVFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTS+FFGYMAC+CY FFLMLGAVGFR++L FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSYFFGYMACICYGFFLMLGAVGFRSSLLFVRHIYRSIKCE  592



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGVFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRASLLFVRHIYKSIKCE  593



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGVFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRASLLFVRHIYKSIKCE  593



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGVFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTS+FFGYMAC+CY FFLMLGAVGFR++L FVRHIYRSIKCE
Sbjct  533  YAYCLYYYYARSDMSGFMQTSYFFGYMACICYGFFLMLGAVGFRSSLLFVRHIYRSIKCE  592



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHWWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM+GFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  532  YGYCLYYYYARSDMTGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYKSIKCE  591



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  442  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  501

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  502  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRAALIFVRHIYHSIKCE  561



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTG+FI
Sbjct  468  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLVAEDHEWWWRSFLCGGSTGIFI  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  528  YSYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYHSIKCE  587



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILF+VFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLFI
Sbjct  421  ASVWGHKIYTIYSILFVVFIILLIVTAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFI  480

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC+YYYYARSDMSGFMQTSFFFGYMA VCY FFLMLG VGFRAALFFVRHIYRSIKCE
Sbjct  481  YGYCIYYYYARSDMSGFMQTSFFFGYMASVCYGFFLMLGGVGFRAALFFVRHIYRSIKCE  540



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG FI
Sbjct  474  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGAFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  593



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILF+VFIIL+I TAFITVAL YFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYSILFVVFIILLIVTAFITVALIYFQLAAEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFF YMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTSFFFRYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  592



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVAL YFQLAAEDH+WWWRS LCGGSTGLFI
Sbjct  468  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALAYFQLAAEDHEWWWRSLLCGGSTGLFI  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG++GFRA+L FVRHIYRSIKCE
Sbjct  528  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSIGFRASLLFVRHIYRSIKCE  587



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  474  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  534  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRAALIFVRHIYHSIKCE  593



>ref|XP_010261665.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=644

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  525  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHEWWWRSVLCGGSTGVFI  584

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  585  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  644



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  477  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALIFVRHIYHSIKCE  596



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  469  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMACVCY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  529  YGYCLYYYYARSDMSGFMQTSFFFGYMACVCYGFFLMLGTVGFRAALIFVRHIYLSIKCE  588



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  473  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGMFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC+YYYY RSDM+GFMQTSFFFGYMAC+CY FFLMLG++GFR++L FVRHIY+SIKCE
Sbjct  533  YGYCVYYYYGRSDMTGFMQTSFFFGYMACICYGFFLMLGSIGFRSSLLFVRHIYKSIKCE  592



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIILVI TAFIT+ALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  476  ASVWGHRIYTIYSILFIVFIILVIVTAFITIALTYFQLAAEDHEWWWRSFLCGGSTGLFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GFRA+L FVRHIY SIKCE
Sbjct  536  YVYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFRASLVFVRHIYGSIKCE  595



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTG F+
Sbjct  466  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGFFV  525

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAAL FVRHIY+SIKCE
Sbjct  526  FAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALLFVRHIYKSIKCE  585



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH IYTIYSILFIVFIIL+I TAFIT+ALTYFQLAAEDH+WWWRSFLCGGSTG+F+
Sbjct  474  ASVWGHSIYTIYSILFIVFIILLIVTAFITIALTYFQLAAEDHEWWWRSFLCGGSTGVFV  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  593



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIY IYSILFIVFIIL+I TAFITVALTYFQLA+EDH+WWWRS+LCGGSTGLF+
Sbjct  468  ASVWGHRIYIIYSILFIVFIILLIVTAFITVALTYFQLASEDHEWWWRSYLCGGSTGLFV  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  528  YGYCFYYYFARSDMSGFMQTSFFFGYMACICYGFFLMLGMVGFRAALLFVRHIYRSIKCE  587



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQT+FFFGYMAC+CY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  533  YGYCLYYYYARSDMSGFMQTTFFFGYMACICYGFFLMLGTVGFRAALIFVRHIYLSIKCE  592



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  475  ASVWGHQIYTIYSILFIVFIILLIVTAFVTVALTYFQLATEDHEWWWRSFLCGGSTGLFI  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQT+FFFGYMAC+CY FFLMLG VGFRAAL FVRHIY SIKCE
Sbjct  535  YGYCLYYYYARSDMSGFMQTTFFFGYMACICYGFFLMLGTVGFRAALIFVRHIYLSIKCE  594



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH++YTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRSFLCGGSTGLF+
Sbjct  475  ASIWGHKVYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHRWWWRSFLCGGSTGLFV  534

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQTSFFFGY A VCYAFFLMLGAVGFRA+L FVRHIYR+IKCE
Sbjct  535  YGYCFYYYYARSDMSGFMQTSFFFGYNAVVCYAFFLMLGAVGFRASLLFVRHIYRAIKCE  594



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSIL IVF+ILVI TAFITVALTYFQLAAEDH+WWWRS LCGGSTGLFI
Sbjct  474  ASVWGHRIYTIYSILSIVFLILVIVTAFITVALTYFQLAAEDHEWWWRSLLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG +GF A+L FVRHIYRSIKCE
Sbjct  534  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTIGFCASLLFVRHIYRSIKCE  593



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  471  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHEWWWRSVLCGGSTGVFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC++YY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  YGYCIFYYFARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  470  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHQWWWRSVLCGGSTGIFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+LFFVRHIYRSIKCE
Sbjct  530  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLFFVRHIYRSIKCE  589



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  469  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHEWWWRSVLCGGSTGIFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  529  FFYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 113/120 (94%), Gaps = 1/120 (1%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWW SFLCGGSTGLFI
Sbjct  469  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWW-SFLCGGSTGLFI  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRAAL FVRHIYRSIKCE
Sbjct  528  YAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRAALLFVRHIYRSIKCE  587



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDHKWWWRS LCGGSTG+FI
Sbjct  469  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHKWWWRSVLCGGSTGIFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  529  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  588



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDHKWWWRS LCGGSTG+FI
Sbjct  471  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHKWWWRSVLCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_006854108.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
 gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  512  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHEWWWRSVLCGGSTGVFI  571

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
             GYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  572  LGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  631



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDHKWWWRS LCGGSTG+FI
Sbjct  471  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHKWWWRSVLCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDHKWWWRS LCGGSTG+FI
Sbjct  471  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHKWWWRSVLCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIY IY ILF+VFIIL++  AF+TVALTYFQLAAEDH+WWWRSFLCGGSTGLF+
Sbjct  468  ASVWGHRIYIIYGILFVVFIILLVVAAFVTVALTYFQLAAEDHEWWWRSFLCGGSTGLFV  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGF AALFFVRHIYRSIKCE
Sbjct  528  YGYCLYYYFARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFHAALFFVRHIYRSIKCE  587



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVA+TYFQLAAEDH+WWWRS LCGGSTG+FI
Sbjct  471  ASVWGHKIYTIYSILFIVFIILIIVTAFITVAMTYFQLAAEDHEWWWRSVLCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM C+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRS LCGGSTG+FI
Sbjct  470  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSVLCGGSTGIFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY ARSDMSGFMQTSFFFGYM C+CY FFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  530  FFYCIYYYQARSDMSGFMQTSFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYQSIKCE  589



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  471  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHEWWWRSILCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  469  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHEWWWRSVLCGGSTGIFI  528

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YCLYYY+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FV+HIYRSIKCE
Sbjct  529  FFYCLYYYHARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVQHIYRSIKCE  588



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVA+TYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  471  ASVWGHKIYTIYSILFIVFIILIIVTAFITVAMTYFQLAVEDHEWWWRSILCGGSTGIFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM C+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  531  FFYCIYYYHARSDMSGFMQTSFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  590



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL +EDH+WWWRSFLCGGSTG F+
Sbjct  467  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLTSEDHEWWWRSFLCGGSTGFFV  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GYCLYYY+ RSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRA+L FVRHIY+SIKCE
Sbjct  527  FGYCLYYYHERSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRASLLFVRHIYKSIKCE  586



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  473  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHEWWWRSVLCGGSTGIFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  533  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  592



>dbj|BAC57816.1| putative syntaxin SYP111 [Oryza sativa Japonica Group]
Length=589

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  470  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHEWWWRSVLCGGSTGIFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  530  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIKCE  589



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  470  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHQWWWRSVLCGGSTGIFI  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLML  VGFRA+LFFVRHIYRSIKCE
Sbjct  530  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLSTVGFRASLFFVRHIYRSIKCE  589



>gb|EEC74833.1| hypothetical protein OsI_10676 [Oryza sativa Indica Group]
Length=1316

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -3

Query  767   ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+
Sbjct  903   ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFV  962

Query  587   ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIK  414
             YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CYAFFLMLG +GFRAALFFVRHIY+SIK
Sbjct  963   YGYCLYYYYARSDMSGFMQTSFFFGYMACICYAFFLMLGMIGFRAALFFVRHIYKSIK  1020



>gb|ABR25749.1| transmembrane 9 superfamily protein member 1 [Oryza sativa Indica 
Group]
Length=109

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -3

Query  692  TAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFG  513
            TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG F+YGYCLYYYYARSDMSGFMQTSFFFG
Sbjct  15   TAFITVALTYFQLAAEDHEWWWRSFLCGGSTGFFVYGYCLYYYYARSDMSGFMQTSFFFG  74

Query  512  YMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YMAC+CYAFFLMLG +GFRAALFFVRHIY+SIKCE
Sbjct  75   YMACICYAFFLMLGMIGFRAALFFVRHIYKSIKCE  109



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  649  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHQWWWRSVLCGGSTGIFI  708

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLML  VGFRA+LFFVRHIYRSIKCE
Sbjct  709  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLSTVGFRASLFFVRHIYRSIKCE  768



>gb|KJB43178.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=541

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT Y ILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLF+
Sbjct  422  ASVWGHRIYTTYVILFIVFIILLIITAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFM  481

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYY A+SDMSGFMQTSFFFGYMAC+CY FFLMLGA+GF A+LFFVRHIYRSIKCE
Sbjct  482  YAYCFYYYSAQSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  541



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 117/143 (82%), Gaps = 16/143 (11%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWR------------  624
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWR            
Sbjct  471  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRIGHRLVVLNDVS  530

Query  623  ----SFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFR  456
                SFLCGGSTG+FIY YCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFR
Sbjct  531  YVGRSFLCGGSTGIFIYAYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFR  590

Query  455  AALFFVRHIYRSIKCE*AARHPV  387
            AAL FVRHIYRSIKC+  A H +
Sbjct  591  AALLFVRHIYRSIKCDDGASHAI  613



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT Y ILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLF+
Sbjct  470  ASVWGHRIYTTYVILFIVFIILLIITAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFM  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYY A+SDMSGFMQTSFFFGYMAC+CY FFLMLGA+GF A+LFFVRHIYRSIKCE
Sbjct  530  YAYCFYYYSAQSDMSGFMQTSFFFGYMACICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  589



>gb|AAF01248.1|AF187853_1 putative multispanning membrane protein [Populus tremula x Populus 
alba]
Length=104

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -3

Query  692  TAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFG  513
            TAFITVALTYFQLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYY+ARSDMSGFMQTSFFFG
Sbjct  10   TAFITVALTYFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYFARSDMSGFMQTSFFFG  69

Query  512  YMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YMACVCY FFLMLG++GFRA+LFFVRHIY SIKCE
Sbjct  70   YMACVCYGFFLMLGSIGFRASLFFVRHIYHSIKCE  104



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  466  ASVWGHKIYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHEWWWRSVLCGGSTGVFI  525

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GYCLYYY+ARSDM+GFMQTSFFFGYM C+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  526  FGYCLYYYFARSDMNGFMQTSFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  585



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAF  VALTYFQLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  472  ASVWGHQIYTIYSILFIVFIILLIVTAFGNVALTYFQLAAEDHEWWWRSFLCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC+++Y+ARSDMSGFMQTSFFFGYMAC+CY FFLMLG V FRA+L FVRHIYRS+KCE
Sbjct  532  YGYCMFFYHARSDMSGFMQTSFFFGYMACICYGFFLMLGTVSFRASLIFVRHIYRSLKCE  591



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  466  ASLWGHKIYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHQWWWRSVLCGGSTGVFI  525

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GYC+YYY+ARSDM+GFMQTSFFFGYM C+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  526  FGYCVYYYFARSDMTGFMQTSFFFGYMTCICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  585



>ref|XP_006849485.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
 gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRS L GGSTG FI
Sbjct  472  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSLLYGGSTGFFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GYCLYYYY RSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIYRSIKCE
Sbjct  532  FGYCLYYYYVRSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLLFVRHIYRSIKCE  591



>ref|XP_009615620.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
tomentosiformis]
Length=557

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIY+ILFIVFI+L+I TAFITVALTYFQLAAEDHKWWWRSFL GGST +FI
Sbjct  438  ESVWGQKIYTIYTILFIVFILLLIVTAFITVALTYFQLAAEDHKWWWRSFLYGGSTSIFI  497

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFR++L FVRHIYRSIKCE
Sbjct  498  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  557



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS  CGGSTGLF+
Sbjct  470  ASVWGHKIYTIYSILFIVFIILIIVTAFITIALTYFQLAIEDHEWWWRSVFCGGSTGLFV  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ARSDM+G MQTSFFFGYMACVCY FFLMLG+VG+RA+L FVRHIYR+IKCE
Sbjct  530  YGYCYYYYFARSDMTGLMQTSFFFGYMACVCYGFFLMLGSVGYRASLLFVRHIYRAIKCE  589



>ref|XP_002963357.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
 gb|EFJ35228.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
Length=589

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS  CGGSTGLF+
Sbjct  470  ASVWGHKIYTIYSILFIVFIILIIVTAFITIALTYFQLAIEDHEWWWRSVFCGGSTGLFV  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ARSDM+G MQTSFFFGYMACVCY FFLMLG+VG+RA+L FVRHIYR+IKCE
Sbjct  530  YGYCYYYYFARSDMTGLMQTSFFFGYMACVCYGFFLMLGSVGYRASLLFVRHIYRAIKCE  589



>ref|XP_009615619.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIY+ILFIVFI+L+I TAFITVALTYFQLAAEDHKWWWRSFL GGST +FI
Sbjct  444  ESVWGQKIYTIYTILFIVFILLLIVTAFITVALTYFQLAAEDHKWWWRSFLYGGSTSIFI  503

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFR++L FVRHIYRSIKCE
Sbjct  504  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  563



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT Y ILFIVFIIL+I TAFITVALTYFQLAAEDH WWWRSFLCGGSTGLF+
Sbjct  470  ASVWGHRIYTTYVILFIVFIILLIITAFITVALTYFQLAAEDHGWWWRSFLCGGSTGLFM  529

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC Y+Y A+SDMSG MQTSFFFGYMAC+CY FFLMLGA+GF A+LFFVRHIYRSIKCE
Sbjct  530  YAYCFYFYSAQSDMSGLMQTSFFFGYMACICYGFFLMLGAIGFCASLFFVRHIYRSIKCE  589



>ref|XP_009615618.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
tomentosiformis]
Length=575

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIY+ILFIVFI+L+I TAFITVALTYFQLAAEDHKWWWRSFL GGST +FI
Sbjct  456  ESVWGQKIYTIYTILFIVFILLLIVTAFITVALTYFQLAAEDHKWWWRSFLYGGSTSIFI  515

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFR++L FVRHIYRSIKCE
Sbjct  516  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  575



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIY+ILFIVFI+L+I TAFITVALTYFQLAAEDHKWWWRSFL GGST +FI
Sbjct  477  ESVWGQKIYTIYTILFIVFILLLIVTAFITVALTYFQLAAEDHKWWWRSFLYGGSTSIFI  536

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFR++L FVRHIYRSIKCE
Sbjct  537  YGYCLYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRSSLLFVRHIYRSIKCE  596



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWR+ LCGGSTG+FI
Sbjct  471  ASVWGHKVYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHEWWWRAVLCGGSTGVFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQTSFFFGYMAC+C+ FFLMLG+VGFRA+  FVRHIY+SIKCE
Sbjct  531  YGYCFYYYYARSDMSGFMQTSFFFGYMACICFGFFLMLGSVGFRASHLFVRHIYQSIKCE  590



>ref|XP_009784373.1| PREDICTED: putative phagocytic receptor 1b isoform X4 [Nicotiana 
sylvestris]
Length=495

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYSILFIVFI+L+I T+FITVALTYFQLAAEDHKWWWRSF+CGGST +FI
Sbjct  376  ESVWGQKIYTIYSILFIVFILLLIVTSFITVALTYFQLAAEDHKWWWRSFICGGSTSIFI  435

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFLMLG VGFR+++ FVRHIYRSIKCE
Sbjct  436  YSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  495



>ref|XP_009784371.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYSILFIVFI+L+I T+FITVALTYFQLAAEDHKWWWRSF+CGGST +FI
Sbjct  443  ESVWGQKIYTIYSILFIVFILLLIVTSFITVALTYFQLAAEDHKWWWRSFICGGSTSIFI  502

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFLMLG VGFR+++ FVRHIYRSIKCE
Sbjct  503  YSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  562



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWR+ LCGGSTG+FI
Sbjct  471  ASVWGHKVYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHEWWWRAVLCGGSTGVFI  530

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GYC YYYYARSDMSGFMQTSFFFGYMAC+CY FFLMLG+VGFRA+  FVRHIY+SIKCE
Sbjct  531  FGYCFYYYYARSDMSGFMQTSFFFGYMACICYGFFLMLGSVGFRASHLFVRHIYQSIKCE  590



>ref|XP_009784372.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Nicotiana 
sylvestris]
Length=550

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYSILFIVFI+L+I T+FITVALTYFQLAAEDHKWWWRSF+CGGST +FI
Sbjct  431  ESVWGQKIYTIYSILFIVFILLLIVTSFITVALTYFQLAAEDHKWWWRSFICGGSTSIFI  490

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFLMLG VGFR+++ FVRHIYRSIKCE
Sbjct  491  YSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  550



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTG F+
Sbjct  463  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGFFV  522

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSI  417
            + YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAAL FVRHIY+SI
Sbjct  523  FAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALLFVRHIYKSI  579



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            +SV GH+IYTIYSILFI+FIIL+I TAF+ VALTYFQLAAEDH WW RSFLCGGSTGLFI
Sbjct  474  SSVWGHQIYTIYSILFIIFIILLIVTAFVNVALTYFQLAAEDHDWWGRSFLCGGSTGLFI  533

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC+++Y ARSDMSGFMQTSFFFGYMAC+CY FFLMLG VGFRA+L FVRHIY SIKCE
Sbjct  534  YGYCMFFYNARSDMSGFMQTSFFFGYMACICYGFFLMLGTVGFRASLIFVRHIYHSIKCE  593



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYSILFIVFI+L+I T+FITVALTYFQLAAEDHKWWWRSF+CGGST +FI
Sbjct  476  ESVWGQKIYTIYSILFIVFILLLIVTSFITVALTYFQLAAEDHKWWWRSFICGGSTSIFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYYY RSDMSGFMQ SFFFGYMAC+CY FFLMLG VGFR+++ FVRHIYRSIKCE
Sbjct  536  YSYCLYYYYTRSDMSGFMQISFFFGYMACICYGFFLMLGTVGFRSSMLFVRHIYRSIKCE  595



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GHRIYTIYSILFIVFIIL+I TAFITVALTYFQL AEDH+WWWRSFLCGGSTG F+
Sbjct  467  ASIWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLTAEDHEWWWRSFLCGGSTGFFV  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSI  417
            + YCLYYY  RSDMSGFMQTSFFFGYMAC+CYAFFLMLG VGFRAAL FVRHIY+SI
Sbjct  527  FAYCLYYYRERSDMSGFMQTSFFFGYMACICYAFFLMLGMVGFRAALLFVRHIYKSI  583



>ref|XP_002952428.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
 gb|EFJ46571.1| hypothetical protein VOLCADRAFT_75353 [Volvox carteri f. nagariensis]
Length=554

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH++YTIYSILFIVFIIL+I TAFITVALTYFQLA EDH+WWWRSFLCGGSTG+F+
Sbjct  435  ASIWGHKVYTIYSILFIVFIILIIVTAFITVALTYFQLAVEDHRWWWRSFLCGGSTGIFV  494

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYY RSDMSGFMQTSFFFGY A VCYAFFLMLG VGFRA+L FVRHIYR+IKCE
Sbjct  495  YGYCFYYYYVRSDMSGFMQTSFFFGYNAVVCYAFFLMLGTVGFRASLLFVRHIYRAIKCE  554



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRS LCGGSTG+FI
Sbjct  467  ASVWGHKIYTIYSILFIVFIILIIVTAFITVALTYFQLAAEDHEWWWRSVLCGGSTGIFI  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
              YC+YYY ARSDMSGFMQTSFFFGYM+C+CY FFLMLG +GF A+L FVRHIY+ IKCE
Sbjct  527  LFYCIYYYRARSDMSGFMQTSFFFGYMSCICYGFFLMLGTIGFCASLLFVRHIYQLIKCE  586



>ref|XP_005650801.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26257.1| putative endosomal protein [Coccomyxa subellipsoidea C-169]
Length=607

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVF+IL++ TAFITVALTYFQLA EDH+WWWRSF+CGGSTGLFI
Sbjct  488  ASVWGHKVYTIYSILFIVFLILLVVTAFITVALTYFQLALEDHRWWWRSFMCGGSTGLFI  547

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY ARSDM G+MQTSFFFGYMACVC AFF+MLG +G+RA+L FVRHIYR+IKCE
Sbjct  548  YGYCFYYYLARSDMGGWMQTSFFFGYMACVCLAFFIMLGTIGWRASLLFVRHIYRAIKCE  607



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            AS+ GH+IYTIYSILFIVFIIL+I TAF+TVALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  473  ASIWGHKIYTIYSILFIVFIILIIVTAFVTVALTYFQLAVEDHEWWWRSVLCGGSTGIFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIK  414
            + YC+YYY+ARSDMSGFMQTSFFFGYM CVCY FFLMLG VGFRA+L FVRHIYRSIK
Sbjct  533  FFYCIYYYHARSDMSGFMQTSFFFGYMTCVCYGFFLMLGTVGFRASLLFVRHIYRSIK  590



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIY+ILFIVFIIL+I TAFITVALTY QLAAEDHKWWWRSFLCGGSTGLFI
Sbjct  473  ASVWGHRIYTIYNILFIVFIILLIVTAFITVALTYLQLAAEDHKWWWRSFLCGGSTGLFI  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYCLYYYYARSDM GFMQTSFFFGYMAC+CY  FL+LG VGF AAL F+R IY SIKCE
Sbjct  533  YGYCLYYYYARSDMDGFMQTSFFFGYMACICYGVFLVLGTVGFCAALLFIRRIYGSIKCE  592



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYS+LFIVF++L+I TAF+TVA TYFQLAAEDHKWWWRSFLCGGSTGLFI
Sbjct  479  ESVWGQKIYTIYSMLFIVFVLLLIVTAFVTVASTYFQLAAEDHKWWWRSFLCGGSTGLFI  538

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY ARS MSGFMQTSFFFGYMAC+CY FFLMLG +GFRA+L FVRHIYRSIKCE
Sbjct  539  YTYCLYYY-ARSGMSGFMQTSFFFGYMACICYGFFLMLGTIGFRASLLFVRHIYRSIKCE  597



>ref|XP_002956625.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
 gb|EFJ42227.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
Length=605

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++Y I+SIL IV++IL+I TAFIT+ALTYFQLA EDH+WWWRSFLCGGSTG+F+
Sbjct  486  ASVWGHKVYIIWSILAIVYVILIIVTAFITIALTYFQLAVEDHQWWWRSFLCGGSTGIFV  545

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQTSFFFGYM  VCY FFLMLG VG+RA+L FVRHIYR+IKCE
Sbjct  546  YGYCFYYYYARSDMSGFMQTSFFFGYMLMVCYGFFLMLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_001689987.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDP09725.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=605

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++Y I+SIL IV+IIL++ TAFIT+ALTYFQLA EDH+WWWRSFLCGGSTG+F+
Sbjct  486  ASVWGHKVYIIWSILAIVYIILIVVTAFITIALTYFQLAVEDHQWWWRSFLCGGSTGIFV  545

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQT+FFFGYMA VC+ FFLMLG VG+RA+L FVRHIYR+IKCE
Sbjct  546  YGYCFYYYYARSDMSGFMQTTFFFGYMAMVCFGFFLMLGTVGWRASLMFVRHIYRAIKCE  605



>ref|XP_010523530.1| PREDICTED: putative phagocytic receptor 1b, partial [Tarenaya 
hassleriana]
Length=277

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILFIVFIIL+I TAFITVALTYFQLAAEDH+WWWRSFLCGGSTG+FI
Sbjct  153  ASVWGHRIYTIYSILFIVFIILLIVTAFITVALTYFQLAAEDHEWWWRSFLCGGSTGMFI  212

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIK  414
            YGYC+YYYY RSDM+GFMQTSFFFGYMAC+CY FFLMLG++GFR++L FVR I+ SIK
Sbjct  213  YGYCVYYYYGRSDMTGFMQTSFFFGYMACICYGFFLMLGSIGFRSSLLFVR-IFFSIK  269



>ref|XP_010039016.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
Length=682

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  764  SVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFIy  585
            SV GHRIYTIY+ILFIVFIIL+I TAFITVALTY QLAAEDHKWWWRSFLCGGSTGLFIY
Sbjct  564  SVWGHRIYTIYNILFIVFIILLIVTAFITVALTYLQLAAEDHKWWWRSFLCGGSTGLFIY  623

Query  584  gyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            GYCLYYYYARSDM GFMQTSFFFGYMAC+CY   L+LG VGF AAL F+R IY SIKCE
Sbjct  624  GYCLYYYYARSDMDGFMQTSFFFGYMACICYGVSLVLGTVGFCAALLFIRRIYGSIKCE  682



>gb|KCW48636.1| hypothetical protein EUGRSUZ_K02294, partial [Eucalyptus grandis]
Length=526

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -3

Query  764  SVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFIy  585
            SV GHRIYTIY+ILFIVFIIL+I TAFITVALTY QLAAEDHKWWWRSFLCGGSTGLFIY
Sbjct  408  SVWGHRIYTIYNILFIVFIILLIVTAFITVALTYLQLAAEDHKWWWRSFLCGGSTGLFIY  467

Query  584  gyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            GYCLYYYYARSDM GFMQTSFFFGYMAC+CY   L+LG VGF AAL F+R IY SIKCE
Sbjct  468  GYCLYYYYARSDMDGFMQTSFFFGYMACICYGVSLVLGTVGFCAALLFIRRIYGSIKCE  526



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIILV+ TAFIT+ALTYFQLA EDH+WWWRS LCGGSTG+FI
Sbjct  495  ASVWGHKVYTIYSILFIVFIILVVVTAFITIALTYFQLAVEDHQWWWRSVLCGGSTGVFI  554

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYYYARSDM+GFMQTSFFFGYM+ +CY FFL+LG +GFRA+  FVRHIY++IKCE
Sbjct  555  YAYCFYYYYARSDMTGFMQTSFFFGYMSVICYGFFLLLGNIGFRASSLFVRHIYKAIKCE  614



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSIL IVFIILVI TAFIT+ALTYFQLA EDH+WWWRSFLCGGSTGLFI
Sbjct  505  ASVWGHKVYTIYSILCIVFIILVIVTAFITIALTYFQLAVEDHRWWWRSFLCGGSTGLFI  564

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            + YC YYY+ARSDMSGFMQTSFFF YM  +CYAFFLMLGAVG+RA+L FVRHIY +IK +
Sbjct  565  FAYCFYYYFARSDMSGFMQTSFFFCYMGMICYAFFLMLGAVGYRASLTFVRHIYSAIKSD  624



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
             SV G +IYTIYS+LFIVF++L+I T F+TVA TYFQLAAEDHKWWWRSFLCGGSTGLFI
Sbjct  476  ESVWGQKIYTIYSMLFIVFVLLLIVTVFVTVASTYFQLAAEDHKWWWRSFLCGGSTGLFI  535

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YCLYYY ARS MSGFMQTS FFGYMAC+CY FFLM G +GFRA+L FVRHIYRSIKCE
Sbjct  536  YTYCLYYY-ARSGMSGFMQTSCFFGYMACICYGFFLMFGTIGFRASLLFVRHIYRSIKCE  594



>ref|XP_002505642.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66900.1| predicted protein [Micromonas sp. RCC299]
Length=468

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIILVI TAFIT+ALTYFQLA EDH+WWWR+ LCGGSTG FI
Sbjct  349  ASVWGHKVYTIYSILFIVFIILVIVTAFITIALTYFQLAVEDHEWWWRAVLCGGSTGCFI  408

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYYYARSDMSGFMQTSFFFGYM  +CY FFLMLG +GFRA+  FV HIY++IKCE
Sbjct  409  YGYCFYYYYARSDMSGFMQTSFFFGYMWTICYGFFLMLGNIGFRASKLFVMHIYKAIKCE  468



>ref|XP_009628018.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILF+VFI+L+I TA ++VA+TYFQLAAEDH+WWWRSFLCGGSTGL++
Sbjct  436  ASVWGHRIYTIYSILFVVFILLLITTALVSVAMTYFQLAAEDHEWWWRSFLCGGSTGLYL  495

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY  YYY++RSDMSGFMQTSFFFGYMACV Y  FLMLG +GFRA L FVR +Y SIKCE
Sbjct  496  FGYSFYYYFSRSDMSGFMQTSFFFGYMACVSYGVFLMLGTIGFRACLLFVRLLYGSIKCE  555



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIYSILF+VFI+L+I TA ++VA+TYFQLAAEDH+WWWRSFLCGGSTGL++
Sbjct  473  ASVWGHRIYTIYSILFVVFILLLITTALVSVAMTYFQLAAEDHEWWWRSFLCGGSTGLYL  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY  YYY++RSDMSGFMQTSFFFGYMACV Y  FLMLG +GFRA L FVR +Y SIKCE
Sbjct  533  FGYSFYYYFSRSDMSGFMQTSFFFGYMACVSYGVFLMLGTIGFRACLLFVRLLYGSIKCE  592



>ref|XP_002973969.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
 gb|EFJ24924.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
Length=591

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILF+VFIIL+I TAFIT++LTYFQLA EDH WWWRS  CGGST  F+
Sbjct  472  ASVWGHKIYTIYSILFVVFIILIIVTAFITISLTYFQLAMEDHTWWWRSIFCGGSTAFFV  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ARSDM+G MQTSF+FGYMACVCY FFLMLG VG++A+L FVRHIY++IKCE
Sbjct  532  YGYCFYYYFARSDMTGLMQTSFYFGYMACVCYGFFLMLGTVGYQASLLFVRHIYKAIKCE  591



>ref|XP_002969094.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
 gb|EFJ30210.1| hypothetical protein SELMODRAFT_170330 [Selaginella moellendorffii]
Length=591

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILF+VFIIL+I TAFIT++LTYFQLA EDH WWWRS  CGGST  F+
Sbjct  472  ASVWGHKIYTIYSILFVVFIILIIVTAFITISLTYFQLAMEDHTWWWRSIFCGGSTAFFV  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ARSDM+G MQTSF+FGYMACVCY FFLMLG VG++A+L FVRHIY++IKCE
Sbjct  532  YGYCFYYYFARSDMTGLMQTSFYFGYMACVCYGFFLMLGTVGYQASLLFVRHIYKAIKCE  591



>ref|XP_001755694.1| predicted protein [Physcomitrella patens]
 gb|EDQ79367.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS  CGGSTGLFI
Sbjct  472  ASVWGHQIYTIYSILFIVFIILIIVTAFITIALTYFQLAIEDHEWWWRSVFCGGSTGLFI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YY+  RS M+G MQTSFF+GYM CVCY FFL+LG+VG+RA+L FVRHIYR+IKCE
Sbjct  532  YGYCFYYHRFRSGMAGLMQTSFFYGYMGCVCYGFFLLLGSVGYRASLLFVRHIYRAIKCE  591



>ref|XP_005850808.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
 gb|EFN58706.1| hypothetical protein CHLNCDRAFT_29709 [Chlorella variabilis]
Length=599

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH WWWRS +CGGST LFI
Sbjct  480  ASVWGHKVYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHSWWWRSVMCGGSTALFI  539

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YY+YARSDM+G MQ SF+FGYM  VCY FFLMLG+VGFRA+L FVRHIY++IKCE
Sbjct  540  YAYCFYYWYARSDMNGLMQASFYFGYMLMVCYGFFLMLGSVGFRASLGFVRHIYKAIKCE  599



>ref|XP_009782694.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Nicotiana 
sylvestris]
Length=555

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIY ILF+VFI+L+I TA ++VA+TYFQLAAEDH+WWWRSFLCGGSTGL++
Sbjct  436  ASVWGHRIYTIYGILFVVFILLLITTALVSVAMTYFQLAAEDHEWWWRSFLCGGSTGLYL  495

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY  YYY+ RSDMSGFMQTSFFFGYMACV Y  FLMLG VGFR+ L FVR +Y SIKCE
Sbjct  496  FGYSFYYYFLRSDMSGFMQTSFFFGYMACVSYGVFLMLGTVGFRSCLLFVRLLYGSIKCE  555



>gb|KDD75073.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=558

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILF+VF IL + TAFIT+ALTYFQLAAEDH+WWWRSFLCGGSTG+F+
Sbjct  439  ASVWGHKVYTIYSILFVVFCILCVVTAFITIALTYFQLAAEDHRWWWRSFLCGGSTGIFV  498

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGY  YYY ARSDMSGFMQ +F+FGY A VC AFFL+LG VG+RA+L FVR IYR+IKCE
Sbjct  499  YGYSFYYYLARSDMSGFMQATFYFGYNAMVCLAFFLILGYVGWRASLAFVRRIYRAIKCE  558



>gb|ACF74283.1| putative endosomal protein [Arachis hypogaea]
Length=86

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = -3

Query  665  YFQLAAEDHKWWWRSFLCGGSTGLFIygyclyyyYARSDMSGFMQTSFFFGYMACVCYAF  486
            YFQLAAEDH+WWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMAC+CY F
Sbjct  1    YFQLAAEDHEWWWRSFLCGGSTGLFIYGYCLYYYYARSDMSGFMQTSFFFGYMACICYGF  60

Query  485  FLMLGAVGFRAALFFVRHIYRSIKCE  408
            FLMLG+VGFRA+L FVRHIYRSIKCE
Sbjct  61   FLMLGSVGFRASLLFVRHIYRSIKCE  86



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYTIY ILF+VFI+L+I TA ++VA+TYFQLAAEDH+WWWRSFLCGGSTGL++
Sbjct  473  ASVWGHRIYTIYGILFVVFILLLITTALVSVAMTYFQLAAEDHEWWWRSFLCGGSTGLYL  532

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY  YYY+ RSDMSGFMQTSFFFGYMACV Y  FLMLG VGFR+ L FVR +Y SIKCE
Sbjct  533  FGYSFYYYFLRSDMSGFMQTSFFFGYMACVSYGVFLMLGTVGFRSCLLFVRLLYGSIKCE  592



>ref|XP_001783681.1| predicted protein [Physcomitrella patens]
 gb|EDQ51511.1| predicted protein [Physcomitrella patens]
Length=586

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH+IYTIYSILFIVFIIL+I TAFIT+ALTYFQLA EDH+WWWRS  CGGSTG+FI
Sbjct  467  ASVWGHKIYTIYSILFIVFIILIIVTAFITIALTYFQLAVEDHEWWWRSVFCGGSTGMFI  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            YGYC YYY+ RS M G MQ SFF+GYM CVCY FFLMLG+VG+RA+L FVR+IYR+IKCE
Sbjct  527  YGYCFYYYHIRSGMVGLMQASFFYGYMGCVCYGFFLMLGSVGYRASLLFVRNIYRAIKCE  586



>ref|XP_007512838.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17438.1| predicted protein [Bathycoccus prasinos]
Length=632

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH++YTIYSILFIVFIIL+I TAFI VALTYFQLAAEDH WWWRS  CGGSTG+FI
Sbjct  513  ASVWGHKVYTIYSILFIVFIILIIVTAFICVALTYFQLAAEDHAWWWRSVFCGGSTGIFI  572

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
             GYC YYY ARSDMSGFMQTSFFFGYM+ +CY FFLMLG VGFRA+  FV+HIY++IK +
Sbjct  573  LGYCFYYYEARSDMSGFMQTSFFFGYMSIICYGFFLMLGNVGFRASSLFVKHIYKAIKSD  632



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT YS LFI+FI L+I TA IT  LT+ QLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  468  ASVWGHRIYTFYSFLFIIFITLLIVTALITATLTHLQLAAEDHRWWWRSFLCGGSTGLFI  527

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYYYA SDMSGFMQTSF FGYMAC+ +  FLMLG VG+ AAL FVRH+Y SIKCE
Sbjct  528  YAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFLMLGTVGYLAALRFVRHVYGSIKCE  587

Query  407  *AARHPV  387
             A   P+
Sbjct  588  WAVSSPL  594



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT YS LFI+FI L+I TA IT  LT+ QLAAEDH+WWWRSFLCGGSTGLFI
Sbjct  499  ASVWGHRIYTFYSFLFIIFITLLIVTALITATLTHLQLAAEDHRWWWRSFLCGGSTGLFI  558

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYYYA SDMSGFMQTSF FGYMAC+ +  FLMLG VG+ AAL FVRH+Y SIKCE
Sbjct  559  YAYCFYYYYALSDMSGFMQTSFIFGYMACISFGCFLMLGTVGYLAALRFVRHVYGSIKCE  618

Query  407  *AARHPV  387
             A   P+
Sbjct  619  WAVSSPL  625



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT+Y ILF+VFI+L+I TA +++A+TY QLAAEDH+WWWRSFLCGGSTGL+I
Sbjct  472  ASVWGHRIYTVYGILFVVFILLLITTALVSIAMTYIQLAAEDHEWWWRSFLCGGSTGLYI  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FLMLG VGF A L FVR +Y  IKCE
Sbjct  532  FGYSIYYYFSRSDMNGFMQTSFFFGYMACVSYGVFLMLGTVGFHACLLFVRLLYGCIKCE  591



>ref|XP_011003771.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Populus euphratica]
Length=547

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT YS LFI+FI L+I TA IT  LT+ QLAAEDH WWWRSFLCGGSTGLFI
Sbjct  428  ASVWGHRIYTFYSFLFIIFISLLIVTALITATLTHLQLAAEDHSWWWRSFLCGGSTGLFI  487

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC +YYYAR++MSGFMQTSF FGYMACV +  FLMLG VG+ AAL FVRH+Y SIKCE
Sbjct  488  YAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFLMLGTVGYLAALRFVRHVYGSIKCE  547



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GHRIYT YS LFI+FI L+I TA IT  LT+ QLAAEDH WWWRSFLCGGSTGLFI
Sbjct  467  ASVWGHRIYTFYSFLFIIFISLLIVTALITATLTHLQLAAEDHSWWWRSFLCGGSTGLFI  526

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC +YYYAR++MSGFMQTSF FGYMACV +  FLMLG VG+ AAL FVRH+Y SIKCE
Sbjct  527  YAYCFHYYYARTEMSGFMQTSFMFGYMACVSFGCFLMLGTVGYLAALRFVRHVYGSIKCE  586



>ref|XP_010322125.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=560

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV G+RIYTIY ILF+VFI+L+I TA +++A+TY QLAAEDH+WWWRSFLCGGSTGL++
Sbjct  441  ASVWGYRIYTIYGILFVVFILLLITTALVSIAMTYIQLAAEDHEWWWRSFLCGGSTGLYL  500

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FLMLG VGF A L FVR +Y  IKCE
Sbjct  501  FGYSMYYYFSRSDMNGFMQTSFFFGYMACVSYGVFLMLGTVGFHACLLFVRLLYGCIKCE  560



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV G+RIYTIY ILF+VFI+L+I TA +++A+TY QLAAEDH+WWWRSFLCGGSTGL++
Sbjct  472  ASVWGYRIYTIYGILFVVFILLLITTALVSIAMTYIQLAAEDHEWWWRSFLCGGSTGLYL  531

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            +GY +YYY++RSDM+GFMQTSFFFGYMACV Y  FLMLG VGF A L FVR +Y  IKCE
Sbjct  532  FGYSMYYYFSRSDMNGFMQTSFFFGYMACVSYGVFLMLGTVGFHACLLFVRLLYGCIKCE  591



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWRSFLCGGSTGLFI  588
            ASV GH IYTI SILFIVFIIL+I TAF+TV+LTYFQL AED+ WWWR+FL GGSTG FI
Sbjct  465  ASVWGHSIYTISSILFIVFIILIIVTAFVTVSLTYFQLVAEDYHWWWRAFLYGGSTGAFI  524

Query  587  ygyclyyyYARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            Y YC YYY++ S+MSGFMQ SFFFGYM+ +CY FFLMLG VGFRAAL FVRHIYR+IKCE
Sbjct  525  YVYCFYYYHSLSNMSGFMQASFFFGYMSAICYGFFLMLGMVGFRAALVFVRHIYRAIKCE  584



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 112/171 (65%), Gaps = 51/171 (30%)
 Frame = -3

Query  767  ASVXGHRIYTIYSilfivfiilvIGTAFITVALTYFQLAAEDHKWWWR------------  624
            ASV GH+IYTIYSILFIVFIIL+I TAF  VALTYFQLAAEDH+WWWR            
Sbjct  512  ASVWGHQIYTIYSILFIVFIILLIVTAFGNVALTYFQLAAEDHEWWWRYVLCNTECPLYF  571

Query  623  ---------------------------------------SFLCGGSTGLFIygyclyyyY  561
                                                   SFLCGGSTGLFIYGYC+++Y+
Sbjct  572  LCLFIRNSTMKKTNQCYGNTHSFHSNTVTLACRRGSKLTSFLCGGSTGLFIYGYCMFFYH  631

Query  560  ARSDMSGFMQTSFFFGYMACVCYAFFLMLGAVGFRAALFFVRHIYRSIKCE  408
            ARSDMSGFMQTSFFFGYMAC+CY FFLMLG V FRA+L FVRHIYRS+KCE
Sbjct  632  ARSDMSGFMQTSFFFGYMACICYGFFLMLGTVSFRASLIFVRHIYRSLKCE  682



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100