BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007H24

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763074.1|  PREDICTED: trafficking protein particle comp...    242   3e-73   Nicotiana sylvestris
ref|XP_009790216.1|  PREDICTED: trafficking protein particle comp...    235   2e-72   Nicotiana sylvestris
ref|XP_009605892.1|  PREDICTED: trafficking protein particle comp...    237   5e-72   
ref|XP_006361038.1|  PREDICTED: trafficking protein particle comp...    233   6e-70   Solanum tuberosum [potatoes]
ref|XP_010327033.1|  PREDICTED: trafficking protein particle comp...    229   8e-70   
ref|XP_004248116.1|  PREDICTED: trafficking protein particle comp...    229   1e-68   Solanum lycopersicum
emb|CDO99569.1|  unnamed protein product                                228   4e-68   Coffea canephora [robusta coffee]
ref|XP_002269604.1|  PREDICTED: trafficking protein particle comp...    214   8e-63   Vitis vinifera
ref|XP_006384022.1|  hypothetical protein POPTR_0004s04060g             202   2e-59   
ref|XP_011086106.1|  PREDICTED: trafficking protein particle comp...    202   3e-58   Sesamum indicum [beniseed]
ref|XP_002305809.2|  hypothetical protein POPTR_0004s04060g             202   5e-58   
ref|XP_007025671.1|  Uncharacterized protein TCM_029905                 198   1e-56   
ref|XP_008225054.1|  PREDICTED: trafficking protein particle comp...    197   3e-56   Prunus mume [ume]
ref|XP_008225055.1|  PREDICTED: trafficking protein particle comp...    197   4e-56   Prunus mume [ume]
ref|XP_010100548.1|  hypothetical protein L484_012103                   196   9e-56   
gb|EYU43414.1|  hypothetical protein MIMGU_mgv1a006364mg                196   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_008383772.1|  PREDICTED: trafficking protein particle comp...    195   2e-55   Malus domestica [apple tree]
gb|KDO75902.1|  hypothetical protein CISIN_1g013275mg                   192   2e-55   Citrus sinensis [apfelsine]
ref|XP_008345883.1|  PREDICTED: probable trafficking protein part...    188   3e-55   
ref|XP_009335677.1|  PREDICTED: trafficking protein particle comp...    194   5e-55   Pyrus x bretschneideri [bai li]
gb|KHN10017.1|  UPF0533 protein C5orf44 like                            187   9e-55   Glycine soja [wild soybean]
ref|XP_002519036.1|  expressed protein, putative                        193   1e-54   Ricinus communis
ref|XP_006467831.1|  PREDICTED: trafficking protein particle comp...    192   2e-54   Citrus sinensis [apfelsine]
ref|XP_006467830.1|  PREDICTED: trafficking protein particle comp...    192   3e-54   Citrus sinensis [apfelsine]
ref|XP_006449307.1|  hypothetical protein CICLE_v10015324mg             192   3e-54   
gb|KDP20945.1|  hypothetical protein JCGZ_21416                         191   4e-54   Jatropha curcas
ref|XP_008806523.1|  PREDICTED: trafficking protein particle comp...    190   1e-53   Phoenix dactylifera
ref|XP_010272687.1|  PREDICTED: trafficking protein particle comp...    190   2e-53   Nelumbo nucifera [Indian lotus]
gb|KJB66695.1|  hypothetical protein B456_010G152800                    189   4e-53   Gossypium raimondii
ref|XP_004293599.2|  PREDICTED: trafficking protein particle comp...    189   5e-53   Fragaria vesca subsp. vesca
gb|KJB66697.1|  hypothetical protein B456_010G152800                    188   5e-53   Gossypium raimondii
gb|KJB66698.1|  hypothetical protein B456_010G152800                    188   5e-53   Gossypium raimondii
gb|KJB66693.1|  hypothetical protein B456_010G152800                    188   5e-53   Gossypium raimondii
gb|KJB66692.1|  hypothetical protein B456_010G152800                    188   6e-53   Gossypium raimondii
gb|KJB66699.1|  hypothetical protein B456_010G152800                    188   7e-53   Gossypium raimondii
gb|KJB66694.1|  hypothetical protein B456_010G152800                    188   8e-53   Gossypium raimondii
ref|XP_010241986.1|  PREDICTED: trafficking protein particle comp...    188   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_007159315.1|  hypothetical protein PHAVU_002G2277000g            185   1e-52   Phaseolus vulgaris [French bean]
ref|XP_003542760.1|  PREDICTED: trafficking protein particle comp...    187   2e-52   Glycine max [soybeans]
gb|KHN07272.1|  UPF0533 protein C5orf44 like                            180   3e-52   Glycine soja [wild soybean]
ref|XP_010545059.1|  PREDICTED: trafficking protein particle comp...    186   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_004505040.1|  PREDICTED: UPF0533 protein C5orf44 homolog         186   7e-52   Cicer arietinum [garbanzo]
ref|XP_007211856.1|  hypothetical protein PRUPE_ppa004769mg             187   7e-52   
gb|KHG04640.1|  Uncharacterized protein F383_28963                      186   8e-52   Gossypium arboreum [tree cotton]
gb|KDO75900.1|  hypothetical protein CISIN_1g013275mg                   185   1e-51   Citrus sinensis [apfelsine]
ref|XP_010918425.1|  PREDICTED: trafficking protein particle comp...    185   1e-51   
ref|XP_010918423.1|  PREDICTED: trafficking protein particle comp...    185   1e-51   Elaeis guineensis
ref|XP_010918426.1|  PREDICTED: trafficking protein particle comp...    185   1e-51   Elaeis guineensis
gb|KDO75899.1|  hypothetical protein CISIN_1g013275mg                   184   2e-51   Citrus sinensis [apfelsine]
ref|XP_010052332.1|  PREDICTED: trafficking protein particle comp...    184   2e-51   Eucalyptus grandis [rose gum]
gb|EPS73866.1|  hypothetical protein M569_00885                         179   1e-50   Genlisea aurea
ref|XP_003529314.1|  PREDICTED: trafficking protein particle comp...    181   5e-50   Glycine max [soybeans]
ref|XP_006583814.1|  PREDICTED: trafficking protein particle comp...    181   5e-50   
ref|XP_010506845.1|  PREDICTED: trafficking protein particle comp...    180   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004172402.1|  PREDICTED: UPF0533 protein C5orf44-like            175   8e-50   
ref|XP_008442355.1|  PREDICTED: trafficking protein particle comp...    179   2e-49   Cucumis melo [Oriental melon]
ref|XP_006293426.1|  hypothetical protein CARUB_v10025351mg             179   2e-49   Capsella rubella
ref|XP_006390324.1|  hypothetical protein EUTSA_v10018568mg             179   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010413113.1|  PREDICTED: trafficking protein particle comp...    178   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010507826.1|  PREDICTED: trafficking protein particle comp...    178   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010686533.1|  PREDICTED: trafficking protein particle comp...    178   7e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010241985.1|  PREDICTED: trafficking protein particle comp...    179   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010241984.1|  PREDICTED: trafficking protein particle comp...    179   1e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010241983.1|  PREDICTED: trafficking protein particle comp...    179   1e-48   Nelumbo nucifera [Indian lotus]
gb|KJB69490.1|  hypothetical protein B456_011G026200                    176   3e-48   Gossypium raimondii
ref|NP_566117.1|  uncharacterized protein                               176   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142490.1|  PREDICTED: trafficking protein particle comp...    176   4e-48   Brassica rapa
emb|CDX80144.1|  BnaA05g00120D                                          176   4e-48   
ref|XP_009335614.1|  PREDICTED: trafficking protein particle comp...    176   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_004146594.1|  PREDICTED: UPF0533 protein C5orf44-like            175   7e-48   Cucumis sativus [cucumbers]
ref|XP_002880336.1|  hypothetical protein ARALYDRAFT_483987             172   7e-47   
gb|KJB66700.1|  hypothetical protein B456_010G152800                    173   7e-47   Gossypium raimondii
ref|XP_009395861.1|  PREDICTED: trafficking protein particle comp...    171   2e-46   
gb|KEH31093.1|  UPF0533 C5orf44-like protein                            169   1e-45   Medicago truncatula
gb|AFK36098.1|  unknown                                                 169   1e-45   Medicago truncatula
emb|CDY53029.1|  BnaC04g00010D                                          170   2e-45   Brassica napus [oilseed rape]
ref|XP_006827801.1|  hypothetical protein AMTR_s00009p00267300          168   5e-45   
gb|KJB66696.1|  hypothetical protein B456_010G152800                    166   1e-44   Gossypium raimondii
ref|XP_002466999.1|  hypothetical protein SORBIDRAFT_01g018120          164   8e-44   Sorghum bicolor [broomcorn]
gb|EEE51219.1|  hypothetical protein OsJ_32047                          163   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763075.1|  PREDICTED: trafficking protein particle comp...    162   3e-43   Nicotiana sylvestris
gb|AAM93677.1|  unknown protein                                         163   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003637387.1|  hypothetical protein MTR_084s0010                  161   1e-42   
ref|XP_008664798.1|  PREDICTED: trafficking protein particle comp...    161   1e-42   
ref|XP_006662480.1|  PREDICTED: probable trafficking protein part...    157   4e-42   
ref|XP_003574132.1|  PREDICTED: trafficking protein particle comp...    159   6e-42   Brachypodium distachyon [annual false brome]
ref|XP_004982719.1|  PREDICTED: trafficking protein particle comp...    157   3e-41   Setaria italica
dbj|BAJ96281.1|  predicted protein                                      157   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011027875.1|  PREDICTED: trafficking protein particle comp...    154   5e-40   Populus euphratica
ref|XP_011027876.1|  PREDICTED: trafficking protein particle comp...    153   1e-39   Populus euphratica
ref|XP_008345884.1|  PREDICTED: probable trafficking protein part...    138   2e-36   
ref|XP_008664799.1|  PREDICTED: trafficking protein particle comp...    142   2e-35   
ref|XP_006594322.1|  PREDICTED: trafficking protein particle comp...    139   1e-34   
ref|XP_001756136.1|  predicted protein                                  137   1e-33   
gb|KDO75901.1|  hypothetical protein CISIN_1g013275mg                   126   4e-30   Citrus sinensis [apfelsine]
ref|XP_010052333.1|  PREDICTED: trafficking protein particle comp...    120   4e-28   Eucalyptus grandis [rose gum]
gb|EMT05872.1|  hypothetical protein F775_31346                         117   1e-26   
gb|KHG23067.1|  hypothetical protein F383_05884                         112   3e-25   Gossypium arboreum [tree cotton]
gb|EMS52639.1|  hypothetical protein TRIUR3_28510                       116   3e-25   Triticum urartu
gb|KEH31094.1|  UPF0533 C5orf44-like protein                            111   1e-24   Medicago truncatula
ref|XP_002962093.1|  hypothetical protein SELMODRAFT_76214              110   1e-24   
ref|XP_004982718.1|  PREDICTED: trafficking protein particle comp...    103   1e-21   
ref|XP_002970996.1|  hypothetical protein SELMODRAFT_95233            98.6    3e-20   
ref|XP_002962090.1|  hypothetical protein SELMODRAFT_77366            79.0    8e-14   
ref|NP_001064971.1|  Os10g0498800                                     72.0    5e-13   
gb|KCW76267.1|  hypothetical protein EUGRSUZ_D00641                   74.3    5e-12   Eucalyptus grandis [rose gum]
ref|NP_001129809.1|  Protein C56C10.7, isoform c                      71.2    2e-11   Caenorhabditis elegans [roundworm]
ref|XP_005646244.1|  DUF974-domain-containing protein                 72.4    3e-11   Coccomyxa subellipsoidea C-169
ref|NP_741009.1|  Protein C56C10.7, isoform a                         71.6    4e-11   Caenorhabditis elegans [roundworm]
pir||T15846  hypothetical protein C56C10.7 - Caenorhabditis elegans   71.6    5e-11   Caenorhabditis elegans [roundworm]
ref|NP_741010.1|  Protein C56C10.7, isoform b                         71.2    6e-11   
ref|XP_009142491.1|  PREDICTED: trafficking protein particle comp...  70.9    8e-11   Brassica rapa
gb|EYC08018.1|  hypothetical protein Y032_0068g254                    68.9    8e-11   Ancylostoma ceylanicum
gb|ACO10463.1|  UPF0533 protein                                       70.9    9e-11   Caligus rogercresseyi
emb|CAD28498.1|  hypothetical protein                                 68.6    1e-10   Homo sapiens [man]
sp|A8WX89.2|TPC13_CAEBR  RecName: Full=Probable trafficking prote...  70.5    1e-10   Caenorhabditis briggsae
gb|ETN71012.1|  hypothetical protein NECAME_04707                     70.5    1e-10   Necator americanus
gb|EAW51347.1|  hypothetical protein FLJ13611, isoform CRA_e          68.2    1e-10   Homo sapiens [man]
ref|XP_002630382.1|  Hypothetical protein CBG04321                    70.5    1e-10   Caenorhabditis briggsae
ref|XP_009060066.1|  hypothetical protein LOTGIDRAFT_106290           70.1    1e-10   Lottia gigantea
ref|XP_003113407.1|  hypothetical protein CRE_26256                   69.7    2e-10   Caenorhabditis remanei
gb|EGT36424.1|  hypothetical protein CAEBREN_15251                    68.9    3e-10   Caenorhabditis brenneri
ref|XP_004932145.1|  PREDICTED: trafficking protein particle comp...  68.9    4e-10   Bombyx mori [silk moth]
gb|EYC08017.1|  hypothetical protein Y032_0068g254                    68.9    4e-10   Ancylostoma ceylanicum
ref|XP_007890312.1|  PREDICTED: trafficking protein particle comp...  68.9    5e-10   Callorhinchus milii [Australian ghost shark]
gb|EYC08019.1|  hypothetical protein Y032_0068g254                    68.9    5e-10   Ancylostoma ceylanicum
gb|AAH59537.1|  Zgc:73187                                             68.6    5e-10   Danio rerio [leopard danio]
ref|XP_007890309.1|  PREDICTED: trafficking protein particle comp...  68.6    5e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_005301063.1|  PREDICTED: trafficking protein particle comp...  68.6    5e-10   Chrysemys picta bellii
ref|NP_955832.2|  trafficking protein particle complex subunit 13...  68.6    5e-10   Danio rerio [leopard danio]
ref|XP_005155617.1|  PREDICTED: trafficking protein particle comp...  68.6    5e-10   Danio rerio [leopard danio]
ref|NP_001231572.1|  trafficking protein particle complex subunit...  68.6    5e-10   Danio rerio [leopard danio]
ref|XP_005155616.1|  PREDICTED: trafficking protein particle comp...  68.6    6e-10   Danio rerio [leopard danio]
ref|XP_010211511.1|  PREDICTED: trafficking protein particle comp...  68.6    6e-10   Tinamus guttatus
ref|XP_010211514.1|  PREDICTED: trafficking protein particle comp...  68.2    6e-10   Tinamus guttatus
ref|XP_009897159.1|  PREDICTED: trafficking protein particle comp...  68.2    7e-10   Picoides pubescens
ref|NP_001187397.1|  upf0533 protein c5orf44-like protein             68.2    7e-10   Ictalurus punctatus
ref|XP_006117075.1|  PREDICTED: trafficking protein particle comp...  68.2    7e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009987823.1|  PREDICTED: trafficking protein particle comp...  68.2    7e-10   Tauraco erythrolophus
ref|XP_004623104.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Octodon degus
ref|XP_009987824.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Tauraco erythrolophus
ref|XP_009987819.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Tauraco erythrolophus
ref|XP_009987818.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Tauraco erythrolophus
ref|XP_006117077.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006034781.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Alligator sinensis
ref|XP_009325554.1|  PREDICTED: trafficking protein particle comp...  68.2    8e-10   Pygoscelis adeliae
dbj|BAC39168.1|  unnamed protein product                              67.8    9e-10   Mus musculus [mouse]
ref|XP_010199164.1|  PREDICTED: trafficking protein particle comp...  67.8    9e-10   Colius striatus
ref|XP_009974116.1|  PREDICTED: trafficking protein particle comp...  67.8    9e-10   Tyto alba [Schleiereule]
emb|CDQ60756.1|  unnamed protein product                              67.8    9e-10   Oncorhynchus mykiss
ref|XP_005392683.1|  PREDICTED: trafficking protein particle comp...  67.8    9e-10   
ref|XP_006034779.1|  PREDICTED: trafficking protein particle comp...  67.8    9e-10   Alligator sinensis
ref|XP_009677464.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Struthio camelus australis
ref|XP_005009960.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   
ref|XP_009677462.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Struthio camelus australis
ref|XP_005493045.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Zonotrichia albicollis
ref|XP_003461647.2|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Cavia porcellus [guinea pig]
ref|XP_005392682.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   
ref|XP_005060754.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Ficedula albicollis
ref|XP_010578825.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Haliaeetus leucocephalus
ref|XP_005060757.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Ficedula albicollis
ref|XP_005493047.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Zonotrichia albicollis
ref|XP_006231948.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Rattus norvegicus [brown rat]
ref|XP_010158262.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Eurypyga helias
ref|XP_009270763.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Aptenodytes forsteri
ref|XP_010578823.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Haliaeetus leucocephalus
gb|EMC86495.1|  UPF0533 protein C5orf44 like protein                  67.8    1e-09   
ref|XP_006517800.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   
ref|XP_010393640.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Corvus cornix cornix
ref|XP_006259127.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Alligator mississippiensis
ref|NP_001087228.1|  trafficking protein particle complex subunit...  67.8    1e-09   Mus musculus [mouse]
ref|XP_010393637.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Corvus cornix cornix
ref|XP_006231946.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Rattus norvegicus [brown rat]
dbj|BAB14633.1|  unnamed protein product                              67.4    1e-09   Homo sapiens [man]
ref|XP_007255075.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   
ref|XP_010158259.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Eurypyga helias
ref|XP_009270761.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Aptenodytes forsteri
ref|XP_007255074.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   
ref|XP_010016939.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Nestor notabilis
ref|XP_010016942.1|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Nestor notabilis
ref|XP_003507986.2|  PREDICTED: trafficking protein particle comp...  67.8    1e-09   Cricetulus griseus [Chinese hamsters]
ref|NP_001006577.2|  uncharacterized protein LOC427165 isoform 2      67.4    1e-09   Gallus gallus [bantam]
ref|XP_004703626.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   
ref|XP_010334877.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Saimiri boliviensis boliviensis
ref|XP_010334876.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Saimiri boliviensis boliviensis
ref|XP_005065636.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   
ref|XP_005151970.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Melopsittacus undulatus
ref|XP_005151969.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Melopsittacus undulatus
ref|NP_079217.2|  trafficking protein particle complex subunit 13...  67.4    1e-09   Homo sapiens [man]
ref|XP_008990244.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Callithrix jacchus [common marmoset]
ref|XP_006913149.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   
ref|NP_001125291.1|  trafficking protein particle complex subunit 13  67.4    1e-09   Pongo abelii [orang utan]
ref|XP_004583800.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Ochotona princeps [southern American pika]
ref|XP_004583798.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Ochotona princeps [southern American pika]
ref|XP_007103372.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Physeter catodon
ref|XP_008990243.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Callithrix jacchus [common marmoset]
gb|AAI17129.1|  C5orf44 protein                                       67.4    1e-09   Homo sapiens [man]
ref|NP_001128904.1|  DKFZP459P083 protein                             67.4    1e-09   Pongo abelii [orang utan]
ref|NP_001087225.1|  trafficking protein particle complex subunit...  67.4    1e-09   Homo sapiens [man]
ref|XP_011369383.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Pteropus vampyrus
ref|XP_006913147.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   
ref|XP_011369386.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   
ref|XP_007486458.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Monodelphis domestica
ref|XP_005604276.1|  PREDICTED: trafficking protein particle comp...  67.4    1e-09   Equus caballus [domestic horse]
ref|XP_007176090.1|  PREDICTED: trafficking protein particle comp...  67.4    2e-09   Balaenoptera acutorostrata scammoni
ref|XP_005604275.1|  PREDICTED: trafficking protein particle comp...  67.4    2e-09   Equus caballus [domestic horse]
ref|XP_007486457.1|  PREDICTED: trafficking protein particle comp...  67.4    2e-09   Monodelphis domestica
ref|XP_004270798.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.4    2e-09   Orcinus orca [Orca]
ref|XP_004465626.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.4    2e-09   Dasypus novemcinctus
ref|XP_007176088.1|  PREDICTED: trafficking protein particle comp...  67.4    2e-09   Balaenoptera acutorostrata scammoni
ref|XP_004465624.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.4    2e-09   Dasypus novemcinctus
ref|XP_006170981.1|  PREDICTED: trafficking protein particle comp...  64.7    2e-09   Tupaia chinensis
ref|XP_007523550.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   
ref|XP_010635552.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
gb|EFB17356.1|  hypothetical protein PANDA_007966                     67.0    2e-09   Ailuropoda melanoleuca
ref|XP_007951053.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Orycteropus afer afer
gb|EGT48361.1|  hypothetical protein CAEBREN_24983                    67.0    2e-09   Caenorhabditis brenneri
ref|NP_001016427.2|  trafficking protein particle complex subunit...  67.0    2e-09   Xenopus tropicalis [western clawed frog]
ref|XP_006186138.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Camelus ferus
ref|XP_009557883.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Cuculus canorus
ref|XP_005530150.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006732586.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Leptonychotes weddellii
ref|XP_009557885.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Cuculus canorus
ref|XP_010635551.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_008689587.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Ursus maritimus [white bear]
ref|XP_004764599.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   
ref|XP_010635549.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_006762480.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Myotis davidii
ref|XP_006186136.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Camelus ferus
ref|XP_005530148.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008260507.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005617504.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Canis lupus familiaris [dogs]
ref|XP_010635548.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_005694690.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Capra hircus [domestic goat]
ref|XP_008844203.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Nannospalax galili
ref|XP_005858008.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Myotis brandtii
ref|XP_005221507.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Bos taurus [bovine]
ref|XP_010635550.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Fukomys damarensis [Damara mole rat]
ref|XP_004764597.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   
ref|XP_008844205.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Nannospalax galili
ref|NP_001095410.1|  trafficking protein particle complex subunit 13  67.0    2e-09   Bos taurus [bovine]
ref|XP_008689588.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Ursus maritimus [white bear]
ref|XP_006871047.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Chrysochloris asiatica
ref|XP_008260505.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007079955.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Panthera tigris altaica
ref|XP_010586478.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Loxodonta africana [African bush elephant]
ref|XP_004374599.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.0    2e-09   Trichechus manatus latirostris
ref|XP_005858007.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Myotis brandtii
ref|XP_010296659.1|  PREDICTED: trafficking protein particle comp...  65.1    2e-09   Balearica regulorum gibbericeps
ref|XP_004678319.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Condylura cristata
ref|XP_006197586.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Vicugna pacos
ref|XP_004016979.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.0    2e-09   Ovis aries [domestic sheep]
ref|XP_006074207.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_005858004.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   Myotis brandtii
ref|XP_004678317.1|  PREDICTED: trafficking protein particle comp...  67.0    2e-09   
ref|XP_004422931.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  67.0    2e-09   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010876367.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Esox lucius
ref|XP_004608540.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Sorex araneus [Eurasian shrew]
ref|XP_010876366.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Esox lucius
ref|XP_006982804.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Peromyscus maniculatus bairdii
ref|XP_004058833.1|  PREDICTED: UPF0533 protein C5orf44 homolog       65.1    2e-09   
ref|XP_006074205.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_006762478.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Myotis davidii
ref|XP_004402297.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  66.6    2e-09   Odobenus rosmarus divergens
ref|XP_006982806.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Peromyscus maniculatus bairdii
gb|EFX78950.1|  hypothetical protein DAPPUDRAFT_320008                66.6    2e-09   Daphnia pulex
ref|XP_005672544.1|  PREDICTED: uncharacterized protein LOC100513...  66.6    2e-09   Sus scrofa [pigs]
ref|XP_010586480.1|  PREDICTED: trafficking protein particle comp...  66.6    2e-09   Loxodonta africana [African bush elephant]
ref|XP_001846284.1|  conserved hypothetical protein                   66.6    3e-09   Culex quinquefasciatus
ref|XP_004074559.1|  PREDICTED: trafficking protein particle comp...  66.2    3e-09   Oryzias latipes [Japanese rice fish]
ref|XP_004074558.1|  PREDICTED: trafficking protein particle comp...  66.2    3e-09   Oryzias latipes [Japanese rice fish]
gb|KFO27733.1|  hypothetical protein H920_10852                       66.6    3e-09   Fukomys damarensis [Damara mole rat]
ref|XP_004884421.1|  PREDICTED: trafficking protein particle comp...  66.2    4e-09   
ref|XP_006899433.1|  PREDICTED: trafficking protein particle comp...  66.2    4e-09   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EHB02759.1|  hypothetical protein GW7_09268                        65.9    4e-09   Heterocephalus glaber [naked mole rat]
ref|XP_004884420.1|  PREDICTED: trafficking protein particle comp...  65.9    4e-09   
ref|XP_004671239.1|  PREDICTED: trafficking protein particle comp...  66.2    4e-09   Jaculus jaculus
ref|XP_010182678.1|  PREDICTED: trafficking protein particle comp...  65.9    4e-09   Mesitornis unicolor
ref|XP_006899430.1|  PREDICTED: trafficking protein particle comp...  65.9    4e-09   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004884419.1|  PREDICTED: trafficking protein particle comp...  65.9    5e-09   
gb|KFM59608.1|  hypothetical protein X975_24184                       65.9    5e-09   
gb|EMP36521.1|  UPF0533 protein C5orf44 like protein                  65.5    5e-09   
ref|XP_007059057.1|  PREDICTED: trafficking protein particle comp...  65.5    5e-09   
ref|XP_005301060.1|  PREDICTED: trafficking protein particle comp...  65.5    6e-09   
ref|XP_007059058.1|  PREDICTED: trafficking protein particle comp...  65.5    6e-09   
gb|KFQ35577.1|  Trafficking protein particle complex subunit 13       65.5    6e-09   
ref|XP_005301062.1|  PREDICTED: trafficking protein particle comp...  65.5    6e-09   
ref|XP_008062678.1|  PREDICTED: trafficking protein particle comp...  65.5    6e-09   
ref|XP_006627089.1|  PREDICTED: trafficking protein particle comp...  65.5    6e-09   
gb|KFP77866.1|  Trafficking protein particle complex subunit 13       65.1    7e-09   
dbj|BAB26869.2|  unnamed protein product                              65.1    7e-09   
ref|XP_009952910.1|  PREDICTED: trafficking protein particle comp...  65.1    8e-09   
ref|XP_005997509.1|  PREDICTED: trafficking protein particle comp...  65.1    8e-09   
ref|XP_007548870.1|  PREDICTED: trafficking protein particle comp...  65.1    8e-09   
gb|KFQ13684.1|  Trafficking protein particle complex subunit 13       65.1    8e-09   
ref|XP_003978039.1|  PREDICTED: UPF0533 protein C5orf44 homolog       65.1    8e-09   
ref|XP_009897158.1|  PREDICTED: trafficking protein particle comp...  65.1    8e-09   
ref|XP_007548872.1|  PREDICTED: trafficking protein particle comp...  65.1    8e-09   
ref|XP_009897161.1|  PREDICTED: trafficking protein particle comp...  65.1    9e-09   
dbj|BAE29111.1|  unnamed protein product                              65.1    9e-09   
ref|NP_001087229.1|  trafficking protein particle complex subunit...  65.1    9e-09   
ref|NP_080155.3|  trafficking protein particle complex subunit 13...  65.1    9e-09   
gb|KFV66110.1|  Trafficking protein particle complex subunit 13       65.1    9e-09   
ref|XP_007890308.1|  PREDICTED: trafficking protein particle comp...  65.1    9e-09   
gb|KGL76261.1|  Trafficking protein particle complex subunit 13       64.7    9e-09   
ref|XP_007890310.1|  PREDICTED: trafficking protein particle comp...  65.1    9e-09   
ref|XP_006117074.1|  PREDICTED: trafficking protein particle comp...  65.1    9e-09   
ref|XP_005319620.1|  PREDICTED: trafficking protein particle comp...  65.1    1e-08   
ref|NP_001231675.1|  uncharacterized protein LOC100513053             64.7    1e-08   
ref|XP_010211510.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009459988.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_008641765.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010137278.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009873848.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_008922947.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_005429351.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010211512.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009070426.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|EDL18504.1|  RIKEN cDNA 2410002O22, isoform CRA_c                  64.7    1e-08   
ref|XP_010003669.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_006117076.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009912525.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009882520.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_008945663.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010081977.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010169531.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009578673.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFQ74332.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_001648554.1|  AAEL004198-PA                                    64.7    1e-08   
ref|XP_009703491.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009325553.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009912524.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFZ47728.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_005506021.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009645172.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009491895.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_005009957.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_005493046.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009987816.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010578824.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009987821.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_005060756.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010393638.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KGL77381.1|  Trafficking protein particle complex subunit 13       63.2    1e-08   
gb|EOB08397.1|  UPF0533 protein                                       64.7    1e-08   
ref|XP_005060753.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010158261.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009987817.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFV19914.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_010578822.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009270762.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009270760.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009987822.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_009974107.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010393636.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_010158258.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
ref|XP_005493044.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFZ59667.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFQ94389.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFO54098.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_009096430.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...  64.7    1e-08   
gb|KFW69426.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFQ36492.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFO91500.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFM02985.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_010016938.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFR17975.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFV41849.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
gb|KFQ58528.1|  Trafficking protein particle complex subunit 13       64.7    1e-08   
ref|XP_006732587.1|  PREDICTED: trafficking protein particle comp...  64.7    1e-08   
gb|KFP51584.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFW81621.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
ref|NP_001181925.1|  uncharacterized protein LOC427165 isoform 1      64.7    1e-08   
gb|KFV89177.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFV15434.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFP78867.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFQ53354.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFP23546.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFP59786.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFQ00400.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|AAY88966.1|  hypothetical protein FLJ13611                         64.3    1e-08   
ref|XP_008421715.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
ref|XP_004091270.1|  PREDICTED: UPF0533 protein C5orf44 homolog       64.3    1e-08   
ref|XP_008421716.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
gb|KFP22649.1|  Trafficking protein particle complex subunit 13       64.3    1e-08   
gb|KFU95507.1|  UPF0533 protein C5orf44                               64.3    1e-08   
ref|XP_007616995.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
ref|XP_009677461.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
ref|XP_010016940.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
gb|ERE84808.1|  putative UPF0533 protein C5orf44 like protein         64.3    1e-08   
ref|XP_003925839.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
ref|XP_003266043.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  64.3    1e-08   
ref|XP_006034780.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
ref|XP_003266042.2|  PREDICTED: UPF0533 protein C5orf44 homolog i...  64.3    1e-08   
ref|XP_006034778.1|  PREDICTED: trafficking protein particle comp...  64.3    1e-08   
gb|ERE84810.1|  putative UPF0533 protein C5orf44 like protein         64.3    1e-08   
ref|XP_003925838.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_009677463.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|NP_001230666.1|  trafficking protein particle complex subunit...  64.3    2e-08   
ref|XP_009447364.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_009239026.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
gb|AAI42995.1|  C5orf44 protein                                       64.3    2e-08   
ref|NP_001087224.1|  trafficking protein particle complex subunit...  64.3    2e-08   
ref|XP_009239024.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
gb|KFV83545.1|  Trafficking protein particle complex subunit 13       64.3    2e-08   
gb|AAI43692.1|  C5orf44 protein                                       64.3    2e-08   
ref|XP_005065635.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_003785920.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_009239023.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_003759450.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  64.3    2e-08   
ref|XP_006259126.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_002744953.3|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_006913145.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_001381439.2|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_002744954.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_011369380.1|  PREDICTED: trafficking protein particle comp...  64.3    2e-08   
ref|XP_006913148.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_003340619.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_007486459.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_003759449.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_005366687.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
dbj|BAB29083.2|  unnamed protein product                              63.9    2e-08   
ref|XP_011369384.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_003785919.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_008248135.1|  PREDICTED: trafficking protein particle comp...  62.8    2e-08   
ref|XP_004465625.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_008062688.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_007523549.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_009557882.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_004465623.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
gb|KHN88722.1|  putative trafficking protein particle complex sub...  63.5    2e-08   
ref|XP_002190150.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_002190091.2|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.9    2e-08   
ref|XP_007457168.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
gb|AAH88172.1|  Similar to RIKEN cDNA 2410002O22 gene                 63.9    2e-08   
ref|XP_005530151.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_007951052.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_006197588.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_009557884.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_005530149.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
gb|KFO75183.1|  Trafficking protein particle complex subunit 13       63.9    2e-08   
ref|XP_006074208.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_008047964.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_005604277.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_008565990.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_004764595.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_006677987.1|  hypothetical protein BATDEDRAFT_34721            63.9    2e-08   
ref|XP_004764600.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_007103373.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_004270799.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.5    2e-08   
gb|ELR58504.1|  hypothetical protein M91_16814                        63.5    2e-08   
gb|EPQ02563.1|  UPF0533 protein like protein                          63.5    2e-08   
ref|XP_007103371.1|  PREDICTED: trafficking protein particle comp...  63.9    2e-08   
ref|XP_006762477.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_011223376.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_006197587.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_006186137.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_005221506.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_008844202.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_004374600.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.5    2e-08   
ref|XP_011223377.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
gb|ELK31200.1|  hypothetical protein MDA_GLEAN10025801                63.5    2e-08   
ref|XP_004608539.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_535257.3|  PREDICTED: trafficking protein particle complex...  63.5    2e-08   
ref|XP_003363894.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_007176089.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_006762479.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_003638975.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_011223375.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_005858003.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_001492631.2|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_005858005.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_004764598.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_004402298.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.5    2e-08   
ref|XP_006871049.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_002591374.1|  hypothetical protein BRAFLDRAFT_282065           63.5    2e-08   
ref|XP_007176087.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_005694687.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_006871048.1|  PREDICTED: trafficking protein particle comp...  63.5    2e-08   
ref|XP_004016980.1|  PREDICTED: UPF0533 protein C5orf44 homolog i...  63.5    2e-08   
ref|XP_006982803.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008565991.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008844204.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_010586481.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008689586.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_006074204.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008260506.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008274371.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_002714113.2|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_006186135.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|NP_001013930.2|  trafficking protein particle complex subunit 13  63.5    3e-08   
ref|XP_006982805.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_008501669.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_005221505.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_004678316.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_006074206.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_004703625.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_004608541.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_005858006.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   
ref|XP_003408114.1|  PREDICTED: trafficking protein particle comp...  63.5    3e-08   



>ref|XP_009763074.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Nicotiana sylvestris]
Length=450

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS+LLK EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPI H DIEL AVEVP II+
Sbjct  292  SSDGSSLLKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIAHKDIELRAVEVPSIIM  351

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  L NQTDR+LGPFEVW+SQSESLDEK VMVNG  TM L Q+EAF SSEF+L
Sbjct  352  LEKPFVVRLNLANQTDRLLGPFEVWVSQSESLDEKAVMVNGLLTMHLAQVEAFSSSEFQL  411

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+F+D +
Sbjct  412  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFIDSQ  450



>ref|XP_009790216.1| PREDICTED: trafficking protein particle complex subunit 13-like, 
partial [Nicotiana sylvestris]
Length=284

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS+L K EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPI   DIEL AVEVP II+
Sbjct  126  SSDGSSLPKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIARKDIELRAVEVPSIIM  185

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  L NQTDR+LGPFEVW+SQSESLDEK VMVNG  TM L Q+EAF SSEF+L
Sbjct  186  LEKPFVVRLNLANQTDRLLGPFEVWVSQSESLDEKAVMVNGLLTMHLAQVEAFSSSEFQL  245

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+F+D +
Sbjct  246  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFIDSQ  284



>ref|XP_009605892.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Nicotiana tomentosiformis]
Length=413

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS+L K EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPI H DIEL AVEVP III
Sbjct  255  SSNGSSLPKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIAHKDIELRAVEVPSIII  314

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  L NQTDR+LGPFEVW+SQSESLDEK VMVNG  T  L Q+EAF SSEF+L
Sbjct  315  LEKPFVVRLNLANQTDRLLGPFEVWVSQSESLDEKAVMVNGLLTTHLAQVEAFSSSEFQL  374

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+FVD +
Sbjct  375  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ  413



>ref|XP_006361038.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Solanum tuberosum]
Length=449

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS L K EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPI   DIEL AVEVP II+
Sbjct  291  SSDGSPLPKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIAQKDIELRAVEVPSIIM  350

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  L NQTDR+LGPFEVW+SQS+SLDEK +MVNG  TM L Q+EAF SSEF L
Sbjct  351  LEKPFMVRLNLANQTDRVLGPFEVWVSQSDSLDEKAIMVNGLLTMHLAQVEAFSSSEFEL  410

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+FVD +
Sbjct  411  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ  449



>ref|XP_010327033.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Solanum lycopersicum]
Length=344

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS L K EGSNVLGKLQITWRTNLGEPGRLQTQQILGS I   DIEL AVEVP II+
Sbjct  186  SSDGSPLPKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSSIAQKDIELRAVEVPSIIM  245

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  LTNQTDR+LGPFEVW+SQS+SLDEK +MVNG  TM L Q+EAF SSE  L
Sbjct  246  LEKPFMVRLNLTNQTDRVLGPFEVWVSQSDSLDEKAIMVNGLLTMHLAQVEAFSSSELEL  305

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+FVD +
Sbjct  306  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ  344



>ref|XP_004248116.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Solanum lycopersicum]
Length=446

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS L K EGSNVLGKLQITWRTNLGEPGRLQTQQILGS I   DIEL AVEVP II+
Sbjct  288  SSDGSPLPKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSSIAQKDIELRAVEVPSIIM  347

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +EKPF+VR  LTNQTDR+LGPFEVW+SQS+SLDEK +MVNG  TM L Q+EAF SSE  L
Sbjct  348  LEKPFMVRLNLTNQTDRVLGPFEVWVSQSDSLDEKAIMVNGLLTMHLAQVEAFSSSELEL  407

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+AVK G+QKI GIT+FD  EKKTYDSLLELE+FVD +
Sbjct  408  NLIAVKHGVQKITGITVFDTREKKTYDSLLELEVFVDSQ  446



>emb|CDO99569.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S +G   +K EGSNVLGK QITWRTNLGEPGRLQTQQILGSP+VH DIEL AVEVP ++I
Sbjct  279  SIQGQPQMKVEGSNVLGKFQITWRTNLGEPGRLQTQQILGSPVVHKDIELQAVEVPSLVI  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
             EKPFL+R  LTNQTDRILGPF+VWLSQS+S DEK V+VNG Q MPL ++EA  SSEF+L
Sbjct  339  FEKPFLLRLNLTNQTDRILGPFQVWLSQSDSFDEKAVLVNGLQMMPLAEVEASSSSEFQL  398

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K+GIQKI GIT+FD  EKKTY+SLLELEIFVD +
Sbjct  399  NLIATKRGIQKITGITVFDTREKKTYESLLELEIFVDSD  437



>ref|XP_002269604.1| PREDICTED: trafficking protein particle complex subunit 13 [Vitis 
vinifera]
 emb|CBI41051.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS  +K +GSNVLGKLQITWRTNLGEPGRLQTQQILGSPI   +IEL  +EVP + I
Sbjct  280  SSQGSAQMKVDGSNVLGKLQITWRTNLGEPGRLQTQQILGSPITRKEIELQVMEVPSVTI  339

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFLV   LTNQTDR +GPFEVWLSQS+S +E+ VMVNG + M LPQ+EAF S++FRL
Sbjct  340  LERPFLVHLNLTNQTDRTMGPFEVWLSQSDSREEQVVMVNGLRAMALPQVEAFCSTDFRL  399

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+QKI GIT+FD+ EK+TY+ L +LEIFVD
Sbjct  400  NLIATKLGVQKITGITVFDIREKRTYEPLPDLEIFVD  436



>ref|XP_006384022.1| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
 gb|ERP61819.1| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
Length=308

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS       SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL   EVP  I 
Sbjct  155  SSHGSA-----ESNVLGKLQITWRTNLGEPGRLQTQQILGTPITPKEIELHVAEVPSAIN  209

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PFLV   LTNQTDR LGPFEVWLSQ ++LDEK VM+NG QTM L QLEAFGS++F L
Sbjct  210  LDRPFLVHLNLTNQTDRELGPFEVWLSQDDTLDEKTVMINGLQTMELSQLEAFGSTDFYL  269

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+QKI GIT+FD  EKKTY  L +LEIFVD
Sbjct  270  NLIATKLGVQKITGITVFDKSEKKTYAPLPDLEIFVD  306



>ref|XP_011086106.1| PREDICTED: trafficking protein particle complex subunit 13 [Sesamum 
indicum]
Length=446

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  S  +K EGSN+LGKLQITWRTNLGEPGRLQTQ I+G+PI   +IEL AVE+PP II
Sbjct  288  SSPHSGQVKVEGSNILGKLQITWRTNLGEPGRLQTQHIVGNPITRKEIELDAVEIPPSII  347

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++KPFLV F+L N T+R+LGPFEVWLS+S+ L+EK VMVNG QTM L + +AF S +F+L
Sbjct  348  LDKPFLVSFQLINLTERVLGPFEVWLSESDLLNEKAVMVNGLQTMTLGEAQAFSSLKFQL  407

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K GIQKI+GIT+FD  EKKTY+SLLELEI+VD +
Sbjct  408  NLIATKHGIQKISGITVFDTVEKKTYNSLLELEIYVDSQ  446



>ref|XP_002305809.2| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
 gb|EEE86320.2| hypothetical protein POPTR_0004s04060g [Populus trichocarpa]
Length=434

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS       SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL   EVP  I 
Sbjct  281  SSHGSA-----ESNVLGKLQITWRTNLGEPGRLQTQQILGTPITPKEIELHVAEVPSAIN  335

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PFLV   LTNQTDR LGPFEVWLSQ ++LDEK VM+NG QTM L QLEAFGS++F L
Sbjct  336  LDRPFLVHLNLTNQTDRELGPFEVWLSQDDTLDEKTVMINGLQTMELSQLEAFGSTDFYL  395

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+QKI GIT+FD  EKKTY  L +LEIFVD
Sbjct  396  NLIATKLGVQKITGITVFDKSEKKTYAPLPDLEIFVD  432



>ref|XP_007025671.1| Uncharacterized protein TCM_029905 [Theobroma cacao]
 gb|EOY28293.1| Uncharacterized protein TCM_029905 [Theobroma cacao]
Length=440

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS  +K EG+N+LGK QITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  282  SSDGSAQVKVEGTNILGKFQITWRTNLGEPGRLQTQQILGNPITCKEIELQILEIPSLIN  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PF V   LTN TDR LGPFEVWLSQ+ +  EK VM+NG QTM LPQ+EA GS++F L
Sbjct  342  LDRPFSVHLNLTNHTDRELGPFEVWLSQNSAHQEKIVMINGLQTMALPQVEASGSTDFHL  401

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+QKI+GIT+ D  +KKTYDSL ++EIFV+ +
Sbjct  402  NLIATKVGVQKISGITVSDTRDKKTYDSLPDVEIFVESD  440



>ref|XP_008225054.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Prunus mume]
Length=439

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI+  DIEL  VEVP  I +
Sbjct  282  SHGSAQTKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPIIQKDIELHVVEVPSAIKL  341

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  KL N+TD+ LGPFEVWLSQ +S +EK V++NG QT+ LP++EAFGS++F LN
Sbjct  342  ERPFSLHLKLANETDKELGPFEVWLSQDDSREEKKVVINGLQTVVLPRVEAFGSTDFHLN  401

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L++ + G+Q+I GIT+F+  EK+TYD L +LEIFVD
Sbjct  402  LISTQLGVQRITGITVFNTREKQTYDPLPDLEIFVD  437



>ref|XP_008225055.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Prunus mume]
Length=434

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI+  DIEL  VEVP  I +
Sbjct  277  SHGSAQTKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPIIQKDIELHVVEVPSAIKL  336

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  KL N+TD+ LGPFEVWLSQ +S +EK V++NG QT+ LP++EAFGS++F LN
Sbjct  337  ERPFSLHLKLANETDKELGPFEVWLSQDDSREEKKVVINGLQTVVLPRVEAFGSTDFHLN  396

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L++ + G+Q+I GIT+F+  EK+TYD L +LEIFVD
Sbjct  397  LISTQLGVQRITGITVFNTREKQTYDPLPDLEIFVD  432



>ref|XP_010100548.1| hypothetical protein L484_012103 [Morus notabilis]
 gb|EXB82791.1| hypothetical protein L484_012103 [Morus notabilis]
Length=454

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS  +K EGSNVLGKLQITWR NLGEPGRLQTQQILG+PI H +IEL   EVP  + 
Sbjct  284  SSQGSAQMKVEGSNVLGKLQITWRANLGEPGRLQTQQILGNPITHKEIELHVTEVPSAVT  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF +   LTNQTD+ LGPFEVWLSQ  SL++K VM+NG Q + LP+LEAFGSS F L
Sbjct  344  LERPFSLPLNLTNQTDKELGPFEVWLSQDGSLEDKVVMLNGLQKLVLPRLEAFGSSTFTL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFV  288
            NL+A K G+QKI G+T+FD  EKK+Y+ L +LE+ V
Sbjct  404  NLIATKLGVQKITGVTVFDAIEKKSYEPLQDLEVDV  439



>gb|EYU43414.1| hypothetical protein MIMGU_mgv1a006364mg [Erythranthe guttata]
Length=447

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  S  LK +GS +LGKLQITWRTNLGEPGRLQTQ ILG+PI   +IEL AVE+PPIII
Sbjct  289  SSPDSAQLKADGSKILGKLQITWRTNLGEPGRLQTQNILGNPITRKEIELHAVEIPPIII  348

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E  FLV   L N TDR+LGPFEV LS+ +SLDE+ VMVNG QTM L ++++F S  F+L
Sbjct  349  LENSFLVSLNLVNLTDRVLGPFEVSLSEHDSLDERAVMVNGLQTMTLGEVQSFSSLSFQL  408

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A+K GIQKI+GIT++D  EKKTYDSLLELEI+VD E
Sbjct  409  NLIAIKHGIQKISGITVYDTIEKKTYDSLLELEIYVDLE  447



>ref|XP_008383772.1| PREDICTED: trafficking protein particle complex subunit 13 [Malus 
domestica]
Length=445

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   DIEL  VEVP  I +
Sbjct  288  SHGSAQGKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDIELHVVEVPSAIKL  347

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  KL N+TD+ LGPFEVWLSQ +S +EK V++NG QT+ LP++EAFGS+   LN
Sbjct  348  ERPFSLHLKLENETDKELGPFEVWLSQDDSPEEKVVVINGLQTVVLPRVEAFGSTNINLN  407

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K G+QKI GIT+F++ EKK+YD L +LEIFVD
Sbjct  408  LIATKLGVQKITGITVFNIREKKSYDPLPDLEIFVD  443



>gb|KDO75902.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=348

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  190  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  249

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  250  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  309

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+Q+I GIT+FD  EK TYDSL +LEIFVD +
Sbjct  310  NLIATKLGVQRITGITVFDKLEKITYDSLPDLEIFVDQD  348



>ref|XP_008345883.1| PREDICTED: probable trafficking protein particle complex subunit 
13 homolog isoform X1 [Malus domestica]
Length=212

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S GST  K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   DIEL  VE P  I 
Sbjct  54   TSHGSTQGKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDIELHVVEEPSAIK  113

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFL+   L N+TD+ LGPF V LSQ +S +E  V++NG QT+ LP++EAF S+ F L
Sbjct  114  LERPFLLHLNLANETDKELGPFGVCLSQDDSREENVVVINGLQTVVLPRVEAFSSTNFNL  173

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+F++ EKK+YD L ++EIFVD
Sbjct  174  NLIATKLGVQRITGITVFNIREKKSYDPLPDMEIFVD  210



>ref|XP_009335677.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pyrus x bretschneideri]
Length=445

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   D+EL  VEVP  I +
Sbjct  288  SHGSAHGKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDVELHVVEVPSAIKL  347

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +   L N+TD  LGPFEVWLSQ++S +EK V++NG QT+ LP++EAFGS+ F LN
Sbjct  348  ERPFSLHLNLANETDEELGPFEVWLSQNDSREEKVVVINGLQTVVLPRVEAFGSTNFNLN  407

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K G+Q+I GIT+F++ EKK+YD L ++EIFVD
Sbjct  408  LIATKLGVQRITGITVFNIREKKSYDPLPDMEIFVD  443



>gb|KHN10017.1| UPF0533 protein C5orf44 like [Glycine soja]
Length=214

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S+GS   K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II +
Sbjct  57   SDGSPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTPATKKEIELQVVEVPSIINL  116

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            +KPF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F LN
Sbjct  117  QKPFMLKLNLTNQTDRELGPFEVGLSQNVSYGERVVMINGLQSMVLSEVQALGSTNFHLN  176

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K GIQ+I GIT+FD  E K+Y+ L +LEIFVD
Sbjct  177  LIATKPGIQRITGITVFDTREMKSYEPLPDLEIFVD  212



>ref|XP_002519036.1| expressed protein, putative [Ricinus communis]
 gb|EEF43247.1| expressed protein, putative [Ricinus communis]
Length=434

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  719  SNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLT  540
            SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL   +VP +I ++KPF V  KLT
Sbjct  288  SNVLGKLQITWRTNLGEPGRLQTQQILGTPITRKEIELCIAKVPAVINLDKPFSVHLKLT  347

Query  539  NQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKI  360
            N TD+ LGPFEVWLSQ  S++EK V +NG QTM L QLEAFG+++F LNL+A K G+Q+I
Sbjct  348  NHTDKELGPFEVWLSQDGSVEEKAVTINGLQTMELSQLEAFGTTDFHLNLIATKLGVQRI  407

Query  359  AGITIFDMHEKKTYDSLLELEIFV  288
             GIT+FD  EKKTYD L +LEIFV
Sbjct  408  TGITVFDKSEKKTYDPLPDLEIFV  431



>ref|XP_006467831.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Citrus sinensis]
 gb|KDO75898.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=439

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  281  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  341  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+FD  EK TYDSL +LEIFVD
Sbjct  401  NLIATKLGVQRITGITVFDKLEKITYDSLPDLEIFVD  437



>ref|XP_006467830.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Citrus sinensis]
 gb|KDO75897.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=446

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  288  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  347

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  348  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  407

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+FD  EK TYDSL +LEIFVD
Sbjct  408  NLIATKLGVQRITGITVFDKLEKITYDSLPDLEIFVD  444



>ref|XP_006449307.1| hypothetical protein CICLE_v10015324mg [Citrus clementina]
 gb|ESR62547.1| hypothetical protein CICLE_v10015324mg [Citrus clementina]
Length=429

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  271  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  330

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  331  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  390

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+FD  EK TYDSL +LEIFVD
Sbjct  391  NLIATKLGVQRITGITVFDKIEKITYDSLPDLEIFVD  427



>gb|KDP20945.1| hypothetical protein JCGZ_21416 [Jatropha curcas]
Length=434

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 123/157 (78%), Gaps = 5/157 (3%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS       SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   ++EL  VEVP +I 
Sbjct  281  SSNGSA-----QSNVLGKLQITWRTNLGEPGRLQTQQILGNPITQKEVELSVVEVPSVIN  335

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++KPF V  KL N T+R LGPFEVWLSQ++SLDEK VM+NG Q++ L +L A G+++F L
Sbjct  336  LDKPFSVHLKLKNHTERELGPFEVWLSQNDSLDEKAVMINGLQSLELQELGALGTTDFHL  395

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A+K G+QKI GIT+FD  EKKTYD L +LEIFVD
Sbjct  396  NLIAIKLGVQKITGITVFDKKEKKTYDPLPDLEIFVD  432



>ref|XP_008806523.1| PREDICTED: trafficking protein particle complex subunit 13 [Phoenix 
dactylifera]
Length=447

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +G N+LGKLQITWRTNLGEPGRLQTQQI G+PI H DI++  +EVP +II+E+PFLV 
Sbjct  297  KADGGNILGKLQITWRTNLGEPGRLQTQQIHGTPISHKDIDVQVIEVPSVIILERPFLVH  356

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQTDR +GPFE+W+S+  + DEK VM+NG Q + LP +EAFGS+ F LNL+A + G
Sbjct  357  LCLTNQTDRTMGPFEIWVSRGITSDEKVVMINGIQKLVLPPVEAFGSANFSLNLIATRLG  416

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            +QKI+GIT+FD+ +KK YD L E+EIFVD
Sbjct  417  VQKISGITVFDVRQKKLYDPLPEMEIFVD  445



>ref|XP_010272687.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Nelumbo nucifera]
Length=442

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  ST +K EGSNVLGK QITW TNLGEPGRLQTQ I GSPI H +I+L  VEVP I I
Sbjct  284  SSHESTQMKVEGSNVLGKFQITWHTNLGEPGRLQTQPIFGSPISHKEIKLKIVEVPSITI  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
              +PFL+R  LTNQTDR +GPFEVW+S+    ++K + VNG   M LP +EAF S++F L
Sbjct  344  SGRPFLIRLNLTNQTDRKMGPFEVWMSKGNFHEQKAITVNGLHKMVLPHVEAFESTDFNL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NLVA + G+QKI GIT+FD+ EKK YD L +LEIFVD +
Sbjct  404  NLVASRLGVQKITGITMFDIKEKKIYDPLPDLEIFVDAD  442



>gb|KJB66695.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=430

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  272  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  331

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  332  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  391

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  392  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  430



>ref|XP_004293599.2| PREDICTED: trafficking protein particle complex subunit 13 [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   DIEL  VE+P +I +
Sbjct  288  SHGSAQTKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDIELQVVEIPSVIKL  347

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  KL N+T++ LGPFEV LSQ +S +EK V++NG QT+  P +EAFGS EF LN
Sbjct  348  ERPFSLHLKLANETEKELGPFEVSLSQDDSREEKVVVINGLQTVVFPSVEAFGSKEFHLN  407

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K G+QKI GIT+F+  E+K+YD L +LEI+VD
Sbjct  408  LIATKLGVQKITGITVFNTMERKSYDPLPDLEIYVD  443



>gb|KJB66697.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=437

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  279  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  339  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  398

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  399  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  437



>gb|KJB66698.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=432

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  274  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  333

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  334  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  393

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  394  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  432



>gb|KJB66693.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=419

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  261  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  320

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  321  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  380

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  381  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  419



>gb|KJB66692.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=440

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  282  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  342  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  401

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  402  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  440



>gb|KJB66699.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=442

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  284  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  344  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  404  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  442



>gb|KJB66694.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=441

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  283  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  342

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  343  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  402

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  403  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  441



>ref|XP_010241986.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X4 [Nelumbo nucifera]
Length=441

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 119/159 (75%), Gaps = 1/159 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K EGSN+LGK QITWR NLGEPGRLQTQ ILGSPI H +IEL  VEVP   I
Sbjct  284  SSHGSEQVKVEGSNILGKFQITWRANLGEPGRLQTQHILGSPISHKEIELQLVEVPSKTI  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
               PFL+  KL NQTD+ +GPFEVW+S   S  EK + VNG Q + LP++EA GS++F L
Sbjct  344  SGMPFLIHLKLINQTDKEMGPFEVWMSGGNS-HEKSITVNGLQKLVLPKVEASGSTDFNL  402

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A + G+QKI GIT+FD+ +KKTYD L +LEIFVD +
Sbjct  403  NLIATRLGVQKITGITVFDVRDKKTYDPLPDLEIFVDAD  441



>ref|XP_007159315.1| hypothetical protein PHAVU_002G2277000g, partial [Phaseolus vulgaris]
 gb|ESW31309.1| hypothetical protein PHAVU_002G2277000g, partial [Phaseolus vulgaris]
Length=337

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S+G    K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II +
Sbjct  180  SDGLAQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTPPTKKEIELQVVEVPSIINL  239

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            +KPF ++  LTNQTD+ LGPFEV LSQ+ S  E+ VM+NG Q+M L Q++A GS++F LN
Sbjct  240  QKPFRIKLNLTNQTDKELGPFEVSLSQNGSYGERVVMINGLQSMVLSQVQALGSTDFHLN  299

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K GIQ+I+GIT+FD  E K+Y+ L +LEIFVD
Sbjct  300  LIATKPGIQRISGITVFDTREMKSYEPLPDLEIFVD  335



>ref|XP_003542760.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Glycine max]
Length=440

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S+GS   K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II +
Sbjct  283  SDGSPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTPATKKEIELQVVEVPSIINL  342

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            +KPF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F LN
Sbjct  343  QKPFMLKLNLTNQTDRELGPFEVGLSQNVSYGERVVMINGLQSMVLSEVQALGSTNFHLN  402

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            L+A K GIQ+I GIT+FD  E K+Y+ L +LEIFVD
Sbjct  403  LIATKPGIQRITGITVFDTREMKSYEPLPDLEIFVD  438



>gb|KHN07272.1| UPF0533 protein C5orf44 like [Glycine soja]
Length=214

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+G    K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+     +IEL  VEVP II 
Sbjct  56   SSDGLPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTTATKKEIELQVVEVPSIIN  115

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++ PF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F L
Sbjct  116  LQNPFMLKLNLTNQTDRELGPFEVSLSQNVSYGERAVMINGLQSMVLSEVQALGSTNFHL  175

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K GIQ+I GIT+FD  E K+Y+ L +LEIFVD
Sbjct  176  NLIATKPGIQRITGITVFDTREMKSYEPLPDLEIFVD  212



>ref|XP_010545059.1| PREDICTED: trafficking protein particle complex subunit 13 [Tarenaya 
hassleriana]
 ref|XP_010545060.1| PREDICTED: trafficking protein particle complex subunit 13 [Tarenaya 
hassleriana]
Length=441

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ S   K  GSNVLGKLQITWRTNLGEPGRLQTQQILG+P+ H +I++  ++VP +I 
Sbjct  283  SSDVSGETKVHGSNVLGKLQITWRTNLGEPGRLQTQQILGAPVTHKEIDMCVLDVPAVIY  342

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF V   L N TDR+LGPFEV LS +ES  EK V  NG QTM LP++EAFGSS+ +L
Sbjct  343  LNRPFPVHLNLRNLTDRLLGPFEVSLSHNESQVEKAVAFNGLQTMTLPRIEAFGSSDLQL  402

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+QKIAGIT  D  EK+TY+ + ++EIFVD E
Sbjct  403  NLIATKLGVQKIAGITAVDTREKRTYELVPDIEIFVDSE  441



>ref|XP_004505040.1| PREDICTED: UPF0533 protein C5orf44 homolog [Cicer arietinum]
Length=434

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+P    DIEL  VEVP II +++PF ++
Sbjct  284  KVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTPTTKKDIELQVVEVPSIINLQRPFTLK  343

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTN TDR LGPFEV LSQ+ S  EK +M+NG Q+M L Q+EA GSS F LNL+A K G
Sbjct  344  LNLTNLTDRELGPFEVNLSQNSSSGEKVIMINGLQSMVLSQIEALGSSNFHLNLIATKPG  403

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            IQ+I GIT+FD  E K+YD L +LEIFVD
Sbjct  404  IQRITGITVFDTREVKSYDPLPDLEIFVD  432



>ref|XP_007211856.1| hypothetical protein PRUPE_ppa004769mg [Prunus persica]
 gb|EMJ13055.1| hypothetical protein PRUPE_ppa004769mg [Prunus persica]
Length=492

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI+  DIEL  VEVP  I +
Sbjct  277  SHGSAQTKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPIIRKDIELHVVEVPSAIKL  336

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  KL N+TD+ LGPFEVWLSQ +S +EK V++NG QT+ LP++EAF S++F LN
Sbjct  337  ERPFSLHLKLANETDKELGPFEVWLSQDDSREEKKVVINGLQTVVLPRVEAFDSTDFHLN  396

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEI  294
            L+A + G+Q+I GITIF+  EK+TY+ L +LE+
Sbjct  397  LIATQLGVQRITGITIFNTREKQTYEPLPDLEV  429



>gb|KHG04640.1| Uncharacterized protein F383_28963 [Gossypium arboreum]
Length=442

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 126/159 (79%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  284  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISCKEIELQILEIPSLIN  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPF+V LSQ+ + +EK VM+NG QT+ LPQ+EAFGS++F L
Sbjct  344  LDKSFLVHLNLTNHTDRELGPFDVRLSQNSAHEEKNVMINGLQTIVLPQVEAFGSTDFHL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I+GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  404  SLIATKLGVQRISGITVSDTKEKKTYDPLPDVEIFVESD  442



>gb|KDO75900.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=446

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  281  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  341  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEI  294
            NL+A K G+Q+I GIT+FD  EK TYDSL +LE+
Sbjct  401  NLIATKLGVQRITGITVFDKLEKITYDSLPDLEV  434



>ref|XP_010918425.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Elaeis guineensis]
Length=443

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K +  N+LGKLQITWRTNLGEPGRLQTQQI G+PI   DI++  VEVP +II
Sbjct  285  SSQEAGHAKVDRGNILGKLQITWRTNLGEPGRLQTQQIHGTPIARKDIDVQVVEVPSVII  344

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFLV   LT+QTDR +GPFE+W+S+S + +EK VM+NG Q + LP +EAFGS+ F L
Sbjct  345  LERPFLVHLCLTSQTDRTVGPFEIWISRSITSEEKVVMINGIQKLVLPPVEAFGSANFSL  404

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A + G+QKI+GIT+FD ++KK YD L E+EIFVD
Sbjct  405  NLIATRLGVQKISGITVFDAYQKKLYDPLPEMEIFVD  441



>ref|XP_010918423.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Elaeis guineensis]
Length=444

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K +  N+LGKLQITWRTNLGEPGRLQTQQI G+PI   DI++  VEVP +II
Sbjct  286  SSQEAGHAKVDRGNILGKLQITWRTNLGEPGRLQTQQIHGTPIARKDIDVQVVEVPSVII  345

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFLV   LT+QTDR +GPFE+W+S+S + +EK VM+NG Q + LP +EAFGS+ F L
Sbjct  346  LERPFLVHLCLTSQTDRTVGPFEIWISRSITSEEKVVMINGIQKLVLPPVEAFGSANFSL  405

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A + G+QKI+GIT+FD ++KK YD L E+EIFVD
Sbjct  406  NLIATRLGVQKISGITVFDAYQKKLYDPLPEMEIFVD  442



>ref|XP_010918426.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Elaeis guineensis]
Length=440

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K +  N+LGKLQITWRTNLGEPGRLQTQQI G+PI   DI++  VEVP +II
Sbjct  282  SSQEAGHAKVDRGNILGKLQITWRTNLGEPGRLQTQQIHGTPIARKDIDVQVVEVPSVII  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFLV   LT+QTDR +GPFE+W+S+S + +EK VM+NG Q + LP +EAFGS+ F L
Sbjct  342  LERPFLVHLCLTSQTDRTVGPFEIWISRSITSEEKVVMINGIQKLVLPPVEAFGSANFSL  401

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A + G+QKI+GIT+FD ++KK YD L E+EIFVD
Sbjct  402  NLIATRLGVQKISGITVFDAYQKKLYDPLPEMEIFVD  438



>gb|KDO75899.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=433

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  281  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M L  +EAFGS++F L
Sbjct  341  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELE  297
            NL+A K G+Q+I GIT+FD  EK TYDSL +LE
Sbjct  401  NLIATKLGVQRITGITVFDKLEKITYDSLPDLE  433



>ref|XP_010052332.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Eucalyptus grandis]
 gb|KCW76266.1| hypothetical protein EUGRSUZ_D00641 [Eucalyptus grandis]
Length=440

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +  +K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+ I   +I+L  VE P  I 
Sbjct  282  SSQSNGQMKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTAITRKEIDLRVVESPNNIN  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + + F V F L N  DR LGPFEVWLSQ+E  +++ VMVNG Q M LP++EAFGSS+F L
Sbjct  342  LGRSFSVHFNLMNLMDRDLGPFEVWLSQNELAEDRAVMVNGLQKMALPKVEAFGSSDFAL  401

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+FD+ E K+YD L + EIFVD
Sbjct  402  NLIATKLGVQRITGITVFDITEAKSYDLLPDWEIFVD  438



>gb|EPS73866.1| hypothetical protein M569_00885, partial [Genlisea aurea]
Length=338

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = -3

Query  722  GSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKL  543
            G+NVLGKLQITWRTNLGEPGRLQTQ ILG+PI H +IEL  +++P +I++EKPF V   L
Sbjct  196  GNNVLGKLQITWRTNLGEPGRLQTQNILGNPITHKEIELRTLDLPSLIVLEKPFTVSLNL  255

Query  542  TNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQK  363
             N T+R+LGPF+VW S S+S D+K VMVNG QTM L +++   S +F LNL+AVK GIQ+
Sbjct  256  INMTERVLGPFQVWQSDSDSPDDKAVMVNGFQTMTLGEVQVSSSLKFHLNLIAVKPGIQR  315

Query  362  IAGITIFDMHEKKTYDSLLELEI  294
            + GITIFD  EKKTYDSLL+LE+
Sbjct  316  VGGITIFDTIEKKTYDSLLDLEV  338



>ref|XP_003529314.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Glycine max]
Length=435

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+G    K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+     +IEL  VEVP II 
Sbjct  277  SSDGLPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTTATKKEIELQVVEVPSIIN  336

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++ PF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F L
Sbjct  337  LQNPFMLKLNLTNQTDRELGPFEVSLSQNVSYGERAVMINGLQSMVLSEVQALGSTNFHL  396

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K GIQ+I GIT+FD  E K+Y+ L +LEIFVD
Sbjct  397  NLIATKPGIQRITGITVFDTREMKSYEPLPDLEIFVD  433



>ref|XP_006583814.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Glycine max]
Length=430

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+G    K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+     +IEL  VEVP II 
Sbjct  272  SSDGLPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTTATKKEIELQVVEVPSIIN  331

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++ PF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F L
Sbjct  332  LQNPFMLKLNLTNQTDRELGPFEVSLSQNVSYGERAVMINGLQSMVLSEVQALGSTNFHL  391

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K GIQ+I GIT+FD  E K+Y+ L +LEIFVD
Sbjct  392  NLIATKPGIQRITGITVFDTREMKSYEPLPDLEIFVD  428



>ref|XP_010506845.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
Length=441

 Score =   180 bits (457),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP +I + +PFL  
Sbjct  291  KFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPAVIHLNRPFLAY  350

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LPQ+EAFGS++F+LNL+A K G
Sbjct  351  LNLTNQTDRQLGPFEVSLSQDESQMEKPVGINGLQALMLPQIEAFGSNDFQLNLIASKLG  410

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +QKIAGIT  D  EKKTY+ + E+EIFV+ +
Sbjct  411  VQKIAGITALDTREKKTYELVPEMEIFVESD  441



>ref|XP_004172402.1| PREDICTED: UPF0533 protein C5orf44-like, partial [Cucumis sativus]
Length=239

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ LK EGSN+LGKLQITWRTN+GEPGRLQTQQILGSPI   ++EL  VE+P +I +E+P
Sbjct  84   SSPLKVEGSNILGKLQITWRTNMGEPGRLQTQQILGSPITRKELELNVVEMPDVIRLERP  143

Query  563  FLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVA  384
            F +  +LT Q +R LGPFEVW+S + S ++K VMVNG Q + +P++E +GS++F LNL+A
Sbjct  144  FTLHMRLTTQIERELGPFEVWMSLNSSDEDKVVMVNGLQKVVIPRVEPYGSTDFHLNLIA  203

Query  383  VKQGIQKIAGITIFDMHEKKTYDS-LLELEIFVDPE  279
             K G+Q+IAGI +FD  EKK Y+    +LEI+VD E
Sbjct  204  TKPGVQRIAGIKVFDTREKKAYEHPSPDLEIYVDLE  239



>ref|XP_008442355.1| PREDICTED: trafficking protein particle complex subunit 13 [Cucumis 
melo]
Length=440

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ LK EGSN+LGKLQITWRTN+GEPGRLQTQQILGSPI   ++EL  VE+P +I +E+P
Sbjct  285  SSPLKVEGSNILGKLQITWRTNMGEPGRLQTQQILGSPITRKELELNVVEMPDVIRLERP  344

Query  563  FLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVA  384
            F +  +LT Q +R LGPFEVW+  + S +EK VMVNG QT+ +P++E +GS++F LNL+A
Sbjct  345  FTLHMRLTTQIERELGPFEVWMLPNGSDEEKVVMVNGLQTVVIPRVEPYGSTDFHLNLIA  404

Query  383  VKQGIQKIAGITIFDMHEKKTYDS-LLELEIFVDPE  279
             K G+Q+IAGI +FD  EKK YD  L +LEI+VD E
Sbjct  405  TKPGVQRIAGIKVFDTKEKKAYDHPLPDLEIYVDLE  440



>ref|XP_006293426.1| hypothetical protein CARUB_v10025351mg [Capsella rubella]
 gb|EOA26324.1| hypothetical protein CARUB_v10025351mg [Capsella rubella]
Length=444

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP +I 
Sbjct  286  SADVSGPTKFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPAVIH  345

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PFL    LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LP++EAFGS++F+L
Sbjct  346  LNRPFLAYLNLTNQTDRQLGPFEVSLSQDESQMEKPVGINGLQALMLPRIEAFGSNDFQL  405

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+QKIAGIT  D  EKKTY+ + E+EIFV+ +
Sbjct  406  NLIASKLGVQKIAGITALDTREKKTYELVPEMEIFVESD  444



>ref|XP_006390324.1| hypothetical protein EUTSA_v10018568mg [Eutrema salsugineum]
 gb|ESQ27610.1| hypothetical protein EUTSA_v10018568mg [Eutrema salsugineum]
Length=440

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP  I + KPF   
Sbjct  290  KLQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINVRVVEVPTAIHLNKPFSAY  349

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LP +EAFGS++F+LNL+A K G
Sbjct  350  LNLTNQTDRPLGPFEVSLSQGESQMEKPVAINGLQKLMLPGIEAFGSNDFQLNLIASKLG  409

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            +QKIAGIT FD  EKKTY+ + E+EIFV+
Sbjct  410  VQKIAGITTFDTREKKTYELVAEMEIFVE  438



>ref|XP_010413113.1| PREDICTED: trafficking protein particle complex subunit 13-like, 
partial [Camelina sativa]
Length=411

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVPP+I + +PFL  
Sbjct  261  KFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPPVIHLNRPFLAY  320

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LP++EAFGS++F+LNL+A K G
Sbjct  321  LNLTNQTDRQLGPFEVSLSQDESQMEKPVGINGLQALMLPRIEAFGSNDFQLNLIASKLG  380

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +QKIAGIT  D  EKKTY+ + E+EIFV+ +
Sbjct  381  VQKIAGITALDTREKKTYELVPEMEIFVESD  411



>ref|XP_010507826.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
 ref|XP_010507827.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Camelina sativa]
Length=444

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP +I + +PFL  
Sbjct  294  KFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPAVIHLNRPFLAF  353

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LP++EAFGS++F+LNL+A K G
Sbjct  354  LNLTNQTDRQLGPFEVSLSQDESQMEKPVGINGLQALMLPRIEAFGSNDFQLNLIASKLG  413

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +QKIAGIT  D  EKKTY+ + E+EIFV+ +
Sbjct  414  VQKIAGITALDTREKKTYELVPEMEIFVESD  444



>ref|XP_010686533.1| PREDICTED: trafficking protein particle complex subunit 13 [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ ST  + EGSN+LGKLQITWRTNLGEPGRLQTQ ILGS +   +I+L  V +P  II
Sbjct  288  SSQESTQTRTEGSNILGKLQITWRTNLGEPGRLQTQHILGSAVPRKEIDLQVVNIPLAII  347

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + KPF V+  LTNQT+R LGPFE+W S  ++  E+  MVNG QTM LP++ AF S+E  +
Sbjct  348  LHKPFEVQLSLTNQTERALGPFEIWFS-GDANGERAFMVNGLQTMALPEVRAFSSTELSM  406

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+QKI GIT+ D  EKKTY+ L +LEIFVD
Sbjct  407  NLIATKVGVQKITGITVLDSVEKKTYEPLPDLEIFVD  443



>ref|XP_010241985.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X3 [Nelumbo nucifera]
Length=525

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K EGSN+LGK QITWR NLGEPGRLQTQ ILGSPI H +IEL  VEVP   I
Sbjct  279  SSHGSEQVKVEGSNILGKFQITWRANLGEPGRLQTQHILGSPISHKEIELQLVEVPSKTI  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
               PFL+  KL NQTD+ +GPFEVW+S   S  EK + VNG Q + LP++EA GS++F L
Sbjct  339  SGMPFLIHLKLINQTDKEMGPFEVWMSGGNS-HEKSITVNGLQKLVLPKVEASGSTDFNL  397

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELE  297
            NL+A + G+QKI GIT+FD+ +KKTYD L +LE
Sbjct  398  NLIATRLGVQKITGITVFDVRDKKTYDPLPDLE  430



>ref|XP_010241984.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Nelumbo nucifera]
Length=529

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K EGSN+LGK QITWR NLGEPGRLQTQ ILGSPI H +IEL  VEVP   I
Sbjct  283  SSHGSEQVKVEGSNILGKFQITWRANLGEPGRLQTQHILGSPISHKEIELQLVEVPSKTI  342

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
               PFL+  KL NQTD+ +GPFEVW+S   S  EK + VNG Q + LP++EA GS++F L
Sbjct  343  SGMPFLIHLKLINQTDKEMGPFEVWMSGGNS-HEKSITVNGLQKLVLPKVEASGSTDFNL  401

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELE  297
            NL+A + G+QKI GIT+FD+ +KKTYD L +LE
Sbjct  402  NLIATRLGVQKITGITVFDVRDKKTYDPLPDLE  434



>ref|XP_010241983.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Nelumbo nucifera]
Length=530

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K EGSN+LGK QITWR NLGEPGRLQTQ ILGSPI H +IEL  VEVP   I
Sbjct  284  SSHGSEQVKVEGSNILGKFQITWRANLGEPGRLQTQHILGSPISHKEIELQLVEVPSKTI  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
               PFL+  KL NQTD+ +GPFEVW+S   S  EK + VNG Q + LP++EA GS++F L
Sbjct  344  SGMPFLIHLKLINQTDKEMGPFEVWMSGGNS-HEKSITVNGLQKLVLPKVEASGSTDFNL  402

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELE  297
            NL+A + G+QKI GIT+FD+ +KKTYD L +LE
Sbjct  403  NLIATRLGVQKITGITVFDVRDKKTYDPLPDLE  435



>gb|KJB69490.1| hypothetical protein B456_011G026200 [Gossypium raimondii]
Length=442

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K + S++LGKLQI+WRTNLGEPGRLQTQQILG+P    +IEL  + +P +II
Sbjct  282  SSPGSEQVKAKRSSILGKLQISWRTNLGEPGRLQTQQILGTPSSCKEIELHVLGIPSLII  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++KPF V   LTN TDR LGPFEVWLS++ S  EK+VM NG QTM LP +EAFGS++F L
Sbjct  342  LDKPFSVHLNLTNHTDRELGPFEVWLSKN-SAHEKFVMFNGLQTMALPAVEAFGSTDFHL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEI  294
            NLVA K G+Q+I+G+ +FD  EKKT++ L ++E+
Sbjct  401  NLVATKLGVQRISGLIVFDTIEKKTFEPLADVEV  434



>ref|NP_566117.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL16264.1|AF428334_1 At2g47960/T9J23.10 [Arabidopsis thaliana]
 gb|AAL67048.1| unknown protein [Arabidopsis thaliana]
 gb|AAC63650.2| expressed protein [Arabidopsis thaliana]
 gb|AAM15133.1| expressed protein [Arabidopsis thaliana]
 gb|AAM45021.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10917.1| uncharacterized protein AT2G47960 [Arabidopsis thaliana]
Length=442

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP +I 
Sbjct  284  SADVSGQTKFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPAVIH  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF     LTNQTDR LGPFEV LSQ E+  EK V +NG QT+ LP++EAFGS++F+L
Sbjct  344  LNRPFRAYLNLTNQTDRQLGPFEVSLSQDETQLEKPVGINGLQTLMLPRIEAFGSNDFQL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+QKIAGIT  D  EKKTY+ + ++EIFV+
Sbjct  404  NLIASKLGVQKIAGITALDTREKKTYELVPDMEIFVE  440



>ref|XP_009142490.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Brassica rapa]
Length=439

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GS++LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP  + 
Sbjct  281  SADVSGQTKLQGSSILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPTALH  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF     LTNQTDR LGPFEV L Q ES  EK V +NG Q + LP+LEAFGSS+F+L
Sbjct  341  LNRPFSASLNLTNQTDRQLGPFEVSLLQDESQMEKPVAINGLQKLMLPRLEAFGSSDFQL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+QKI GIT FD  EKKTY+ + E+EIFV+ +
Sbjct  401  NLIASKLGVQKIGGITTFDTREKKTYELVPEMEIFVESD  439



>emb|CDX80144.1| BnaA05g00120D [Brassica napus]
Length=439

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GS++LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP  I 
Sbjct  281  SADVSGQTKLQGSSILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPTAIH  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF     LTNQTDR LGPFEV L Q ES  EK V +NG Q + LP+LEAFGSS+F+L
Sbjct  341  LNRPFSASLNLTNQTDRQLGPFEVSLLQDESQMEKPVAINGLQKLMLPRLEAFGSSDFQL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            NL+A K G+QKI GIT FD  EKKTY+ + E+EIFV+ +
Sbjct  401  NLIASKLGVQKIGGITTFDTREKKTYELVPEMEIFVESD  439



>ref|XP_009335614.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Pyrus x bretschneideri]
Length=447

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S GS   K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   D+EL  VEVP  I +
Sbjct  288  SHGSAHGKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDVELHVVEVPSAIKL  347

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +   L N+TD  LGPFEVWLSQ++S +EK V++NG QT+ LP++EAFGS+ F LN
Sbjct  348  ERPFSLHLNLANETDEELGPFEVWLSQNDSREEKVVVINGLQTVVLPRVEAFGSTNFNLN  407

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFV  288
            L+A K G+Q+I GIT+F++ E+K++ +L  +  F+
Sbjct  408  LIATKLGVQRITGITVFNL-ERKSHTTLCRIWRFL  441



>ref|XP_004146594.1| PREDICTED: UPF0533 protein C5orf44-like [Cucumis sativus]
 gb|KGN64666.1| hypothetical protein Csa_1G073730 [Cucumis sativus]
Length=440

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ LK EGSN+LGKLQITWRTN+GEPGRLQTQQILGSPI   ++EL  VE+P +I +E+P
Sbjct  285  SSPLKVEGSNILGKLQITWRTNMGEPGRLQTQQILGSPITRKELELNVVEMPDVIRLERP  344

Query  563  FLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVA  384
            F +  +LT Q +R LGPFEVW+S + S ++K VMVNG Q + +P++E +GS++F LNL+A
Sbjct  345  FTLHMRLTTQIERELGPFEVWMSLNSSDEDKVVMVNGLQKVVIPRVEPYGSTDFHLNLIA  404

Query  383  VKQGIQKIAGITIFDMHEKKTYDS-LLELEIFVDPE  279
             K G+Q+IAGI +FD  EKK Y+    +LEI+VD E
Sbjct  405  TKPGVQRIAGIKVFDTREKKAYEHPSPDLEIYVDLE  440



>ref|XP_002880336.1| hypothetical protein ARALYDRAFT_483987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56595.1| hypothetical protein ARALYDRAFT_483987 [Arabidopsis lyrata subsp. 
lyrata]
Length=443

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GSN+LGK QITWRTNLGEPGRLQTQQILG+P+   +I +   EVP +I 
Sbjct  280  SADVSGQTKFQGSNILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVAEVPAVIH  339

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF     LTNQTDR LGPFEV LSQ ES  EK V +NG QT+ LP++EAFGS++F+L
Sbjct  340  LNRPFPAYLNLTNQTDRQLGPFEVSLSQDESQMEKPVGINGLQTLMLPRIEAFGSNDFQL  399

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFV  288
            NL+A K G+QKI+GIT  D  EKKTY+ + E+E+ V
Sbjct  400  NLIASKLGVQKISGITALDTREKKTYELVPEMEVSV  435



>gb|KJB66700.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=498

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL  +E+P +I 
Sbjct  284  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGTPISRKEIELQILEIPSLIN  343

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++K FLV   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  344  LDKSFLVHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  403

Query  395  NLVAVKQGIQKIAGITIFDMHEKKT  321
            +L+A K G+Q+I GIT+ D  EKKT
Sbjct  404  SLIATKLGVQRITGITVSDTTEKKT  428



>ref|XP_009395861.1| PREDICTED: trafficking protein particle complex subunit 13 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396623.1| PREDICTED: trafficking protein particle complex subunit 13 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397331.1| PREDICTED: trafficking protein particle complex subunit 13 [Musa 
acuminata subsp. malaccensis]
Length=445

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S+  S  ++ + S++LGK QITWRTNLGEPGRLQTQQI G+PIVH DI+L  ++VPPII+
Sbjct  287  STVESGRVRVDSSSILGKFQITWRTNLGEPGRLQTQQIYGTPIVHKDIDLHILDVPPIIV  346

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFLV   L NQT+R LGPFE++ S   S +EK  MVNG Q + LP +EAF S+   L
Sbjct  347  LERPFLVHLSLKNQTERTLGPFEIFTSPGISSEEKVAMVNGIQKLVLPPVEAFDSNIIEL  406

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            N++A + G+QKI+G+T+FD+ EKK YD L ++EIFVD
Sbjct  407  NMIAPRLGVQKISGVTVFDVREKKVYDPLPDVEIFVD  443



>gb|KEH31093.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=432

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S + S   K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II 
Sbjct  274  SLDDSAQTKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTPTTKKEIELQVVEVPSIIN  333

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PF ++  LTN T+R LGPF+V +SQ+ S  E  VM+NG Q+M L Q+EA GS+   L
Sbjct  334  LQRPFTLKLNLTNLTERELGPFKVSVSQNGSSGETAVMINGLQSMVLSQIEALGSTNIHL  393

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K GIQKI GIT+FD    K+Y+ L +LEIFVD
Sbjct  394  NLIATKPGIQKITGITVFDTRGMKSYEPLPDLEIFVD  430



>gb|AFK36098.1| unknown [Medicago truncatula]
 gb|KEH31092.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=437

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S + S   K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II 
Sbjct  279  SLDDSAQTKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTPTTKKEIELQVVEVPSIIN  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PF ++  LTN T+R LGPF+V +SQ+ S  E  VM+NG Q+M L Q+EA GS+   L
Sbjct  339  LQRPFTLKLNLTNLTERELGPFKVSVSQNGSSGETAVMINGLQSMVLSQIEALGSTNIHL  398

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K GIQKI GIT+FD    K+Y+ L +LEIFVD
Sbjct  399  NLIATKPGIQKITGITVFDTRGMKSYEPLPDLEIFVD  435



>emb|CDY53029.1| BnaC04g00010D [Brassica napus]
Length=521

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GS++LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP  I 
Sbjct  324  SADVSGQTKFQGSSILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPTTIH  383

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            + +PF     LTNQTDR LGPFEV LSQ ES  EK V +NG Q + LP+LEAFGSS+F+L
Sbjct  384  LNRPFSASLNLTNQTDRQLGPFEVSLSQDESQMEKPVAINGLQKLMLPRLEAFGSSDFQL  443

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFV  288
            NL+A K G+QKI GIT  D  EKKTY+ + E+E+ V
Sbjct  444  NLIASKLGVQKIGGITALDTREKKTYELVPEMEVSV  479



>ref|XP_006827801.1| hypothetical protein AMTR_s00009p00267300 [Amborella trichopoda]
 gb|ERM95217.1| hypothetical protein AMTR_s00009p00267300 [Amborella trichopoda]
Length=488

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  S  +K EGSN+ GKLQITWRTNLGEPGRLQTQQILGSPI H +IEL   E+P III
Sbjct  281  SSPESAQMKVEGSNIFGKLQITWRTNLGEPGRLQTQQILGSPISHKEIELQIGELPSIII  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++KPFLV   LTN T+R +GPFEV LS  ES +   V VNG   + LPQLEA  S  F L
Sbjct  341  LDKPFLVHLILTNHTERRIGPFEVSLSGDESPESNVVYVNGLWKLALPQLEALSSMNFNL  400

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSL  309
            +L+A + G+QKI+GIT+ D  EKK YDSL
Sbjct  401  SLIATRLGVQKISGITVLDAREKKIYDSL  429



>gb|KJB66696.1| hypothetical protein B456_010G152800 [Gossypium raimondii]
Length=417

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 25/159 (16%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S  S  +K EG+N+LGKLQITWRTNLGEPGRLQTQQILG+                   
Sbjct  284  ASPDSAQMKVEGTNILGKLQITWRTNLGEPGRLQTQQILGT-------------------  324

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
                  V   LTN TDR LGPFEV LSQ+ + +EK VM+NG QTM LPQ+EAFGS++F L
Sbjct  325  ------VHLNLTNHTDRELGPFEVRLSQNSAHEEKKVMINGLQTMVLPQVEAFGSTDFHL  378

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +L+A K G+Q+I GIT+ D  EKKTYD L ++EIFV+ +
Sbjct  379  SLIATKLGVQRITGITVSDTTEKKTYDPLPDVEIFVESD  417



>ref|XP_002466999.1| hypothetical protein SORBIDRAFT_01g018120 [Sorghum bicolor]
 gb|EER93997.1| hypothetical protein SORBIDRAFT_01g018120 [Sorghum bicolor]
Length=461

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPPII 
Sbjct  303  SSDEAGQTKSEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVDLRAVKVPPIIY  362

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+ F+V   LTNQTD+ +GPFEV+L+ S S +++ V+VNGPQ + LP +EAF S +F L
Sbjct  363  VERAFMVNLCLTNQTDKTVGPFEVFLAPSMSGEDRAVLVNGPQKLILPLVEAFESMKFNL  422

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  423  SMVATQLGVQKISGITMYAVQEKKYYEPLPDIEIFVDAE  461



>gb|EEE51219.1| hypothetical protein OsJ_32047 [Oryza sativa Japonica Group]
Length=402

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  S   K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPP+I 
Sbjct  244  SSGESGQTKAEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVDLRAVKVPPVIF  303

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF+V   LTNQ+D+ +GPFEV+L+ S   +EKYV+VNG Q + LP +EAF S  F L
Sbjct  304  LERPFMVNLCLTNQSDKTVGPFEVFLAPSVLDEEKYVLVNGLQKLVLPLVEAFESINFDL  363

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  364  SMVATQVGVQKISGITLYAVQEKKLYEPLSDIEIFVDAE  402



>ref|XP_009763075.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Nicotiana sylvestris]
Length=412

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+GS+LLK EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPI H DIEL AVEVP II+
Sbjct  292  SSDGSSLLKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIAHKDIELRAVEVPSIIM  351

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLP-QLEAFGSSEFR  399
            +EKPF+VR  L NQTDR+LGPFEVW+SQSESLDEK VMVNG  TM        F SS  R
Sbjct  352  LEKPFVVRLNLANQTDRLLGPFEVWVSQSESLDEKAVMVNGLLTMCWAYDCSCFFSSSCR  411

Query  398  L  396
             
Sbjct  412  F  412



>gb|AAM93677.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAP54458.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEC67253.1| hypothetical protein OsI_34196 [Oryza sativa Indica Group]
Length=473

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS  S   K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPP+I 
Sbjct  315  SSGESGQTKAEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVDLRAVKVPPVIF  374

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF+V   LTNQ+D+ +GPFEV+L+ S   +EKYV+VNG Q + LP +EAF S  F L
Sbjct  375  LERPFMVNLCLTNQSDKTVGPFEVFLAPSVLDEEKYVLVNGLQKLVLPLVEAFESINFDL  434

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  435  SMVATQVGVQKISGITLYAVQEKKLYEPLSDIEIFVDAE  473



>ref|XP_003637387.1| hypothetical protein MTR_084s0010 [Medicago truncatula]
Length=446

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 116/166 (70%), Gaps = 9/166 (5%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S + S   K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II 
Sbjct  279  SLDDSAQTKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTPTTKKEIELQVVEVPSIIN  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTM---------PLPQLE  423
            +++PF ++  LTN T+R LGPF+V +SQ+ S  E  VM+NG Q+M          L Q+E
Sbjct  339  LQRPFTLKLNLTNLTERELGPFKVSVSQNGSSGETAVMINGLQSMVMHSLWIISVLSQIE  398

Query  422  AFGSSEFRLNLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            A GS+   LNL+A K GIQKI GIT+FD    K+Y+ L +LEIFVD
Sbjct  399  ALGSTNIHLNLIATKPGIQKITGITVFDTRGMKSYEPLPDLEIFVD  444



>ref|XP_008664798.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Zea mays]
 tpg|DAA49444.2| TPA: hypothetical protein ZEAMMB73_593757 [Zea mays]
Length=461

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 119/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D+ L AV+VPPII 
Sbjct  303  SSDEAGQTKSEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVNLRAVKVPPIIY  362

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+ F+V   LTNQTD+ +GPFEV+L+ S S +++ V+VNGPQ + LP +EAF S +F L
Sbjct  363  VERAFMVNLCLTNQTDKTVGPFEVFLAPSMSGEDRAVLVNGPQKLILPLVEAFESIKFDL  422

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++V  + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  423  SMVTTQLGVQKISGITMYAVQEKKYYEPLPDIEIFVDAE  461



>ref|XP_006662480.1| PREDICTED: probable trafficking protein particle complex subunit 
13 homolog [Oryza brachyantha]
Length=317

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    DI+L  V+VPP+I +E+PF+V 
Sbjct  167  KTEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDIDLRVVKVPPVIFLERPFMVN  226

Query  551  FKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQG  372
              LTNQ+D+ +GPFEV+++ S   +EK V+VNG Q + LP +EAF S  F L++VA + G
Sbjct  227  LCLTNQSDKTVGPFEVFVAPSVPGEEKSVLVNGLQKLILPLVEAFESINFDLSMVATQVG  286

Query  371  IQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            +QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  287  VQKISGITLYAVQEKKLYEPLSDIEIFVDAE  317



>ref|XP_003574132.1| PREDICTED: trafficking protein particle complex subunit 13 [Brachypodium 
distachyon]
Length=458

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 121/159 (76%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ S+ +K EGS+VLGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPP+I 
Sbjct  300  SSDESSQIKAEGSSVLGKFQITWRTNLGEPGRLQTQNINSTPTPSKDVDLRAVKVPPVIF  359

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF+V   +TNQT + +GPFEV+L+ + S ++K V+VNG Q + LP +EAF S  F L
Sbjct  360  LERPFMVNLCVTNQTGKTVGPFEVFLASNISGEQKAVLVNGLQKLVLPLVEAFESINFDL  419

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + E+K Y+ L ++EIFVD E
Sbjct  420  SMVATQLGVQKISGITMYAVQERKYYEPLPDIEIFVDAE  458



>ref|XP_004982719.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Setaria italica]
Length=463

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K E S+ LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPPII 
Sbjct  305  SSDEAAQPKSELSSTLGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVDLRAVKVPPIIY  364

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
             E+PF+V   LTNQTD+ +GPFEV+L+ S + +E  V+VNG Q + LP +EAF S +F L
Sbjct  365  AERPFMVNLCLTNQTDKTVGPFEVFLAPSMTGEESAVLVNGLQKLILPLVEAFESIKFDL  424

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  425  SMVATQLGVQKISGITMYAVQEKKYYEPLSDIEIFVDAE  463



>dbj|BAJ96281.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+    +K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV++PP+I 
Sbjct  305  SSDEPGQIKTEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTPSKDVDLRAVKIPPVIF  364

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF+V   LTNQT++ +GPFEV+L+ S S ++K V+VNG Q + LP +EAF S  F L
Sbjct  365  LERPFMVNLCLTNQTEKTVGPFEVFLAPSVSGEQKTVLVNGLQKLVLPLVEAFESINFDL  424

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++VA + G+QKI+GIT++ + E++ Y+ L ++EIFVD E
Sbjct  425  SMVATQLGVQKISGITLYAVQEREHYEPLPDIEIFVDAE  463



>ref|XP_011027875.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Populus euphratica]
Length=439

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS       SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL   EVP  I 
Sbjct  281  SSHGSA-----ESNVLGKLQITWRTNLGEPGRLQTQQILGTPITPKEIELHVAEVPSAIN  335

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PFLV   LTNQTDR LGPFEVWLSQ ++LDEK VMVNG QTM L QLEAFG+++F L
Sbjct  336  LDRPFLVHLNLTNQTDRELGPFEVWLSQDDTLDEKTVMVNGLQTMELSQLEAFGTTDFYL  395

Query  395  NLVAVK  378
               AV 
Sbjct  396  GTFAVH  401



>ref|XP_011027876.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Populus euphratica]
Length=426

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 95/123 (77%), Gaps = 5/123 (4%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS       SNVLGKLQITWRTNLGEPGRLQTQQILG+PI   +IEL   EVP  I 
Sbjct  281  SSHGSA-----ESNVLGKLQITWRTNLGEPGRLQTQQILGTPITPKEIELHVAEVPSAIN  335

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +++PFLV   LTNQTDR LGPFEVWLSQ ++LDEK VMVNG QTM L QLEAFG+++F L
Sbjct  336  LDRPFLVHLNLTNQTDRELGPFEVWLSQDDTLDEKTVMVNGLQTMELSQLEAFGTTDFYL  395

Query  395  NLV  387
             ++
Sbjct  396  CII  398



>ref|XP_008345884.1| PREDICTED: probable trafficking protein particle complex subunit 
13 homolog isoform X2 [Malus domestica]
Length=192

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            +S GST  K EGSN+LGKLQITWRTNLGEPGRLQTQQI+G+PI   DIEL  VE P  I 
Sbjct  54   TSHGSTQGKVEGSNILGKLQITWRTNLGEPGRLQTQQIMGTPITRKDIELHVVEEPSAIK  113

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PFL+   L N+TD+ LGPF V LSQ +S +E  V++NG QT+ LP++EAF S+ F L
Sbjct  114  LERPFLLHLNLANETDKELGPFGVCLSQDDSREENVVVINGLQTVVLPRVEAFSSTNFNL  173



>ref|XP_008664799.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Zea mays]
Length=446

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 15/159 (9%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D+ L AV+VPPII 
Sbjct  303  SSDEAGQTKSEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVNLRAVKVPPIIY  362

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+ F+V   LTNQTD+ +GPFEV+L+ S S +++ V+VNGPQ               +L
Sbjct  363  VERAFMVNLCLTNQTDKTVGPFEVFLAPSMSGEDRAVLVNGPQ---------------KL  407

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            ++V  + G+QKI+GIT++ + EKK Y+ L ++EIFVD E
Sbjct  408  SMVTTQLGVQKISGITMYAVQEKKYYEPLPDIEIFVDAE  446



>ref|XP_006594322.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X2 [Glycine max]
Length=403

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            S+GS   K EGSNVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II +
Sbjct  283  SDGSPQTKVEGSNVLGKLQITWRTNLGEPGRLQTQQILGTPATKKEIELQVVEVPSIINL  342

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +KPF+++  LTNQTDR LGPFEV LSQ+ S  E+ VM+NG Q+M L +++A GS+ F L
Sbjct  343  QKPFMLKLNLTNQTDRELGPFEVGLSQNVSYGERVVMINGLQSMVLSEVQALGSTNFHL  401



>ref|XP_001756136.1| predicted protein [Physcomitrella patens]
 gb|EDQ79002.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = -3

Query  731  KXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVR  552
            K +GSN LGKL+I WRT LGEPGRLQTQQILG+P    ++ L  VE+P  I++E+PFLVR
Sbjct  367  KADGSNTLGKLEIMWRTTLGEPGRLQTQQILGNPSPRKEVSLRIVEIPSRILLERPFLVR  426

Query  551  FKLTNQTDRILGPFEVWLSQSESLD-EKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQ  375
              ++N TDR +GP ++ +SQ ++    + ++VNG  +M +PQL+   S++  L+LVA   
Sbjct  427  MSVSNHTDRTVGPLQISMSQDDAQGVPRAIVVNGLWSMTVPQLDPLASTDVNLSLVATAV  486

Query  374  GIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            G+QKI G+ + D  + K YD+L   E+FV+ E
Sbjct  487  GVQKITGVGLTDRRDGKPYDALTATEVFVESE  518



>gb|KDO75901.1| hypothetical protein CISIN_1g013275mg [Citrus sinensis]
Length=405

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S   S+ +K +GSNVLGKLQITWRTNLGEPGRLQTQQILG+ I   +IEL  VEVP ++ 
Sbjct  281  SHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVG  340

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTM  441
            I+KPFL++ KLTNQTD+  GPFE+WLSQ++S +EK VM+NG + M
Sbjct  341  IDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIM  385



>ref|XP_010052333.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Eucalyptus grandis]
Length=401

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 91/157 (58%), Gaps = 39/157 (25%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +  +K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+ I   +I+L          
Sbjct  282  SSQSNGQMKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTAITRKEIDLRV--------  333

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
                             +  P  + L +S S               LP++EAFGSS+F L
Sbjct  334  -----------------VESPNNINLGRSFS--------------ALPKVEAFGSSDFAL  362

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVD  285
            NL+A K G+Q+I GIT+FD+ E K+YD L + EIFVD
Sbjct  363  NLIATKLGVQRITGITVFDITEAKSYDLLPDWEIFVD  399



>gb|EMT05872.1| hypothetical protein F775_31346 [Aegilops tauschii]
Length=490

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+    +K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV++PP+I 
Sbjct  305  SSDEPGQMKTEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTPSKDVDLRAVKIPPVIF  364

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            +E+PF+V   LTNQT++ +GPFEV+L+ S S ++K V+VNG Q + LP +EAF S  F L
Sbjct  365  LERPFMVNLCLTNQTEKTVGPFEVFLAPSVSGEQKTVLVNGLQKLVLPLVEAFESINFDL  424



>gb|KHG23067.1| hypothetical protein F383_05884 [Gossypium arboreum]
Length=401

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 94/159 (59%), Gaps = 39/159 (25%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS GS  +K + S++LGKLQI+WRTNLGEPGRLQTQQILG+P    +IEL  + +P +II
Sbjct  282  SSPGSEQVKAKRSSILGKLQISWRTNLGEPGRLQTQQILGNPSSCKEIELQVLGIPSLII  341

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
            ++KPF                                         LP +EAFGS++F L
Sbjct  342  LDKPFSA---------------------------------------LPAVEAFGSTDFHL  362

Query  395  NLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            N+VA K G+Q I+G+ +FD  EKKT++ L ++EIFV+ +
Sbjct  363  NVVATKLGVQSISGLIVFDTKEKKTFEPLADVEIFVESD  401



>gb|EMS52639.1| hypothetical protein TRIUR3_28510 [Triticum urartu]
Length=1595

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = -3

Query  755   SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
             SS+    +K EGS++LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV++PP+I 
Sbjct  1410  SSDEPGQIKTEGSSILGKFQITWRTNLGEPGRLQTQNIHSTPTPSKDVDLRAVKIPPVIF  1469

Query  575   iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRL  396
             +E+PF+V   LTNQT++ +GPFEV+L+ S S ++K V+VNG Q + LP +EAF S  F L
Sbjct  1470  LERPFMVNLCLTNQTEKTVGPFEVFLAPSVSGEQKTVLVNGLQKLVLPLVEAFESINFDL  1529



>gb|KEH31094.1| UPF0533 C5orf44-like protein [Medicago truncatula]
Length=419

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S + S   K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+P    +IEL  VEVP II 
Sbjct  279  SLDDSAQTKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTPTTKKEIELQVVEVPSIIN  338

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQL  426
            +++PF ++  LTN T+R LGPF+V +SQ+ S  E  VM+NG Q+M +  L
Sbjct  339  LQRPFTLKLNLTNLTERELGPFKVSVSQNGSSGETAVMINGLQSMVMHSL  388



>ref|XP_002962093.1| hypothetical protein SELMODRAFT_76214 [Selaginella moellendorffii]
 gb|EFJ37353.1| hypothetical protein SELMODRAFT_76214 [Selaginella moellendorffii]
Length=439

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ +K EG+N LGKL+I WRT LGE GRLQTQQI GSP     +++    +P  I+IE+P
Sbjct  276  SSDVKLEGANALGKLEILWRTTLGETGRLQTQQINGSPTPKKPLDVKMTNLPQRILIERP  335

Query  563  FLVRFKLTNQTDRILGPFEVWLSQS-ESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLV  387
            FLVR ++TN++++  GP  V +S++ ++   + V++NG  ++ +P L    S+E  +NLV
Sbjct  336  FLVRMEVTNRSEQFTGPLRVVMSETDDNGTPRTVLMNGLLSLMVPPLAPLASTELEVNLV  395

Query  386  AVKQGIQKIAGITIFDMHEKK  324
            AV  G+Q++AGI + D  + +
Sbjct  396  AVAAGVQRVAGICLVDARDGR  416



>ref|XP_004982718.1| PREDICTED: trafficking protein particle complex subunit 13-like 
isoform X1 [Setaria italica]
Length=513

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            SS+ +   K E S+ LGK QITWRTNLGEPGRLQTQ I  +P    D++L AV+VPPII 
Sbjct  305  SSDEAAQPKSELSSTLGKFQITWRTNLGEPGRLQTQNIHSTPTASKDVDLRAVKVPPIIY  364

Query  575  iEKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTM  441
             E+PF+V   LTNQTD+ +GPFEV+L+ S + +E  V+VNG Q +
Sbjct  365  AERPFMVNLCLTNQTDKTVGPFEVFLAPSMTGEESAVLVNGLQKL  409



>ref|XP_002970996.1| hypothetical protein SELMODRAFT_95233 [Selaginella moellendorffii]
 gb|EFJ27594.1| hypothetical protein SELMODRAFT_95233 [Selaginella moellendorffii]
Length=439

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ +K EG+N LGKL+I WRT LGE GRLQTQQI GSP     +++    +P  I+IE+P
Sbjct  276  SSDVKLEGANALGKLEILWRTTLGETGRLQTQQINGSPTPKKPLDVKMTNLPQRILIERP  335

Query  563  FLVRFKLTNQTDRILGPFEVWLSQS-ESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLV  387
            FLVR ++TN++++  GP  V +S++ ++   + V++NG  ++   ++    +     NLV
Sbjct  336  FLVRMEVTNRSEQFTGPLRVVMSETDDNGTPRTVLMNGLLSLVSSRIHEDLTGTLSQNLV  395

Query  386  AVKQGIQKIAGITIFDMHEKK  324
            AV  G+Q+IAGI + D  + +
Sbjct  396  AVAAGVQRIAGICLVDARDGR  416



>ref|XP_002962090.1| hypothetical protein SELMODRAFT_77366, partial [Selaginella moellendorffii]
 gb|EFJ37350.1| hypothetical protein SELMODRAFT_77366, partial [Selaginella moellendorffii]
Length=318

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 68/98 (69%), Gaps = 1/98 (1%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S+ +K EG+N LGKL+I WRT LGE GRLQTQQI GSP     +++    +P  I+IE+P
Sbjct  217  SSDVKLEGANALGKLEILWRTTLGETGRLQTQQINGSPTPKKPLDVKMTNLPQRILIERP  276

Query  563  FLVRFKLTNQTDRILGPFEVWLSQSESL-DEKYVMVNG  453
            FLVR ++TN++++  GP  V +S+++     + V++NG
Sbjct  277  FLVRMEVTNRSEQFTGPLRVVMSETDDNGTPRTVLMNG  314



>ref|NP_001064971.1| Os10g0498800 [Oryza sativa Japonica Group]
 dbj|BAF26885.1| Os10g0498800, partial [Oryza sativa Japonica Group]
Length=64

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  470  YVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGITIFDMHEKKTYDSLLELEIF  291
            YV+VNG Q + LP +EAF S  F L++VA + G+QKI+GIT++ + EKK Y+ L ++EIF
Sbjct  1    YVLVNGLQKLVLPLVEAFESINFDLSMVATQVGVQKISGITLYAVQEKKLYEPLSDIEIF  60

Query  290  VDPE  279
            VD E
Sbjct  61   VDAE  64



>gb|KCW76267.1| hypothetical protein EUGRSUZ_D00641 [Eucalyptus grandis]
Length=382

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIEL  606
            SS+ +  +K EG+NVLGKLQITWRTNLGEPGRLQTQQILG+ I   +I+L
Sbjct  282  SSQSNGQMKVEGNNVLGKLQITWRTNLGEPGRLQTQQILGTAITRKEIDL  331



>ref|NP_001129809.1| Protein C56C10.7, isoform c [Caenorhabditis elegans]
 emb|CCD68186.1| C56C10.7, isoform c [Caenorhabditis elegans]
Length=243

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  106  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVSCRLYNCS  165

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  166  ERALD-LQLRLEQPSN---RHLVFCSPSGVSLGQLPPSQHVDFSLNVFPVTVGIQSISGI  221

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  222  RITDTFTKRIYEHDDIAQIFV  242



>ref|XP_005646244.1| DUF974-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21700.1| DUF974-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=417

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 81/145 (56%), Gaps = 3/145 (2%)
 Frame = -3

Query  719  SNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLT  540
            +  LGK++I WR NLG+ GRLQTQQI+ + +   D+EL    +P  + +E PF  +  + 
Sbjct  275  TGALGKMEIRWRGNLGKLGRLQTQQIMANAVNSKDVELLLTSLPQAVHLEIPFAAKVTVR  334

Query  539  NQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKI  360
            +  DR L    + L   E   E  ++V    +  + +L+A+GSS     L+ +K+G+QK+
Sbjct  335  SNVDRTLE--NLALRVPEQPAEGGLVVEDLSSTVVSRLDAYGSSSVVCTLLPMKEGLQKL  392

Query  359  AGITIFDMHEKKTYDSLLELEIFVD  285
              + +    + +  D +++++ FV+
Sbjct  393  QAVELISQQDGRILD-VMDIDCFVN  416



>ref|NP_741009.1| Protein C56C10.7, isoform a [Caenorhabditis elegans]
 sp|Q95QQ2.1|TPC13_CAEEL RecName: Full=Probable trafficking protein particle complex subunit 
13 homolog [Caenorhabditis elegans]
 emb|CCD68177.1| C56C10.7, isoform a [Caenorhabditis elegans]
Length=401

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  264  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVSCRLYNCS  323

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  324  ERALD-LQLRLEQPSN---RHLVFCSPSGVSLGQLPPSQHVDFSLNVFPVTVGIQSISGI  379

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  380  RITDTFTKRIYEHDDIAQIFV  400



>pir||T15846 hypothetical protein C56C10.7 - Caenorhabditis elegans
Length=398

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  261  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVSCRLYNCS  320

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  321  ERALD-LQLRLEQPSN---RHLVFCSPSGVSLGQLPPSQHVDFSLNVFPVTVGIQSISGI  376

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  377  RITDTFTKRIYEHDDIAQIFV  397



>ref|NP_741010.1| Protein C56C10.7, isoform b [Caenorhabditis elegans]
 emb|CCD68178.1| C56C10.7, isoform b [Caenorhabditis elegans]
Length=417

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  280  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVSCRLYNCS  339

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  340  ERALD-LQLRLEQPSN---RHLVFCSPSGVSLGQLPPSQHVDFSLNVFPVTVGIQSISGI  395

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  396  RITDTFTKRIYEHDDIAQIFV  416



>ref|XP_009142491.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Brassica rapa]
Length=361

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -3

Query  755  SSEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiii  576
            S++ S   K +GS++LGK QITWRTNLGEPGRLQTQQILG+P+   +I +  VEVP  + 
Sbjct  281  SADVSGQTKLQGSSILGKFQITWRTNLGEPGRLQTQQILGAPVSRKEINMRVVEVPTALH  340

Query  575  iEKPFLV  555
            + +PF V
Sbjct  341  LNRPFSV  347



>gb|EYC08018.1| hypothetical protein Y032_0068g254 [Ancylostoma ceylanicum]
Length=224

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 73/141 (52%), Gaps = 5/141 (4%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      H D+ L    +P  + + KPF V  +L N  
Sbjct  88   IGKLDMSWRTHMGERGRLQTSPLQRIAPAHGDVRLSIENLPATVPVRKPFTVDCRLYNCC  147

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L      L+ S+ L   +  ++G   + L Q+   G+  F + ++ +  G Q I+GI
Sbjct  148  ERSLDLRLELLNNSQCL--FFCSISG---IALGQVPPNGNVAFSVEVLPIAIGFQSISGI  202

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   KK YD     ++FV
Sbjct  203  RIVDSFAKKVYDHDDIAQVFV  223



>gb|ACO10463.1| UPF0533 protein [Caligus rogercresseyi]
Length=425

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 80/142 (56%), Gaps = 4/142 (3%)
 Frame = -3

Query  713  VLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQ  534
             +GK+ + WRTNLGE GR++T Q+L +P V NDI+      P ++++ + F +  K+ N 
Sbjct  275  AIGKIDVIWRTNLGERGRIKTSQLLRTPPVLNDIQFLIESCPSVVMLHQVFNISAKIFNN  334

Query  533  TDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAG  354
            ++R L    + + +++S     +M +G     L  L+  G  EF L++V +  G+Q I+G
Sbjct  335  SERTLELEALCVDKNKS----RLMWSGSTAQKLGLLQPDGCLEFTLSVVPLDTGLQVISG  390

Query  353  ITIFDMHEKKTYDSLLELEIFV  288
            I I D   K+ Y+     ++FV
Sbjct  391  IRILDNLLKRAYEFDDSNQVFV  412



>emb|CAD28498.1| hypothetical protein [Homo sapiens]
Length=207

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  59   KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  118

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  119  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  172

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  173  SISGLRLTDTFLKRTYE  189



>sp|A8WX89.2|TPC13_CAEBR RecName: Full=Probable trafficking protein particle complex subunit 
13 homolog [Caenorhabditis briggsae]
 emb|CAP25053.3| Protein CBG04321 [Caenorhabditis briggsae]
Length=401

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  264  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVACRLYNCS  323

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   + +++  P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  324  ERALD-LQLRLEQPSN---RQLVICSPSGVSLGQLPPSRYVDFALNVFPVAVGIQSISGI  379

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  380  RITDTFTKRHYEHDDIAQIFV  400



>gb|ETN71012.1| hypothetical protein NECAME_04707 [Necator americanus]
Length=385

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 5/141 (4%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRTN+GE GRLQT  +      H D+ L    +P  + + KPF V  +L N  
Sbjct  249  IGKLDMSWRTNMGERGRLQTSPLQRIAPTHGDVRLSVENLPATVPVRKPFTVDCRLYNCC  308

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L       + S+SL   +  ++G   + L Q+   GS  F + ++ +  G Q I+GI
Sbjct  309  ERSLDLRLELQNSSQSL--IFCSISG---ISLGQVPPNGSVTFSVEILPISIGFQSISGI  363

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   KK YD     ++FV
Sbjct  364  RIVDSFMKKIYDHDDIAQVFV  384



>gb|EAW51347.1| hypothetical protein FLJ13611, isoform CRA_e [Homo sapiens]
Length=217

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  69   KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  128

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  129  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  182

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  183  SISGLRLTDTFLKRTYE  199



>ref|XP_002630382.1| Hypothetical protein CBG04321 [Caenorhabditis briggsae]
Length=414

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF V  +L N +
Sbjct  277  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVDVQKPFEVACRLYNCS  336

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   + +++  P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  337  ERALD-LQLRLEQPSN---RQLVICSPSGVSLGQLPPSRYVDFALNVFPVAVGIQSISGI  392

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  393  RITDTFTKRHYEHDDIAQIFV  413



>ref|XP_009060066.1| hypothetical protein LOTGIDRAFT_106290 [Lottia gigantea]
 gb|ESO89020.1| hypothetical protein LOTGIDRAFT_106290 [Lottia gigantea]
Length=407

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 82/155 (53%), Gaps = 3/155 (2%)
 Frame = -3

Query  743  STLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKP  564
            S + + +G N +GKL I W+TN+GE GRLQT Q+      + DI+L    +P  + +E  
Sbjct  256  SEMKQKKGLNNIGKLDIVWKTNMGEKGRLQTSQLQRVAPGYGDIKLTIESIPDSVKLESI  315

Query  563  FLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVA  384
            F V  ++TN  +R +    V  + + S    +  ++G Q   LPQ E   S +  L L+A
Sbjct  316  FNVTCRITNCCERTMDLTLVLQNLNISTGLLWCGISGKQLGKLPQNE---SMDIHLTLLA  372

Query  383  VKQGIQKIAGITIFDMHEKKTYDSLLELEIFVDPE  279
            V  G+Q I G+ + D   K+TY+     +IFV  E
Sbjct  373  VTPGLQSICGLRLTDNFLKRTYEHDDIAQIFVSDE  407



>ref|XP_003113407.1| hypothetical protein CRE_26256 [Caenorhabditis remanei]
 gb|EFP07319.1| hypothetical protein CRE_26256 [Caenorhabditis remanei]
Length=398

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +        D+ L     P  + ++KPF V  +L N +
Sbjct  261  IGKLDMSWRTSMGEKGRLQTSALQRIAPGFGDVRLSVENTPACVDVQKPFEVACRLYNCS  320

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  321  ERALD-LQLRLEQPSN---RHLVFCSPSGVSLGQLPPSQYVDFTLNVFPVAVGIQSISGI  376

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  377  RITDTFTKRIYEHDDIAQIFV  397



>gb|EGT36424.1| hypothetical protein CAEBREN_15251 [Caenorhabditis brenneri]
Length=380

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 76/141 (54%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF +  +L N +
Sbjct  243  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVEVQKPFEILCRLYNCS  302

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   ++++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  303  ERALD-LQLRLEQPTN---RHLVFCSPSGVSLGQLPPSQYVDFVLNVFPVAVGIQSISGI  358

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  359  RITDTFTKRVYEHDDIAQIFV  379



>ref|XP_004932145.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Bombyx mori]
Length=401

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (54%), Gaps = 4/132 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL I WR+NLGE GRLQT Q+    + H+D+ L   ++P  +  ++ F  + K+ N +
Sbjct  264  IGKLDIVWRSNLGEKGRLQTSQLEAMALDHDDLRLTVEQIPSKVCADEAFTFKCKVVNAS  323

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L      + +  S  +  ++  G     L  LE   ++   L  + +  G+QK+ G+
Sbjct  324  ERTLD----LILKLRSPQDSSLLWCGISNRKLGPLEPGKTTFINLTALPINTGLQKVTGV  379

Query  350  TIFDMHEKKTYD  315
            ++ D+  K+TYD
Sbjct  380  SLVDLFLKRTYD  391



>gb|EYC08017.1| hypothetical protein Y032_0068g254 [Ancylostoma ceylanicum]
Length=392

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 73/141 (52%), Gaps = 5/141 (4%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      H D+ L    +P  + + KPF V  +L N  
Sbjct  256  IGKLDMSWRTHMGERGRLQTSPLQRIAPAHGDVRLSIENLPATVPVRKPFTVDCRLYNCC  315

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L      L+ S+ L   +  ++G   + L Q+   G+  F + ++ +  G Q I+GI
Sbjct  316  ERSLDLRLELLNNSQCL--FFCSISG---IALGQVPPNGNVAFSVEVLPIAIGFQSISGI  370

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   KK YD     ++FV
Sbjct  371  RIVDSFAKKVYDHDDIAQVFV  391



>ref|XP_007890312.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Callorhinchus milii]
Length=411

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF V  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEMIPDTVNLEEPFEVMCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L+A  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNAIHWCGISGRQ---LGKLSPNSSLHLALKLLASVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>gb|EYC08019.1| hypothetical protein Y032_0068g254 [Ancylostoma ceylanicum]
Length=431

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 73/141 (52%), Gaps = 5/141 (4%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      H D+ L    +P  + + KPF V  +L N  
Sbjct  295  IGKLDMSWRTHMGERGRLQTSPLQRIAPAHGDVRLSIENLPATVPVRKPFTVDCRLYNCC  354

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L      L+ S+ L   +  ++G   + L Q+   G+  F + ++ +  G Q I+GI
Sbjct  355  ERSLDLRLELLNNSQCL--FFCSISG---IALGQVPPNGNVAFSVEVLPIAIGFQSISGI  409

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   KK YD     ++FV
Sbjct  410  RIVDSFAKKVYDHDDIAQVFV  430



>gb|AAH59537.1| Zgc:73187 [Danio rerio]
 gb|AAH71349.1| Zgc:73187 [Danio rerio]
Length=385

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  237  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEFIPDTVDLEEPFDITCK  296

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  297  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLSPSASLSIPLKLLSSVQGLQ  350

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  351  SISGLRLTDTFLKRTYE  367



>ref|XP_007890309.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Callorhinchus milii]
Length=417

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF V  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEMIPDTVNLEEPFEVMCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L+A  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNAIHWCGISGRQ---LGKLSPNSSLHLALKLLASVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_005301063.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Chrysemys picta bellii]
Length=411

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLMDTFLKRTYE  393



>ref|NP_955832.2| trafficking protein particle complex subunit 13 isoform 2 [Danio 
rerio]
 sp|Q6PBY7.2|TPC13_DANRE RecName: Full=Trafficking protein particle complex subunit 13 
[Danio rerio]
Length=412

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  264  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEFIPDTVDLEEPFDITCK  323

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  324  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLSPSASLSIPLKLLSSVQGLQ  377

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  378  SISGLRLTDTFLKRTYE  394



>ref|XP_005155617.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Danio rerio]
Length=411

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEFIPDTVDLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLSPSASLSIPLKLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|NP_001231572.1| trafficking protein particle complex subunit 13 isoform 1 [Danio 
rerio]
Length=418

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  270  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEFIPDTVDLEEPFDITCK  329

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  330  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLSPSASLSIPLKLLSSVQGLQ  383

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  384  SISGLRLTDTFLKRTYE  400



>ref|XP_005155616.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Danio rerio]
Length=417

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEFIPDTVDLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLSPSASLSIPLKLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_010211511.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Tinamus guttatus]
Length=401

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_010211514.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Tinamus guttatus]
Length=395

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>ref|XP_009897159.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Picoides pubescens]
Length=413

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|NP_001187397.1| upf0533 protein c5orf44-like protein [Ictalurus punctatus]
 gb|ADO28590.1| upf0533 protein c5orf44-like protein [Ictalurus punctatus]
Length=417

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    VP  + IE+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGEKGRLQTSQLQRMAPGYGDVRLSLELVPDTVNIEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLLLEMCNTRSVHWCGVSGRQ---LGKLGPSASLSIPLQLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_006117075.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pelodiscus sinensis]
Length=479

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  331  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  390

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  391  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  444

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  445  SVSGLRLTDTFLKRTYE  461



>ref|XP_009987823.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X7 [Tauraco erythrolophus]
Length=410

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_004623104.1| PREDICTED: trafficking protein particle complex subunit 13 [Octodon 
degus]
Length=417

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L   ++    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEICDTSSVHWCGVSGRQ---LGKLHPSASLGLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_009987824.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X8 [Tauraco erythrolophus]
Length=410

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_009987819.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Tauraco erythrolophus]
Length=416

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_009987818.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Tauraco erythrolophus]
Length=416

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTSSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_006117077.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Pelodiscus sinensis]
Length=473

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  325  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  384

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  385  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  438

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  439  SVSGLRLTDTFLKRTYE  455



>ref|XP_006034781.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Alligator sinensis]
Length=395

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLILEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>ref|XP_009325554.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pygoscelis adeliae]
Length=394

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>dbj|BAC39168.1| unnamed protein product [Mus musculus]
Length=354

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  206  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  265

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R++   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  266  ITNCSERMM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  319

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  320  SVSGLRLTDTFLKRTYE  336



>ref|XP_010199164.1| PREDICTED: trafficking protein particle complex subunit 13, partial 
[Colius striatus]
Length=400

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_009974116.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Tyto alba]
Length=392

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>emb|CDQ60756.1| unnamed protein product [Oncorhynchus mykiss]
Length=401

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEMIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L ++    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLVLEMCNTCSIHWCGVSGRQ---LGKVSPSASLALPLKLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  367  SISGLRLTDSFLKRTYE  383



>ref|XP_005392683.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Chinchilla lanigera]
Length=411

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L   ++    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCDTSSVHWCGVSGRQ---LGKLLPSASLGLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006034779.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Alligator sinensis]
Length=401

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLILEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_009677464.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Struthio camelus australis]
Length=395

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLILEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>ref|XP_005009960.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Anas platyrhynchos]
Length=395

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>ref|XP_009677462.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Struthio camelus australis]
Length=401

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLILEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_005493045.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Zonotrichia albicollis]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_003461647.2| PREDICTED: trafficking protein particle complex subunit 13 [Cavia 
porcellus]
Length=411

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L   ++    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCDTSSVHWCGVSGRQ---LGKLLPSASLGLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005392682.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Chinchilla lanigera]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L   ++    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCDTSSVHWCGVSGRQ---LGKLLPSASLGLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005060754.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Ficedula albicollis]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_010578825.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Haliaeetus leucocephalus]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005060757.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Ficedula albicollis]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005493047.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Zonotrichia albicollis]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006231948.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Rattus norvegicus]
Length=411

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTTSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010158262.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Eurypyga helias]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_009270763.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Aptenodytes forsteri]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010578823.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Haliaeetus leucocephalus]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>gb|EMC86495.1| UPF0533 protein C5orf44 like protein [Columba livia]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006517800.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Mus musculus]
Length=411

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R++   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERMM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010393640.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Corvus cornix cornix]
Length=410

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006259127.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Alligator mississippiensis]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLILEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|NP_001087228.1| trafficking protein particle complex subunit 13 isoform 2 [Mus 
musculus]
 sp|Q3TIR1.1|TPC13_MOUSE RecName: Full=Trafficking protein particle complex subunit 13 
[Mus musculus]
 dbj|BAE39785.1| unnamed protein product [Mus musculus]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R++   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERMM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_010393637.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Corvus cornix cornix]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_006231946.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Rattus norvegicus]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTTSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>dbj|BAB14633.1| unnamed protein product [Homo sapiens]
Length=354

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  206  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  265

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  266  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  319

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  320  SISGLRLTDTFLKRTYE  336



>ref|XP_007255075.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Astyanax mexicanus]
Length=424

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  276  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEYIPDTVNLEEPFDITCK  335

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  336  ITNCSERTM---DLVLEMCNTRSVHWCGVSGRQ---LGKLCPSASLSIPLKLLSSVQGLQ  389

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  390  SISGLRLTDTFLKRTYE  406



>ref|XP_010158259.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Eurypyga helias]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_009270761.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Aptenodytes forsteri]
Length=416

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_007255074.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Astyanax mexicanus]
Length=430

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  282  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEYIPDTVNLEEPFDITCK  341

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  342  ITNCSERTM---DLVLEMCNTRSVHWCGVSGRQ---LGKLCPSASLSIPLKLLSSVQGLQ  395

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  396  SISGLRLTDTFLKRTYE  412



>ref|XP_010016939.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Nestor notabilis]
Length=400

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  313  VTNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_010016942.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Nestor notabilis]
Length=394

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  247  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  306

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  307  VTNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  360

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  361  SVSGLRLTDTFLKRTYE  377



>ref|XP_003507986.2| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Cricetulus griseus]
 gb|ERE84806.1| putative UPF0533 protein C5orf44 like protein [Cricetulus griseus]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFRITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|NP_001006577.2| uncharacterized protein LOC427165 isoform 2 [Gallus gallus]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLRLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_004703626.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Echinops telfairi]
Length=372

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  224  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVTLEEPFHITCK  283

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  284  ITNCSERTM---DLVLEMCNTNSVHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  337

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  338  SVSGLRLTDTFLKRTYE  354



>ref|XP_010334877.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Saimiri boliviensis boliviensis]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLISSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010334876.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Saimiri boliviensis boliviensis]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLISSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005065636.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Mesocricetus auratus]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|XP_005151970.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Melopsittacus undulatus]
Length=410

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  VTNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005151969.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Melopsittacus undulatus]
Length=416

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  VTNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|NP_079217.2| trafficking protein particle complex subunit 13 isoform 2 [Homo 
sapiens]
 ref|XP_008951024.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pan paniscus]
 ref|XP_009447362.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Pan troglodytes]
 sp|A5PLN9.2|TPC13_HUMAN RecName: Full=Trafficking protein particle complex subunit 13 
[Homo sapiens]
 gb|EAW51343.1| hypothetical protein FLJ13611, isoform CRA_a [Homo sapiens]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_008990244.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Callithrix jacchus]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|XP_006913149.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Pteropus alecto]
 gb|ELK11395.1| hypothetical protein PAL_GLEAN10024843 [Pteropus alecto]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|NP_001125291.1| trafficking protein particle complex subunit 13 [Pongo abelii]
 sp|Q5RCG0.1|TPC13_PONAB RecName: Full=Trafficking protein particle complex subunit 13 
[Pongo abelii]
 emb|CAH90547.1| hypothetical protein [Pongo abelii]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_004583800.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Ochotona princeps]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLDMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_004583798.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Ochotona princeps]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLDMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_007103372.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Physeter catodon]
Length=447

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  299  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  358

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  359  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  412

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  413  SVSGLRLTDTFLKRTYE  429



>ref|XP_008990243.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Callithrix jacchus]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>gb|AAI17129.1| C5orf44 protein, partial [Homo sapiens]
 gb|AAI43694.1| C5orf44 protein, partial [Homo sapiens]
Length=400

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  252  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  311

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  312  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  365

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  366  SISGLRLTDTFLKRTYE  382



>ref|NP_001128904.1| DKFZP459P083 protein [Pongo abelii]
 ref|XP_009239025.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Pongo abelii]
 emb|CAH93324.1| hypothetical protein [Pongo abelii]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|NP_001087225.1| trafficking protein particle complex subunit 13 isoform 3 [Homo 
sapiens]
 ref|XP_008951025.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Pan paniscus]
 ref|XP_009447363.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Pan troglodytes]
 gb|EAW51344.1| hypothetical protein FLJ13611, isoform CRA_b [Homo sapiens]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  377  SISGLRLTDTFLKRTYE  393



>ref|XP_011369383.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Pteropus vampyrus]
Length=446

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  298  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  357

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  358  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  411

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  412  SISGLRLTDTFLKRTYE  428



>ref|XP_006913147.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Pteropus alecto]
Length=417

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  383  SISGLRLTDTFLKRTYE  399



>ref|XP_011369386.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X7 [Pteropus vampyrus]
 ref|XP_011369388.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X8 [Pteropus vampyrus]
Length=440

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  292  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  351

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  352  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  405

Query  365  KIAGITIFDMHEKKTYD  315
             I+G+ + D   K+TY+
Sbjct  406  SISGLRLTDTFLKRTYE  422



>ref|XP_007486458.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Monodelphis domestica]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLNPSSSLYLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005604276.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Equus caballus]
 ref|XP_008521834.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Equus przewalskii]
Length=411

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_007176090.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Balaenoptera acutorostrata scammoni]
Length=411

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005604275.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Equus caballus]
 ref|XP_008521832.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Equus przewalskii]
Length=417

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_007486457.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Monodelphis domestica]
Length=417

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLNPSSSLYLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_004270798.1| PREDICTED: UPF0533 protein C5orf44 homolog isoform 1 [Orcinus 
orca]
 ref|XP_004328596.1| PREDICTED: UPF0533 protein C5orf44 homolog isoform 1 [Tursiops 
truncatus]
 ref|XP_007103374.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Physeter catodon]
 ref|XP_007457166.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Lipotes vexillifer]
Length=417

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_004465626.1| PREDICTED: UPF0533 protein C5orf44 homolog isoform 4 [Dasypus 
novemcinctus]
Length=411

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 80/146 (55%), Gaps = 8/146 (5%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            SE + ++K  G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +
Sbjct  256  SEKAGIIK--GVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNL  313

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  K+TN ++R +   ++ L    +    +  ++G Q   L +L    S    L 
Sbjct  314  EEPFHITCKITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALT  367

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYD  315
            L++  QG+Q ++G+ + D   K+TY+
Sbjct  368  LLSSVQGLQSVSGLRLTDTFLKRTYE  393



>ref|XP_007176088.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Balaenoptera acutorostrata scammoni]
Length=417

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTSSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_004465624.1| PREDICTED: UPF0533 protein C5orf44 homolog isoform 2 [Dasypus 
novemcinctus]
Length=417

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 80/146 (55%), Gaps = 8/146 (5%)
 Frame = -3

Query  752  SEGSTLLKXEGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiii  573
            SE + ++K  G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +
Sbjct  262  SEKAGIIK--GVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNL  319

Query  572  EKPFLVRFKLTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLN  393
            E+PF +  K+TN ++R +   ++ L    +    +  ++G Q   L +L    S    L 
Sbjct  320  EEPFHITCKITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALT  373

Query  392  LVAVKQGIQKIAGITIFDMHEKKTYD  315
            L++  QG+Q ++G+ + D   K+TY+
Sbjct  374  LLSSVQGLQSVSGLRLTDTFLKRTYE  399



>ref|XP_006170981.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Tupaia chinensis]
Length=173

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 5/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  24   KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  83

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN +        + +  + S+   +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  84   ITNCSSERTMDLVLEMCNTSSI--HWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  138

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  139  SVSGLRLTDTFLKRTYE  155



>ref|XP_007523550.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Erinaceus europaeus]
Length=401

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  253  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVSLEEPFHITCK  312

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  313  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  366

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  367  SVSGLRLTDTFLKRTYE  383



>ref|XP_010635552.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Fukomys damarensis]
 ref|XP_010635553.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Fukomys damarensis]
Length=405

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  257  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  316

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  317  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  370

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  371  SVSGLRLTDTFLKRTYE  387



>gb|EFB17356.1| hypothetical protein PANDA_007966 [Ailuropoda melanoleuca]
Length=339

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  191  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  250

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  251  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  304

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  305  SVSGLRLTDTFLKRTYE  321



>ref|XP_007951053.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Orycteropus afer afer]
Length=371

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  224  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  283

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  284  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  337

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  338  SVSGLRLTDTFLKRTYE  354



>gb|EGT48361.1| hypothetical protein CAEBREN_24983, partial [Caenorhabditis brenneri]
Length=374

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 75/141 (53%), Gaps = 4/141 (3%)
 Frame = -3

Query  710  LGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFKLTNQT  531
            +GKL ++WRT++GE GRLQT  +      + D+ L   + P  + ++KPF +  +L N +
Sbjct  237  IGKLDMSWRTSMGEKGRLQTSALQRIAPGYGDVRLSVEKTPACVEVQKPFEILCRLYNCS  296

Query  530  DRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQKIAGI  351
            +R L   ++ L Q  +   + ++   P  + L QL      +F LN+  V  GIQ I+GI
Sbjct  297  ERALD-LQLRLEQPTN---RNLVFCTPSGVSLGQLPPSQYVDFVLNVFPVAVGIQSISGI  352

Query  350  TIFDMHEKKTYDSLLELEIFV  288
             I D   K+ Y+     +IFV
Sbjct  353  RITDTFTKRVYEHDDIAQIFV  373



>ref|NP_001016427.2| trafficking protein particle complex subunit 13 isoform 2 [Xenopus 
(Silurana) tropicalis]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSIETIPDTVRLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNAIHWCGVSGRQ---LGKLHPSSSLHLTLALLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006186138.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Camelus ferus]
 ref|XP_010947675.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Camelus bactrianus]
 ref|XP_010973233.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Camelus dromedarius]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_009557883.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Cuculus canorus]
Length=416

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDIICK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005530150.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Pseudopodoces humilis]
Length=416

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLYLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_006732586.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Leptonychotes weddellii]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSLHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_009557885.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Cuculus canorus]
Length=410

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDIICK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010635551.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Fukomys damarensis]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_008689587.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Ursus maritimus]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_004764599.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Mustela putorius furo]
 ref|XP_004789766.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X5 [Mustela putorius furo]
Length=404

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  256  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  315

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  316  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  369

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  370  SVSGLRLTDTFLKRTYE  386



>ref|XP_010635549.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Fukomys damarensis]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_006762480.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Myotis davidii]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  +I+E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVILEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006186136.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Camelus ferus]
 ref|XP_010947672.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Camelus bactrianus]
 ref|XP_010973231.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Camelus dromedarius]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005530148.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Pseudopodoces humilis]
Length=410

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGVSGRQ---LGKLHPSSSLYLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_008260507.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Oryctolagus cuniculus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005617504.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X6 [Canis lupus familiaris]
 ref|XP_007079957.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Panthera tigris altaica]
 ref|XP_011282339.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Felis catus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010635548.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Fukomys damarensis]
Length=421

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  273  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  332

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  333  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  386

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  387  SVSGLRLTDTFLKRTYE  403



>ref|XP_005694690.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Capra hircus]
 ref|XP_005892844.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Bos mutus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_008844203.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Nannospalax galili]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005858008.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X7 [Myotis brandtii]
 ref|XP_006081466.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Myotis lucifugus]
 ref|XP_008160098.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Eptesicus fuscus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  +I+E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVILEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_005221507.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Bos taurus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_010635550.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Fukomys damarensis]
Length=415

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  267  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  326

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  327  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  380

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  381  SVSGLRLTDTFLKRTYE  397



>ref|XP_004764597.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Mustela putorius furo]
 ref|XP_004789764.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Mustela putorius furo]
Length=410

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  262  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  321

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  322  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  375

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  376  SVSGLRLTDTFLKRTYE  392



>ref|XP_008844205.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Nannospalax galili]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|NP_001095410.1| trafficking protein particle complex subunit 13 [Bos taurus]
 sp|A7MB76.1|TPC13_BOVIN RecName: Full=Trafficking protein particle complex subunit 13 
[Bos taurus]
 gb|AAI51377.1| LOC511108 protein [Bos taurus]
 tpg|DAA17969.1| TPA: hypothetical protein LOC511108 [Bos taurus]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_008689588.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X3 [Ursus maritimus]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



>ref|XP_006871047.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X1 [Chrysochloris asiatica]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_008260505.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Oryctolagus cuniculus]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_007079955.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Panthera tigris altaica]
 ref|XP_011282336.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Felis catus]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_010586478.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X2 [Loxodonta africana]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_004374599.1| PREDICTED: UPF0533 protein C5orf44 homolog isoform 1 [Trichechus 
manatus latirostris]
Length=417

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    VP  + +E+PF +  K
Sbjct  269  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAVPDTVNLEEPFHITCK  328

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  329  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  382

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  383  SVSGLRLTDTFLKRTYE  399



>ref|XP_005858007.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X6 [Myotis brandtii]
Length=430

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  +I+E+PF +  K
Sbjct  282  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVILEEPFHITCK  341

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  342  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  395

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  396  SVSGLRLTDTFLKRTYE  412



>ref|XP_010296659.1| PREDICTED: trafficking protein particle complex subunit 13-like 
[Balearica regulorum gibbericeps]
Length=219

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 5/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  71   KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLETIPDTVNLEEPFDITCK  130

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN +        + +  + S+   +  V+G Q   L +L    S    L L++  QG+Q
Sbjct  131  ITNCSSERTMDLVLEMCNTNSI--HWCGVSGRQ---LGKLHPSSSLHLALTLLSSVQGLQ  185

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  186  SVSGLRLTDTFLKRTYE  202



>ref|XP_004678319.1| PREDICTED: trafficking protein particle complex subunit 13 isoform 
X4 [Condylura cristata]
Length=411

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  725  EGSNVLGKLQITWRTNLGEPGRLQTQQILGSPIVHNDIELGAvevppiiiiEKPFLVRFK  546
            +G  V+GKL I W+TNLGE GRLQT Q+      + D+ L    +P  + +E+PF +  K
Sbjct  263  KGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCK  322

Query  545  LTNQTDRILGPFEVWLSQSESLDEKYVMVNGPQTMPLPQLEAFGSSEFRLNLVAVKQGIQ  366
            +TN ++R +   ++ L    +    +  ++G Q   L +L    S    L L++  QG+Q
Sbjct  323  ITNCSERTM---DLVLEMCNTNSIHWCGISGRQ---LGKLHPSSSLCLALTLLSSVQGLQ  376

Query  365  KIAGITIFDMHEKKTYD  315
             ++G+ + D   K+TY+
Sbjct  377  SVSGLRLTDTFLKRTYE  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260