BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007E18

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770220.1|  PREDICTED: mitogen-activated protein kinase ...    380   8e-128   Nicotiana sylvestris
ref|XP_006351058.1|  PREDICTED: mitogen-activated protein kinase ...    379   2e-127   
gb|AAP20419.1|  mitogen-activated protein kinase 1                      379   3e-127   Solanum lycopersicum
ref|XP_009606346.1|  PREDICTED: mitogen-activated protein kinase ...    379   4e-127   Nicotiana tomentosiformis
ref|NP_001275321.1|  mitogen-activated protein kinase homolog NTF...    379   4e-127   Solanum tuberosum [potatoes]
dbj|BAG50821.1|  MAP kinase                                             378   5e-127   Nicotiana benthamiana
ref|NP_001275113.1|  mitogen-activated protein kinase homolog NTF...    378   5e-127   Solanum tuberosum [potatoes]
gb|ABJ89812.1|  salicylic acid-activated MAP kinase                     378   6e-127   Nicotiana attenuata
dbj|BAG50820.1|  MAP kinase                                             378   6e-127   Nicotiana benthamiana
dbj|BAC53772.1|  salicylic acid-induced protein kinase                  378   7e-127   Nicotiana benthamiana
gb|AHN53386.1|  MAPK6 protein                                           377   1e-126   Solanum tuberosum [potatoes]
ref|XP_008384112.1|  PREDICTED: mitogen-activated protein kinase ...    377   1e-126   
gb|ABB16417.1|  mitogen-activated protein kinase Ntf4-1                 377   1e-126   Nicotiana tabacum [American tobacco]
gb|KHG06263.1|  Mitogen-activated protein kinase NTF4                   376   4e-126   Gossypium arboreum [tree cotton]
gb|ABB16418.1|  mitogen-activated protein kinase Ntf4-2                 376   4e-126   Nicotiana tabacum [American tobacco]
ref|NP_001280856.1|  mitogen-activated protein kinase homolog D5        376   4e-126   Malus domestica [apple tree]
ref|XP_008394276.1|  PREDICTED: mitogen-activated protein kinase ...    376   6e-126   
sp|Q40532.1|NTF4_TOBAC  RecName: Full=Mitogen-activated protein k...    375   6e-126   Nicotiana tabacum [American tobacco]
ref|NP_001234011.1|  Mitogen-activated protein kinase                   375   6e-126   
gb|AHX99575.1|  mitogen-activated protein kinase 6                      375   7e-126   Betula platyphylla [Asian white birch]
ref|NP_001234355.1|  mitogen-activated protein kinase 2                 375   9e-126   Solanum lycopersicum
gb|AAF81420.1|  MAP kinase 2                                            375   1e-125   Capsicum annuum
gb|AJA29666.1|  mitogen-activated protein kinase 6                      375   1e-125   Gossypium hirsutum [American cotton]
sp|Q06060.1|MPK_PEA  RecName: Full=Mitogen-activated protein kina...    374   2e-125   Pisum sativum [garden pea]
emb|CAC79662.1|  mitogen activated protein kinase                       374   2e-125   Capsicum annuum
ref|XP_002524853.1|  big map kinase/bmk, putative                       374   2e-125   Ricinus communis
ref|NP_001235426.1|  mitogen-activated protein kinase 2                 374   2e-125   Glycine max [soybeans]
ref|XP_009366225.1|  PREDICTED: mitogen-activated protein kinase ...    372   1e-124   Pyrus x bretschneideri [bai li]
gb|ACG60597.1|  mitogen activated protein kinase 2                      372   1e-124   Solanum peruvianum [Peruvian tomato]
emb|CBI24707.3|  unnamed protein product                                370   2e-124   Vitis vinifera
gb|ADT65136.1|  mitogen-activated protein kinase                        372   2e-124   Gossypium hirsutum [American cotton]
ref|XP_004505140.1|  PREDICTED: mitogen-activated protein kinase ...    371   4e-124   
gb|AAN65179.1|  mitogen-activated protein kinase 6                      370   5e-124   Petroselinum crispum
emb|CDP08056.1|  unnamed protein product                                371   5e-124   Coffea canephora [robusta coffee]
ref|XP_007033688.1|  Mitogen-activated protein kinase 6                 372   6e-124   
gb|KCW63919.1|  hypothetical protein EUGRSUZ_G01599                     366   8e-124   Eucalyptus grandis [rose gum]
gb|KHN32349.1|  Mitogen-activated protein kinase like MMK1              370   2e-123   Glycine soja [wild soybean]
ref|XP_011097634.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    369   2e-123   
ref|XP_006583849.1|  PREDICTED: mitogen-activated protein kinase ...    368   4e-123   Glycine max [soybeans]
gb|KHN31012.1|  Mitogen-activated protein kinase like MMK1              368   5e-123   Glycine soja [wild soybean]
ref|XP_003529369.1|  PREDICTED: mitogen-activated protein kinase ...    369   7e-123   Glycine max [soybeans]
ref|XP_010650725.1|  PREDICTED: mitogen-activated protein kinase ...    368   8e-123   Vitis vinifera
ref|XP_011001813.1|  PREDICTED: mitogen-activated protein kinase ...    367   1e-122   Populus euphratica
ref|XP_010066116.1|  PREDICTED: mitogen-activated protein kinase ...    367   2e-122   Eucalyptus grandis [rose gum]
gb|AAF65766.1|AF242308_1  mitogen-activated protein kinase              366   2e-122   Euphorbia esula [wolf's milk]
ref|XP_004287157.1|  PREDICTED: mitogen-activated protein kinase ...    366   2e-122   Fragaria vesca subsp. vesca
ref|XP_002323707.2|  mitogen-activated protein kinase 7                 367   2e-122   
ref|XP_007153722.1|  hypothetical protein PHAVU_003G059500g             366   2e-122   Phaseolus vulgaris [French bean]
gb|AAZ23128.1|  mitogen-activated protein kinase 1                      366   3e-122   Arachis hypogaea [goober]
ref|XP_002310398.2|  mitogen-activated protein kinase 7                 366   4e-122   Populus trichocarpa [western balsam poplar]
sp|Q07176.1|MMK1_MEDSA  RecName: Full=Mitogen-activated protein k...    365   5e-122   Medicago sativa [alfalfa]
ref|XP_009358393.1|  PREDICTED: mitogen-activated protein kinase ...    366   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_011047652.1|  PREDICTED: mitogen-activated protein kinase ...    365   6e-122   Populus euphratica
ref|XP_010101362.1|  Mitogen-activated protein kinase-MMK1-like p...    365   1e-121   
ref|XP_008243044.1|  PREDICTED: mitogen-activated protein kinase ...    365   1e-121   Prunus mume [ume]
ref|XP_007202173.1|  hypothetical protein PRUPE_ppa006536mg             365   1e-121   Prunus persica
gb|AHJ80962.1|  mitogen-activated protein kinase 2                      364   2e-121   Morus notabilis
ref|XP_008445484.1|  PREDICTED: mitogen-activated protein kinase ...    362   2e-121   Cucumis melo [Oriental melon]
ref|XP_003608100.1|  Mitogen-activated protein kinase                   363   3e-121   Medicago truncatula
gb|KDP35142.1|  hypothetical protein JCGZ_10676                         363   5e-121   Jatropha curcas
gb|AID46462.1|  MAP kinase 1                                            363   7e-121   Vigna mungo [urad dal]
ref|XP_008445483.1|  PREDICTED: mitogen-activated protein kinase ...    362   1e-120   Cucumis melo [Oriental melon]
gb|EYU23922.1|  hypothetical protein MIMGU_mgv1a008052mg                362   1e-120   Erythranthe guttata [common monkey flower]
ref|XP_010246606.1|  PREDICTED: mitogen-activated protein kinase ...    362   1e-120   Nelumbo nucifera [Indian lotus]
ref|XP_004144187.1|  PREDICTED: mitogen-activated protein kinase ...    362   2e-120   Cucumis sativus [cucumbers]
ref|XP_011074877.1|  PREDICTED: mitogen-activated protein kinase ...    361   2e-120   Sesamum indicum [beniseed]
gb|EYU22909.1|  hypothetical protein MIMGU_mgv1a007972mg                360   4e-120   Erythranthe guttata [common monkey flower]
ref|XP_006442196.1|  hypothetical protein CICLE_v10020481mg             359   2e-119   Citrus clementina [clementine]
gb|AAY90121.1|  mitogen-activated protein kinase                        359   2e-119   Rheum australe [Himalayan rhubarb]
ref|XP_006492790.1|  PREDICTED: mitogen-activated protein kinase ...    359   2e-119   Citrus sinensis [apfelsine]
gb|KJB27808.1|  hypothetical protein B456_005G011100                    354   2e-119   Gossypium raimondii
ref|XP_010915532.1|  PREDICTED: mitogen-activated protein kinase 1      358   4e-119   
ref|XP_010530307.1|  PREDICTED: mitogen-activated protein kinase 6      358   4e-119   Tarenaya hassleriana [spider flower]
gb|KHG30807.1|  Mitogen-activated protein kinase MMK1                   358   6e-119   Gossypium arboreum [tree cotton]
emb|CDX83459.1|  BnaA03g20470D                                          358   6e-119   
emb|CDY44256.1|  BnaC03g24480D                                          358   6e-119   Brassica napus [oilseed rape]
ref|XP_010672463.1|  PREDICTED: mitogen-activated protein kinase ...    358   8e-119   Beta vulgaris subsp. vulgaris [field beet]
gb|AGA37189.1|  mitogen-activated protein kinase 6.1                    357   8e-119   Brassica napus [oilseed rape]
gb|AEM97899.1|  sucrose-activated protein kinase                        357   1e-118   Cephalostachyum fuchsianum
ref|XP_009133635.1|  PREDICTED: mitogen-activated protein kinase ...    356   3e-118   Brassica rapa
gb|KJB27807.1|  hypothetical protein B456_005G011100                    356   3e-118   Gossypium raimondii
gb|AEG64802.1|  mitogen-activated protein kinase                        356   4e-118   Gossypium hirsutum [American cotton]
ref|XP_009419763.1|  PREDICTED: mitogen-activated protein kinase ...    355   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001266884.1|  uncharacterized protein LOC100834779               355   5e-118   Brachypodium distachyon [annual false brome]
emb|CAH05023.1|  putative MAP kinase                                    355   6e-118   Papaver rhoeas [field poppy]
gb|AGO61959.1|  MAPK FLRS                                               352   1e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010526635.1|  PREDICTED: mitogen-activated protein kinase ...    354   2e-117   Tarenaya hassleriana [spider flower]
ref|XP_009399824.1|  PREDICTED: mitogen-activated protein kinase 1      354   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE65112.1|  hypothetical protein OsJ_20171                          354   3e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812083.1|  PREDICTED: mitogen-activated protein kinase 1      353   4e-117   Phoenix dactylifera
gb|ACD76439.1|  mitogen activated protein kinase 6                      352   5e-117   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90351.1|  predicted protein                                      353   6e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056846.1|  Os06g0154500                                       352   9e-117   
ref|XP_010925649.1|  PREDICTED: mitogen-activated protein kinase ...    352   1e-116   Elaeis guineensis
ref|XP_004964813.1|  PREDICTED: mitogen-activated protein kinase ...    351   4e-116   Setaria italica
gb|ACF85409.1|  unknown                                                 350   6e-116   Zea mays [maize]
ref|NP_001152745.1|  ABA stimulation MAP kinase                         350   7e-116   
ref|XP_002437855.1|  hypothetical protein SORBIDRAFT_10g003810          350   1e-115   Sorghum bicolor [broomcorn]
ref|XP_009389895.1|  PREDICTED: mitogen-activated protein kinase ...    349   2e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008780958.1|  PREDICTED: mitogen-activated protein kinase ...    348   3e-115   Phoenix dactylifera
gb|AFW85791.1|  putative MAP kinase family protein                      347   1e-114   
ref|NP_001104843.1|  MAP kinase2                                        347   2e-114   
gb|ACG37232.1|  MPK6 - putative MAPK                                    345   1e-113   Zea mays [maize]
ref|XP_006655804.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    343   4e-113   
gb|KFK37200.1|  hypothetical protein AALP_AA4G227200                    343   5e-113   Arabis alpina [alpine rockcress]
gb|AAO16560.1|  mitogen-activated protein kinase                        343   6e-113   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009142961.1|  PREDICTED: mitogen-activated protein kinase 6      341   2e-112   Brassica rapa
gb|ADM89008.1|  MPK6 protein                                            341   2e-112   Brassica napus [oilseed rape]
ref|XP_010517958.1|  PREDICTED: mitogen-activated protein kinase ...    340   4e-112   
emb|CDX79801.1|  BnaA05g03550D                                          339   9e-112   
ref|XP_002880067.1|  hypothetical protein ARALYDRAFT_903782             339   1e-111   Arabidopsis lyrata subsp. lyrata
ref|XP_010506280.1|  PREDICTED: mitogen-activated protein kinase ...    339   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010508373.1|  PREDICTED: mitogen-activated protein kinase 6      339   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006397553.1|  hypothetical protein EUTSA_v10001439mg             341   2e-111   
emb|CDY17911.1|  BnaC04g03080D                                          338   2e-111   Brassica napus [oilseed rape]
ref|NP_181907.1|  MAP kinase 6                                          338   3e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294349.1|  hypothetical protein CARUB_v10023366mg             338   4e-111   Capsella rubella
gb|ABG54333.1|  double HA-tagged mitogen activated protein kinase 6     338   5e-111   synthetic construct
gb|AFK49116.1|  unknown                                                 327   3e-110   Medicago truncatula
gb|EPS60369.1|  hypothetical protein M569_14432                         333   2e-109   Genlisea aurea
ref|XP_006845036.1|  hypothetical protein AMTR_s00058p00218380          332   8e-109   
gb|ACN39979.1|  unknown                                                 329   2e-108   Picea sitchensis
gb|ACN39845.1|  unknown                                                 330   2e-108   Picea sitchensis
gb|ACT63866.1|  mitogen activated protein kinase 6                      329   7e-108   Pinus taeda
gb|AGS78125.1|  mitogen activated protein kinase 1                      328   9e-108   Curcuma longa
gb|KHG09868.1|  Mitogen-activated protein kinase MMK1                   325   3e-106   Gossypium arboreum [tree cotton]
gb|KJB71605.1|  hypothetical protein B456_011G132800                    323   2e-105   Gossypium raimondii
ref|XP_010253496.1|  PREDICTED: mitogen-activated protein kinase ...    320   4e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009406947.1|  PREDICTED: mitogen-activated protein kinase 5      310   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010260161.1|  PREDICTED: mitogen-activated protein kinase ...    308   8e-100   Nelumbo nucifera [Indian lotus]
gb|KJB20240.1|  hypothetical protein B456_003G139900                    304   3e-99    Gossypium raimondii
gb|AJA29669.1|  mitogen-activated protein kinase 9                      306   5e-99    Gossypium hirsutum [American cotton]
gb|KHG08689.1|  Mitogen-activated protein kinase 3                      306   6e-99    Gossypium arboreum [tree cotton]
ref|XP_002532266.1|  big map kinase/bmk, putative                       302   9e-99    
ref|XP_004294685.1|  PREDICTED: mitogen-activated protein kinase 3      305   9e-99    Fragaria vesca subsp. vesca
ref|XP_010032056.1|  PREDICTED: mitogen-activated protein kinase 3      305   1e-98    Eucalyptus grandis [rose gum]
gb|KDO73106.1|  hypothetical protein CISIN_1g025683mg                   300   3e-98    Citrus sinensis [apfelsine]
gb|KJB20241.1|  hypothetical protein B456_003G139900                    304   3e-98    Gossypium raimondii
ref|XP_006424673.1|  hypothetical protein CICLE_v10028667mg             301   8e-98    
gb|AEV89968.1|  mitogen activated protein kinase                        303   1e-97    Humulus lupulus [common hop]
ref|XP_006402656.1|  hypothetical protein EUTSA_v10006460mg             303   1e-97    Eutrema salsugineum [saltwater cress]
ref|XP_008792346.1|  PREDICTED: mitogen-activated protein kinase 5      302   1e-97    Phoenix dactylifera
gb|ABM67698.1|  mitogen-activated protein kinase                        302   2e-97    Citrus sinensis [apfelsine]
gb|KDP44133.1|  hypothetical protein JCGZ_05600                         302   2e-97    Jatropha curcas
ref|XP_006424672.1|  hypothetical protein CICLE_v10028667mg             301   5e-97    Citrus clementina [clementine]
gb|KHN22030.1|  Mitogen-activated protein kinase 3                      301   5e-97    Glycine soja [wild soybean]
ref|XP_003539740.1|  PREDICTED: mitogen-activated protein kinase ...    301   5e-97    Glycine max [soybeans]
ref|NP_001275822.1|  mitogen-activated protein kinase 1                 301   5e-97    Citrus sinensis [apfelsine]
ref|XP_010920941.1|  PREDICTED: mitogen-activated protein kinase 5      300   8e-97    Elaeis guineensis
gb|KHG13782.1|  Mitogen-activated protein kinase 3                      300   1e-96    Gossypium arboreum [tree cotton]
gb|KHN05707.1|  Mitogen-activated protein kinase 3                      300   1e-96    Glycine soja [wild soybean]
gb|ABR17734.1|  unknown                                                 296   2e-96    Picea sitchensis
ref|XP_002876524.1|  predicted protein                                  300   2e-96    Arabidopsis lyrata subsp. lyrata
ref|NP_191538.1|  mitogen-activated protein kinase 10                   300   2e-96    Arabidopsis thaliana [mouse-ear cress]
gb|ADI52626.1|  mitogen-activated protein kinase 3                      299   3e-96    Gossypium hirsutum [American cotton]
ref|XP_008385257.1|  PREDICTED: mitogen-activated protein kinase 3      298   5e-96    
gb|KJB56016.1|  hypothetical protein B456_009G104600                    298   5e-96    Gossypium raimondii
gb|AJA29672.1|  mitogen-activated protein kinase 13                     298   7e-96    Gossypium hirsutum [American cotton]
gb|ABG54337.1|  double HA-tagged mitogen activated protein kinase 10    299   7e-96    synthetic construct
ref|XP_010535564.1|  PREDICTED: mitogen-activated protein kinase 3      298   7e-96    Tarenaya hassleriana [spider flower]
ref|NP_001265988.1|  mitogen-activated protein kinase 3-like            298   8e-96    
ref|XP_010689418.1|  PREDICTED: mitogen-activated protein kinase 3      298   9e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|AGI60283.1|  mitogen-activated protein kinase 4                      298   1e-95    Dendrobium officinale
ref|XP_007016654.1|  Mitogen-activated protein kinase 3                 298   1e-95    
ref|NP_001237882.1|  mitogen-activated protein kinase 1                 297   1e-95    
ref|XP_007205387.1|  hypothetical protein PRUPE_ppa007370mg             297   1e-95    Prunus persica
ref|XP_009358265.1|  PREDICTED: mitogen-activated protein kinase 3      297   1e-95    Pyrus x bretschneideri [bai li]
ref|XP_009602556.1|  PREDICTED: mitogen-activated protein kinase ...    294   2e-95    Nicotiana tomentosiformis
ref|XP_007132165.1|  hypothetical protein PHAVU_011G071400g             296   5e-95    Phaseolus vulgaris [French bean]
ref|XP_010112333.1|  Mitogen-activated protein kinase 3                 296   7e-95    Morus notabilis
gb|AHY02158.1|  mitogen-activated protein kinase 3                      295   8e-95    Betula platyphylla [Asian white birch]
ref|NP_001267653.1|  mitogen-activated protein kinase 3-like            295   8e-95    Cucumis sativus [cucumbers]
gb|AAF73236.1|AF153061_1  MAP kinase 3                                  295   8e-95    Pisum sativum [garden pea]
emb|CAA57721.1|  protein kinase                                         295   1e-94    Medicago sativa [alfalfa]
gb|AGV52329.1|  MAPK3                                                   295   1e-94    Brassica juncea [brown mustard]
gb|AGA37186.1|  mitogen-activated protein kinase 3.1                    295   1e-94    Brassica napus [oilseed rape]
ref|XP_011007365.1|  PREDICTED: mitogen-activated protein kinase ...    295   1e-94    Populus euphratica
ref|XP_002314017.1|  kinase MMK4 family protein                         294   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_009352415.1|  PREDICTED: mitogen-activated protein kinase ...    294   3e-94    Pyrus x bretschneideri [bai li]
ref|XP_009416271.1|  PREDICTED: mitogen-activated protein kinase ...    293   5e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO84839.1|  putative MAP kinase 3                                   293   5e-94    Catharanthus roseus [chatas]
ref|XP_008358164.1|  PREDICTED: mitogen-activated protein kinase ...    293   6e-94    Malus domestica [apple tree]
ref|XP_006828349.1|  hypothetical protein AMTR_s00023p00249950          293   6e-94    Amborella trichopoda
ref|XP_002875737.1|  mitogen-activated protein kinase 3                 293   6e-94    Arabidopsis lyrata subsp. lyrata
emb|CDP08947.1|  unnamed protein product                                291   6e-94    Coffea canephora [robusta coffee]
ref|XP_006291331.1|  hypothetical protein CARUB_v10017466mg             293   7e-94    Capsella rubella
ref|XP_010514890.1|  PREDICTED: mitogen-activated protein kinase ...    293   7e-94    Camelina sativa [gold-of-pleasure]
dbj|BAA09600.1|  WIPK                                                   292   1e-93    Nicotiana tabacum [American tobacco]
ref|NP_190150.1|  mitogen-activated protein kinase 3                    292   1e-93    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA04866.1|  MAP kinase                                             292   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001284376.1|  mitogen-activated protein kinase 3                 292   2e-93    Cucumis melo [Oriental melon]
gb|AAZ23129.1|  mitogen-activated protein kinase 2                      292   2e-93    Arachis hypogaea [goober]
emb|CDX86029.1|  BnaC03g55440D                                          292   2e-93    
gb|ABK25416.1|  unknown                                                 291   2e-93    Picea sitchensis
ref|NP_001234360.1|  mitogen-activated protein kinase 3                 291   2e-93    Solanum lycopersicum
ref|XP_002298450.1|  kinase MMK4 family protein                         291   3e-93    Populus trichocarpa [western balsam poplar]
gb|KFK33939.1|  hypothetical protein AALP_AA5G081200                    291   4e-93    Arabis alpina [alpine rockcress]
gb|ADU54564.1|  wound-induced mitogen-activated protein kinase          291   4e-93    Nicotiana glutinosa
ref|XP_009150063.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    291   4e-93    Brassica rapa
gb|AAV34677.1|  mitogen-activated protein kinase 3                      291   5e-93    Brassica napus [oilseed rape]
gb|ABG54330.1|  double HA-tagged mitogen activated protein kinase 3     291   6e-93    synthetic construct
ref|XP_010425992.1|  PREDICTED: mitogen-activated protein kinase ...    290   7e-93    Camelina sativa [gold-of-pleasure]
emb|CBI16244.3|  unnamed protein product                                289   7e-93    Vitis vinifera
ref|XP_010503182.1|  PREDICTED: mitogen-activated protein kinase 3      290   8e-93    Camelina sativa [gold-of-pleasure]
gb|ABW34945.1|  mitogen-activated protein kinase 3                      290   8e-93    Solanum peruvianum [Peruvian tomato]
ref|XP_011025025.1|  PREDICTED: mitogen-activated protein kinase ...    290   1e-92    Populus euphratica
dbj|BAM13298.1|  MAP kinase 5                                           286   1e-92    Oryza australiensis
ref|NP_001275448.1|  mitogen-activated protein kinase 3-like            290   1e-92    Solanum tuberosum [potatoes]
gb|ABJ89813.1|  wound-induced protein kinase                            290   2e-92    Nicotiana attenuata
gb|ABY85198.2|  mitogen activated protein kinase 1                      289   2e-92    Datura metel
ref|XP_009802373.1|  PREDICTED: mitogen-activated protein kinase 3      289   3e-92    Nicotiana sylvestris
ref|XP_002284807.1|  PREDICTED: mitogen-activated protein kinase 3      289   3e-92    Vitis vinifera
gb|AII16885.1|  mitogen activated protein kinase                        282   3e-92    Camellia sinensis [black tea]
gb|KJB24765.1|  hypothetical protein B456_004G159400                    285   9e-92    Gossypium raimondii
dbj|BAM13295.1|  MAP kinase 5                                           283   1e-91    Oryza officinalis
gb|KJB24767.1|  hypothetical protein B456_004G159400                    284   1e-91    Gossypium raimondii
ref|XP_003633959.1|  PREDICTED: mitogen-activated protein kinase ...    287   2e-91    Vitis vinifera
dbj|BAM13291.1|  MAP kinase 5                                           283   2e-91    Oryza sativa f. spontanea
ref|XP_006828303.1|  hypothetical protein AMTR_s00023p00233730          286   4e-91    Amborella trichopoda
dbj|BAC53771.1|  wound-inuduced protein kinase                          286   4e-91    Nicotiana benthamiana
dbj|BAM13299.1|  MAP kinase 5                                           282   5e-91    Oryza brachyantha
ref|XP_009624465.1|  PREDICTED: mitogen-activated protein kinase ...    280   6e-91    Nicotiana tomentosiformis
dbj|BAM13294.1|  MAP kinase 5                                           281   6e-91    Oryza punctata
gb|KJB24766.1|  hypothetical protein B456_004G159400                    285   6e-91    Gossypium raimondii
ref|XP_004143889.1|  PREDICTED: mitogen-activated protein kinase ...    285   8e-91    Cucumis sativus [cucumbers]
ref|XP_007051730.1|  MAP kinase 4                                       285   9e-91    
gb|AJA29676.1|  mitogen-activated protein kinase 18                     285   9e-91    Gossypium hirsutum [American cotton]
gb|AAV68711.1|  mitogen-activated protein kinase 3                      285   9e-91    Chorispora bungeana
gb|AJP75153.1|  mitogen-activated protein kinase 4                      285   9e-91    Gossypium hirsutum [American cotton]
gb|AFW88747.1|  putative MAP kinase family protein                      283   1e-90    
gb|AAL87690.1|AF479884_1  MAP kinase MAPK5b                             281   1e-90    Oryza sativa [red rice]
ref|XP_008660261.1|  PREDICTED: mitogen-activated protein kinase ...    283   1e-90    Zea mays [maize]
gb|KJB06428.1|  hypothetical protein B456_001G1588001                   282   1e-90    Gossypium raimondii
gb|AAK01710.1|AF332873_1  MAP kinase BIMK1                              284   2e-90    Oryza sativa Indica Group [Indian rice]
gb|KFK30715.1|  hypothetical protein AALP_AA6G018100                    284   2e-90    Arabis alpina [alpine rockcress]
ref|XP_010512256.1|  PREDICTED: mitogen-activated protein kinase ...    285   2e-90    Camelina sativa [gold-of-pleasure]
gb|KHG15311.1|  Mitogen-activated protein kinase 4                      284   2e-90    Gossypium arboreum [tree cotton]
gb|AJA29674.1|  mitogen-activated protein kinase 16                     283   3e-90    Gossypium hirsutum [American cotton]
ref|XP_001763232.1|  predicted protein                                  284   3e-90    
dbj|BAM13297.1|  MAP kinase 5                                           280   3e-90    Oryza latifolia
gb|KJB20599.1|  hypothetical protein B456_003G155700                    278   4e-90    Gossypium raimondii
gb|KJB20598.1|  hypothetical protein B456_003G155700                    279   5e-90    Gossypium raimondii
gb|ADT91692.1|  mitogen-activated protein kinase 4                      283   5e-90    Nicotiana attenuata
gb|AGD94958.1|  mitogen-activated protein kinase                        283   5e-90    Lilium regale
gb|ADQ85914.1|  mitogen-activated protein kinase                        283   6e-90    Ipomoea batatas [batate]
ref|XP_010469270.1|  PREDICTED: mitogen-activated protein kinase ...    281   6e-90    
ref|XP_009767886.1|  PREDICTED: mitogen-activated protein kinase ...    283   6e-90    Nicotiana sylvestris
ref|XP_002976336.1|  hypothetical protein SELMODRAFT_449423             283   7e-90    
gb|AAO16999.1|  Putative MAP kinase 1                                   282   7e-90    Oryza sativa Japonica Group [Japonica rice]
emb|CAA73323.1|  MAP kinase I                                           283   7e-90    Petroselinum crispum
ref|XP_002304516.2|  MAP kinase family protein                          282   8e-90    
ref|XP_010055688.1|  PREDICTED: mitogen-activated protein kinase ...    283   8e-90    Eucalyptus grandis [rose gum]
ref|XP_006649891.1|  PREDICTED: mitogen-activated protein kinase ...    282   9e-90    Oryza brachyantha
gb|ABS11090.1|  MAP kinase                                              282   9e-90    Triticum aestivum [Canadian hard winter wheat]
gb|AAC28850.1|  MAP kinase homolog                                      282   9e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010419634.1|  PREDICTED: mitogen-activated protein kinase 4      282   1e-89    Camelina sativa [gold-of-pleasure]
ref|NP_001234266.1|  mitogen-activated protein kinase 5                 279   1e-89    
gb|EPS72198.1|  mitogen-activated protein kinase                        282   1e-89    Genlisea aurea
ref|XP_006419019.1|  hypothetical protein EUTSA_v10002582mg             282   1e-89    Eutrema salsugineum [saltwater cress]
ref|XP_007135122.1|  hypothetical protein PHAVU_010G102800g             282   1e-89    Phaseolus vulgaris [French bean]
ref|NP_001288546.1|  mitogen-activated protein kinase 5                 282   1e-89    Zea mays [maize]
gb|AAB61033.1|  MAP Kinase                                              281   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984821.1|  PREDICTED: mitogen-activated protein kinase ...    282   1e-89    Setaria italica
gb|ACG38361.1|  MPK3 - putative MAPK                                    282   1e-89    Zea mays [maize]
ref|XP_010276898.1|  PREDICTED: mitogen-activated protein kinase ...    282   1e-89    Nelumbo nucifera [Indian lotus]
gb|EYU32160.1|  hypothetical protein MIMGU_mgv1a0097901mg               277   1e-89    Erythranthe guttata [common monkey flower]
emb|CAC13967.1|  MAPK2 protein                                          282   1e-89    Oryza sativa [red rice]
ref|XP_007209255.1|  hypothetical protein PRUPE_ppa007254mg             282   1e-89    Prunus persica
ref|XP_011089373.1|  PREDICTED: mitogen-activated protein kinase 3      282   1e-89    Sesamum indicum [beniseed]
gb|KJB20602.1|  hypothetical protein B456_003G155700                    280   1e-89    Gossypium raimondii
ref|NP_001049770.1|  Os03g0285800                                       282   1e-89    
gb|ABH01189.1|  mitogen activated protein kinase 3                      282   1e-89    Oryza sativa Indica Group [Indian rice]
gb|AAD37790.1|AF149424_1  MAP kinase                                    281   2e-89    Ipomoea batatas [batate]
gb|KDP28586.1|  hypothetical protein JCGZ_14357                         281   2e-89    Jatropha curcas
dbj|BAE46985.1|  mitogen-activated protein kinase                       282   2e-89    Nicotiana tabacum [American tobacco]
gb|KJB20603.1|  hypothetical protein B456_003G155700                    278   2e-89    Gossypium raimondii
ref|XP_011092840.1|  PREDICTED: mitogen-activated protein kinase ...    281   2e-89    Sesamum indicum [beniseed]
ref|XP_002278860.1|  PREDICTED: mitogen-activated protein kinase ...    281   2e-89    Vitis vinifera
ref|XP_010427457.1|  PREDICTED: mitogen-activated protein kinase ...    281   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006598940.1|  PREDICTED: mitogen-activated protein kinase ...    281   2e-89    
ref|XP_006396275.1|  hypothetical protein EUTSA_v10028738mg             281   3e-89    
ref|XP_008790283.1|  PREDICTED: mitogen-activated protein kinase ...    281   3e-89    
ref|XP_010919113.1|  PREDICTED: mitogen-activated protein kinase 2      281   3e-89    
gb|EYU23463.1|  hypothetical protein MIMGU_mgv1a008362mg                281   3e-89    
dbj|BAJ33841.1|  unnamed protein product                                281   3e-89    
gb|KHG30595.1|  Mitogen-activated protein kinase 2                      281   3e-89    
ref|XP_003532933.1|  PREDICTED: mitogen-activated protein kinase ...    281   3e-89    
ref|NP_001242364.1|  uncharacterized protein LOC100786554               281   3e-89    
gb|KHN26933.1|  Mitogen-activated protein kinase like MMK2              281   3e-89    
gb|AEQ28763.1|  mitogen-activated protein kinase 1                      281   3e-89    
gb|KJB20600.1|  hypothetical protein B456_003G155700                    280   3e-89    
gb|KHN46703.1|  Mitogen-activated protein kinase like MMK2              281   3e-89    
ref|XP_007218147.1|  hypothetical protein PRUPE_ppa007306mg             281   3e-89    
gb|EYU18887.1|  hypothetical protein MIMGU_mgv1a008230mg                281   3e-89    
ref|XP_011022625.1|  PREDICTED: mitogen-activated protein kinase ...    281   3e-89    
gb|AHN53385.1|  MAPK4_2 protein                                         281   3e-89    
ref|XP_010089054.1|  Mitogen-activated protein kinase 4                 281   3e-89    
ref|XP_006584732.1|  PREDICTED: mitogen-activated protein kinase ...    281   3e-89    
gb|KDP25391.1|  hypothetical protein JCGZ_20547                         281   3e-89    
ref|XP_009363400.1|  PREDICTED: mitogen-activated protein kinase ...    281   4e-89    
ref|XP_006290113.1|  hypothetical protein CARUB_v10003760mg             281   4e-89    
gb|ABR46148.1|  mitogen-activated protein kinase 4                      281   4e-89    
ref|XP_006444977.1|  hypothetical protein CICLE_v10020645mg             276   4e-89    
ref|XP_010456244.1|  PREDICTED: mitogen-activated protein kinase ...    281   5e-89    
ref|NP_192046.1|  mitogen-activated protein kinase 4                    281   5e-89    
emb|CAA56314.1|  MAP KINASE                                             280   6e-89    
ref|XP_002874986.1|  mitogen-activated protein kinase 4                 280   6e-89    
gb|AHY02157.1|  mitogen-activated protein kinase 4                      280   6e-89    
gb|KJB20597.1|  hypothetical protein B456_003G155700                    280   7e-89    
gb|EYU35104.1|  hypothetical protein MIMGU_mgv1a008501mg                280   7e-89    
gb|ABR46162.1|  mitogen-activated protein kinase 4                      280   8e-89    
gb|AAF81419.1|  MAP kinase 1                                            280   8e-89    
ref|XP_010323646.1|  PREDICTED: mitogen-activated protein kinase ...    280   8e-89    
gb|ABR46146.1|  mitogen-activated protein kinase 4                      280   9e-89    
gb|KHN29324.1|  Mitogen-activated protein kinase like MMK2              280   9e-89    
ref|NP_001266826.1|  uncharacterized protein LOC100837420               279   1e-88    
ref|XP_006444978.1|  hypothetical protein CICLE_v10020645mg             277   1e-88    
gb|AGU91420.1|  mitogen-activated protein kinase 4                      278   2e-88    
ref|XP_010544396.1|  PREDICTED: mitogen-activated protein kinase ...    279   2e-88    
gb|AID46463.1|  MAP kinase 2                                            279   2e-88    
ref|XP_010676423.1|  PREDICTED: mitogen-activated protein kinase ...    279   2e-88    
ref|XP_010255643.1|  PREDICTED: mitogen-activated protein kinase ...    278   2e-88    
ref|NP_001140308.1|  uncharacterized protein LOC100272353               279   2e-88    
ref|XP_007160100.1|  hypothetical protein PHAVU_002G292400g             279   2e-88    
ref|XP_011093115.1|  PREDICTED: mitogen-activated protein kinase ...    276   2e-88    
gb|ABG54331.1|  double HA-tagged mitogen activated protein kinase 4     280   2e-88    
gb|AJA29681.1|  mitogen-activated protein kinase 27                     279   2e-88    
dbj|BAA04867.1|  MAP kinase                                             279   2e-88    
ref|XP_003525376.1|  PREDICTED: mitogen-activated protein kinase ...    279   2e-88    
gb|ACF83548.1|  unknown                                                 279   2e-88    
ref|XP_009604282.1|  PREDICTED: mitogen-activated protein kinase ...    279   3e-88    
ref|XP_010112959.1|  Mitogen-activated protein kinase-MMK2-like p...    278   3e-88    
ref|XP_002511904.1|  big map kinase/bmk, putative                       278   3e-88    
ref|XP_011093114.1|  PREDICTED: mitogen-activated protein kinase ...    276   3e-88    
ref|XP_009134529.1|  PREDICTED: mitogen-activated protein kinase 4      278   4e-88    
ref|NP_001241378.1|  uncharacterized protein LOC100803024               278   4e-88    
ref|XP_010253473.1|  PREDICTED: mitogen-activated protein kinase ...    278   4e-88    
ref|XP_008238948.1|  PREDICTED: mitogen-activated protein kinase ...    278   4e-88    
ref|NP_001242213.1|  uncharacterized protein LOC100815697               278   4e-88    
ref|XP_006491167.1|  PREDICTED: mitogen-activated protein kinase ...    278   5e-88    
gb|AJA29670.1|  mitogen-activated protein kinase 10                     278   5e-88    
ref|XP_002509851.1|  big map kinase/bmk, putative                       278   5e-88    
ref|XP_003534546.1|  PREDICTED: mitogen-activated protein kinase ...    278   6e-88    
gb|ACE80627.1|  MAP kinase 4                                            278   6e-88    
gb|ADP24129.1|  mitogen-activaed protein kinase 4                       278   6e-88    
gb|ABB69023.1|  mitogen-activated protein kinase 4                      278   7e-88    
gb|KHM99338.1|  Mitogen-activated protein kinase like MMK2              277   8e-88    
ref|XP_009349811.1|  PREDICTED: mitogen-activated protein kinase ...    277   8e-88    
ref|XP_004306748.1|  PREDICTED: mitogen-activated protein kinase ...    277   9e-88    
ref|XP_006476505.1|  PREDICTED: mitogen-activated protein kinase ...    277   9e-88    
gb|KDO76321.1|  hypothetical protein CISIN_1g017083mg                   274   9e-88    
ref|XP_006444976.1|  hypothetical protein CICLE_v10020645mg             277   1e-87    
gb|ABM55743.1|  mitogen-associated protein kinase 2                     273   1e-87    
ref|XP_004298829.1|  PREDICTED: mitogen-activated protein kinase ...    277   1e-87    
ref|XP_004294692.1|  PREDICTED: mitogen-activated protein kinase ...    276   1e-87    
gb|AAN65180.1|  mitogen-activated protein kinase 4                      277   1e-87    
sp|Q40353.1|MMK2_MEDSA  RecName: Full=Mitogen-activated protein k...    276   1e-87    
gb|KJB49445.1|  hypothetical protein B456_008G120100                    273   2e-87    
gb|ADI52627.1|  mitogen-activated protein kinase 4                      276   2e-87    
ref|XP_006439486.1|  hypothetical protein CICLE_v10020633mg             276   2e-87    
ref|XP_011093113.1|  PREDICTED: mitogen-activated protein kinase ...    276   2e-87    
ref|XP_006292783.1|  hypothetical protein CARUB_v10019032mg             277   2e-87    
gb|KDO76320.1|  hypothetical protein CISIN_1g017083mg                   275   2e-87    
ref|XP_008232995.1|  PREDICTED: mitogen-activated protein kinase ...    276   2e-87    
ref|XP_009104224.1|  PREDICTED: mitogen-activated protein kinase ...    276   2e-87    
gb|AAW65993.1|  mitogen-activated protein kinase                        276   2e-87    
emb|CDP12066.1|  unnamed protein product                                276   3e-87    
emb|CDP20377.1|  unnamed protein product                                276   3e-87    
ref|XP_006439487.1|  hypothetical protein CICLE_v10020633mg             276   3e-87    
ref|XP_003624049.1|  Mitogen-activated protein kinase                   276   3e-87    
gb|AFK35403.1|  unknown                                                 276   3e-87    
ref|XP_007158526.1|  hypothetical protein PHAVU_002G159500g             274   4e-87    
ref|XP_009345123.1|  PREDICTED: mitogen-activated protein kinase ...    276   4e-87    
ref|XP_002298015.2|  hypothetical protein POPTR_0001s09800g             272   5e-87    
ref|XP_009366541.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    276   5e-87    
ref|XP_008358115.1|  PREDICTED: mitogen-activated protein kinase ...    275   5e-87    
ref|XP_008343413.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    276   5e-87    
ref|XP_009395432.1|  PREDICTED: mitogen-activated protein kinase 2      275   5e-87    
gb|KFK31909.1|  hypothetical protein AALP_AA6G174800                    275   7e-87    
ref|XP_006287960.1|  hypothetical protein CARUB_v10001195mg             275   8e-87    
ref|XP_010112322.1|  Mitogen-activated protein kinase-NTF6-like p...    275   9e-87    
gb|ABR10070.1|  MAPK                                                    275   9e-87    
gb|KJB49444.1|  hypothetical protein B456_008G120100                    275   9e-87    
ref|XP_008375978.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    276   9e-87    
ref|XP_007040337.1|  MAP kinase 4                                       275   1e-86    
emb|CDX67813.1|  BnaA07g18530D                                          277   1e-86    
gb|AEX49899.1|  mitogen-activated protein kinase 4                      274   2e-86    
ref|XP_010934938.1|  PREDICTED: mitogen-activated protein kinase ...    272   2e-86    
gb|AGS78126.1|  mitogen activated protein kinase 5                      274   2e-86    
ref|XP_010669962.1|  PREDICTED: mitogen-activated protein kinase ...    273   2e-86    
ref|XP_007158527.1|  hypothetical protein PHAVU_002G159500g             274   2e-86    
ref|XP_011080918.1|  PREDICTED: mitogen-activated protein kinase ...    274   2e-86    
ref|XP_011029347.1|  PREDICTED: mitogen-activated protein kinase ...    274   2e-86    
ref|XP_010934937.1|  PREDICTED: mitogen-activated protein kinase ...    272   2e-86    
ref|NP_001274898.1|  mitogen-activated protein kinase homolog MMK...    273   3e-86    
ref|XP_011036902.1|  PREDICTED: mitogen-activated protein kinase ...    273   3e-86    
ref|NP_001233767.1|  mitogen-activated protein kinase 4                 273   3e-86    
ref|XP_004510752.1|  PREDICTED: mitogen-activated protein kinase ...    273   4e-86    
ref|XP_010055090.1|  PREDICTED: mitogen-activated protein kinase ...    273   4e-86    
gb|ABR46165.1|  mitogen-activated protein kinase 4                      273   4e-86    
ref|XP_004492784.1|  PREDICTED: mitogen-activated protein kinase ...    273   4e-86    
ref|NP_001240234.1|  uncharacterized protein LOC100802929               273   5e-86    
ref|XP_003622463.1|  Mitogen-activated protein kinase                   273   5e-86    
ref|XP_006424692.1|  hypothetical protein CICLE_v10028684mg             272   6e-86    
ref|XP_010934936.1|  PREDICTED: mitogen-activated protein kinase ...    272   7e-86    
ref|XP_010435057.1|  PREDICTED: mitogen-activated protein kinase ...    271   7e-86    
ref|XP_006488210.1|  PREDICTED: mitogen-activated protein kinase ...    272   7e-86    
ref|XP_009628879.1|  PREDICTED: mitogen-activated protein kinase ...    272   8e-86    
ref|XP_010556563.1|  PREDICTED: mitogen-activated protein kinase 4      272   8e-86    
gb|ACF81402.1|  unknown                                                 269   9e-86    
ref|XP_004148790.1|  PREDICTED: mitogen-activated protein kinase ...    272   9e-86    
gb|KJB29908.1|  hypothetical protein B456_005G123100                    271   9e-86    
ref|XP_009354515.1|  PREDICTED: mitogen-activated protein kinase 13     272   1e-85    
ref|XP_008465285.1|  PREDICTED: mitogen-activated protein kinase ...    272   1e-85    
ref|XP_004169894.1|  PREDICTED: mitogen-activated protein kinase ...    272   1e-85    
ref|NP_001275185.1|  mitogen-activated protein kinase homolog NTF...    272   1e-85    
ref|XP_011089377.1|  PREDICTED: mitogen-activated protein kinase ...    271   1e-85    
ref|XP_006396920.1|  hypothetical protein EUTSA_v10028737mg             272   1e-85    
ref|XP_007206294.1|  hypothetical protein PRUPE_ppa007376mg             271   1e-85    
ref|XP_004511562.1|  PREDICTED: mitogen-activated protein kinase ...    271   1e-85    
ref|XP_002872577.1|  mitogen-activated protein kinase 5                 271   1e-85    
ref|XP_008794840.1|  PREDICTED: mitogen-activated protein kinase ...    273   2e-85    
ref|XP_004511561.1|  PREDICTED: mitogen-activated protein kinase ...    271   2e-85    
ref|NP_001233897.1|  mitogen-activated protein kinase 7                 271   2e-85    
ref|XP_010941156.1|  PREDICTED: mitogen-activated protein kinase ...    273   2e-85    
emb|CDX98395.1|  BnaC06g17560D                                          275   2e-85    
gb|AAN65181.1|  mitogen-activated protein kinase 3b                     271   2e-85    
gb|AAN75065.2|AF435805_1  mitogen-activated protein kinase              273   2e-85    
ref|XP_009358274.1|  PREDICTED: mitogen-activated protein kinase ...    271   2e-85    
emb|CAH05025.1|  putative MAP kinase                                    270   2e-85    
ref|XP_010544756.1|  PREDICTED: mitogen-activated protein kinase 12     271   2e-85    
ref|XP_002320818.1|  MAP kinase family protein                          271   3e-85    
ref|XP_004505940.1|  PREDICTED: mitogen-activated protein kinase ...    271   3e-85    
ref|XP_006662544.1|  PREDICTED: mitogen-activated protein kinase ...    270   3e-85    
ref|XP_011036909.1|  PREDICTED: mitogen-activated protein kinase ...    270   4e-85    
ref|XP_009382252.1|  PREDICTED: mitogen-activated protein kinase ...    270   4e-85    
ref|XP_002302599.1|  Mitogen-activated protein kinase 4                 270   4e-85    
gb|AIX47138.1|  MAPK1                                                   270   4e-85    
ref|XP_009793071.1|  PREDICTED: mitogen-activated protein kinase ...    271   4e-85    
gb|ACG31917.1|  MPK4 - putative MAPK                                    270   4e-85    
gb|AJA29680.1|  mitogen-activated protein kinase 26                     270   4e-85    
ref|XP_010435048.1|  PREDICTED: mitogen-activated protein kinase ...    270   5e-85    
ref|XP_010422087.1|  PREDICTED: mitogen-activated protein kinase ...    270   5e-85    
ref|NP_001105239.1|  salt-induced MAP kinase 1                          270   5e-85    
ref|NP_001117210.1|  mitogen-activated protein kinase 11                270   5e-85    
ref|XP_006829066.1|  hypothetical protein AMTR_s00001p00258560          270   5e-85    
ref|XP_004503681.1|  PREDICTED: mitogen-activated protein kinase ...    270   6e-85    
ref|XP_007132157.1|  hypothetical protein PHAVU_011G070800g             272   7e-85    
ref|XP_003538034.1|  PREDICTED: mitogen-activated protein kinase ...    270   9e-85    
ref|XP_010455540.1|  PREDICTED: mitogen-activated protein kinase ...    270   9e-85    
emb|CAB37188.1|  MAP kinase                                             270   9e-85    
gb|KHN35039.1|  Mitogen-activated protein kinase 4                      269   1e-84    
ref|XP_010689413.1|  PREDICTED: mitogen-activated protein kinase ...    269   1e-84    
ref|XP_009108179.1|  PREDICTED: mitogen-activated protein kinase 5      270   1e-84    
ref|XP_003606524.1|  Mitogen-activated protein kinase                   270   1e-84    
gb|KCW63920.1|  hypothetical protein EUGRSUZ_G01599                     269   1e-84    
ref|XP_010034613.1|  PREDICTED: mitogen-activated protein kinase ...    270   1e-84    
ref|XP_009396576.1|  PREDICTED: mitogen-activated protein kinase ...    270   1e-84    
ref|XP_002284710.1|  PREDICTED: mitogen-activated protein kinase ...    269   1e-84    
gb|KJB56031.1|  hypothetical protein B456_009G103800                    265   1e-84    
gb|AGH89467.1|  mitogen-activated protein kinase 1                      269   1e-84    
ref|XP_008222472.1|  PREDICTED: mitogen-activated protein kinase ...    269   1e-84    
gb|AFP20226.1|  MAP kinase                                              269   1e-84    
gb|EYU18893.1|  hypothetical protein MIMGU_mgv1a008467mg                269   1e-84    
ref|XP_007016636.1|  Kinase superfamily protein isoform 1               269   1e-84    
gb|ABG54338.1|  double HA-tagged mitogen activated protein kinase 11    269   2e-84    
ref|XP_006345585.1|  PREDICTED: mitogen-activated protein kinase ...    266   2e-84    
ref|XP_002467591.1|  hypothetical protein SORBIDRAFT_01g030680          269   2e-84    
ref|XP_003538304.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    269   2e-84    
ref|XP_010480147.1|  PREDICTED: mitogen-activated protein kinase ...    268   2e-84    
gb|AAN77146.1|  mitogen-activated protein kinase                        264   2e-84    
ref|XP_006659134.1|  PREDICTED: mitogen-activated protein kinase ...    269   3e-84    
dbj|BAJ97968.1|  predicted protein                                      268   4e-84    
gb|AFP20227.1|  MAP kinase                                              268   4e-84    
gb|ABK59683.1|  At4g11330                                               264   4e-84    
gb|KJB56030.1|  hypothetical protein B456_009G103800                    265   4e-84    
gb|KHG15804.1|  Mitogen-activated protein kinase NTF6                   268   4e-84    
ref|XP_003574247.1|  PREDICTED: mitogen-activated protein kinase 6      268   4e-84    
ref|XP_008796912.1|  PREDICTED: mitogen-activated protein kinase ...    267   4e-84    
gb|AGA37188.1|  mitogen-activated protein kinase 5.1                    268   5e-84    
emb|CDP08955.1|  unnamed protein product                                268   6e-84    
gb|EEC82924.1|  hypothetical protein OsI_27877                          268   7e-84    
gb|KEH21120.1|  MAP kinase                                              268   7e-84    
gb|KHG05791.1|  Mitogen-activated protein kinase 4                      268   7e-84    
dbj|BAC99508.1|  putative mitogen-activated protein kinase 4            268   8e-84    
ref|XP_008796911.1|  PREDICTED: mitogen-activated protein kinase ...    267   8e-84    
ref|XP_006345584.1|  PREDICTED: mitogen-activated protein kinase ...    267   9e-84    
gb|AHN53384.1|  MAPK4_1 protein                                         267   9e-84    
ref|NP_001061028.2|  Os08g0157000                                       268   9e-84    
ref|NP_001234660.1|  mitogen-activated protein kinase 6                 267   9e-84    
gb|AJA29671.1|  mitogen-activated protein kinase 12                     267   9e-84    
ref|XP_003611065.1|  Mitogen-activated protein kinase                   267   9e-84    
ref|NP_001065156.1|  Os10g0533600                                       267   1e-83    
ref|XP_008458174.1|  PREDICTED: mitogen-activated protein kinase ...    267   1e-83    
gb|AAM88622.1|  putative serine/threonine protein kinase                267   1e-83    
gb|AIU98492.1|  mitogen-activated protein kinase                        266   1e-83    
gb|AHH30831.1|  mitogen-activated protein kinase 4                      266   2e-83    
gb|AIP87138.1|  mitogen-activated protein kinase                        266   2e-83    
dbj|BAG31942.1|  MAP kinase                                             266   2e-83    
emb|CDY18876.1|  BnaC04g04740D                                          266   2e-83    



>ref|XP_009770220.1| PREDICTED: mitogen-activated protein kinase homolog NTF4 [Nicotiana 
sylvestris]
 gb|AAB58396.1| salicylic acid-activated MAP kinase [Nicotiana tabacum]
Length=393

 Score =   380 bits (976),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVHPTAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVEGALAHPYL SLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRRRITVEGALAHPYLNSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  381  RESLAFNPEYQH  392



>ref|XP_006351058.1| PREDICTED: mitogen-activated protein kinase homolog NTF4-like 
[Solanum tuberosum]
Length=395

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVEGALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRLTVEGALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQQ  206
            RE +AFNPE+ Q 
Sbjct  382  REGLAFNPEYHQH  394



>gb|AAP20419.1| mitogen-activated protein kinase 1 [Solanum lycopersicum]
Length=396

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 187/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH +P AID
Sbjct  264  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVNPAAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  324  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE+++
Sbjct  384  RESIAFNPEYQR  395



>ref|XP_009606346.1| PREDICTED: mitogen-activated protein kinase homolog NTF4 [Nicotiana 
tomentosiformis]
Length=393

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAID+WSVGCIF ELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDIWSVGCIFTELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVHPAAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVEGALAHPYL SLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRRRITVEGALAHPYLNSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  381  RESLAFNPEYQH  392



>ref|NP_001275321.1| mitogen-activated protein kinase homolog NTF4-like [Solanum tuberosum]
 dbj|BAB93529.1| mitogen-activated protein kinase [Solanum tuberosum]
Length=396

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH +P AID
Sbjct  264  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVNPAAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYL SLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  324  LVEKMLTFDPRRRITVEDALAHPYLASLHDISDEPICMTPFNFDFEQHALTEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE+++
Sbjct  384  RESIAFNPEYQR  395



>dbj|BAG50821.1| MAP kinase [Nicotiana benthamiana]
Length=394

 Score =   378 bits (971),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>ref|NP_001275113.1| mitogen-activated protein kinase homolog NTF4-like [Solanum tuberosum]
 dbj|BAB93530.1| mitogen-activated protein kinase [Solanum tuberosum]
Length=394

 Score =   378 bits (971),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVEGALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRLTVEGALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>gb|ABJ89812.1| salicylic acid-activated MAP kinase [Nicotiana attenuata]
Length=393

 Score =   378 bits (971),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPL RRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLNRRQSFTEKFPHVHPAAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVEGALAHPYL SLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRRRITVEGALAHPYLNSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  381  RESLAFNPEYQH  392



>dbj|BAG50820.1| MAP kinase [Nicotiana benthamiana]
Length=393

 Score =   378 bits (970),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVHPDAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVE MLTFDPRRRITVEGALAHPYL SLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVETMLTFDPRRRITVEGALAHPYLNSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  381  RESLAFNPEYQH  392



>dbj|BAC53772.1| salicylic acid-induced protein kinase [Nicotiana benthamiana]
Length=393

 Score =   378 bits (970),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVHPDAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVE MLTFDPRRRITVEGALAHPYL SLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVETMLTFDPRRRITVEGALAHPYLNSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  381  RESLAFNPEYQH  392



>gb|AHN53386.1| MAPK6 protein [Solanum tuberosum]
Length=396

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH +P AID
Sbjct  264  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVNPAAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHD SDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  324  LVEKMLTFDPRRRITVEDALAHPYLTSLHDSSDEPICMTPFNFDFEQHALTEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE+++
Sbjct  384  RESIAFNPEYQR  395



>ref|XP_008384112.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Malus domestica]
Length=403

 Score =   377 bits (969),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  211  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  270

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE++FLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  271  FPGRDHVHQLRLLMELIGTPSEAELQFLNENAKRYIRQLPLYRRQSFTEKFPHVHPSAID  330

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP RRITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHALSEEQMKELIY
Sbjct  331  LVEKMLTFDPTRRITVEDALAHPYLTSLHDISDEPXCLTPFSFDFEQHALSEEQMKELIY  390

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE+++Q
Sbjct  391  REALAFNPEYQRQ  403



>gb|ABB16417.1| mitogen-activated protein kinase Ntf4-1 [Nicotiana tabacum]
Length=394

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/192 (92%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E FPH +PGAID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVENFPHVNPGAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>gb|KHG06263.1| Mitogen-activated protein kinase NTF4 [Gossypium arboreum]
Length=399

 Score =   376 bits (966),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 177/193 (92%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSESDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQLPLYRRQSFTE+FP+ HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLYRRQSFTEKFPNVHPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE+ QQ
Sbjct  387  REALAFNPEYLQQ  399



>gb|ABB16418.1| mitogen-activated protein kinase Ntf4-2 [Nicotiana tabacum]
Length=392

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  200  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  259

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  260  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  319

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  320  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  379

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  380  REGLAFNPEYQH  391



>ref|NP_001280856.1| mitogen-activated protein kinase homolog D5 [Malus domestica]
 gb|ACY82513.1| mitogen-activated protein kinase [Malus domestica]
Length=394

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE++FLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  262  FPGRDHVHQLRLLLELIGTPSEAELQFLNENAKRYIRQLPLYRRQSFTEKFPHVHPSAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHALSEEQMKELIY
Sbjct  322  LVEKMLTFDPTQRITVEDALAHPYLTSLHDISDEPVCTTPFSFDFEQHALSEEQMKELIY  381

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  382  REALAFNPEYQLQ  394



>ref|XP_008394276.1| PREDICTED: mitogen-activated protein kinase homolog D5 [Malus 
domestica]
Length=406

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  214  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  273

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE++FLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  274  FPGRDHVHQLRLLLELIGTPSEAELQFLNENAKRYIRQLPLYRRQSFTEKFPHVHPSAID  333

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHALSEEQMKELIY
Sbjct  334  LVEKMLTFDPTQRITVEDALAHPYLTSLHDISDEPVCTTPFSFDFEQHALSEEQMKELIY  393

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  394  REALAFNPEYQLQ  406



>sp|Q40532.1|NTF4_TOBAC RecName: Full=Mitogen-activated protein kinase homolog NTF4; 
AltName: Full=P45 [Nicotiana tabacum]
 emb|CAA58761.1| p45Ntf4 serine/threonine protein kinase [Nicotiana tabacum]
Length=393

 Score =   375 bits (964),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 176/192 (92%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  381  REGLAFNPEYQH  392



>ref|NP_001234011.1| Mitogen-activated protein kinase [Solanum lycopersicum]
 emb|CAD59691.1| Mitogen-activated protein kinase [Solanum lycopersicum]
Length=396

 Score =   375 bits (964),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 186/192 (97%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSETDFMTEYVVTRWYRGPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH +P AID
Sbjct  264  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVNPAAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  324  LVEKMLTFDPRRRITVEDALAHPYLTSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE+++
Sbjct  384  RESIAFNPEYQR  395



>gb|AHX99575.1| mitogen-activated protein kinase 6 [Betula platyphylla]
Length=393

 Score =   375 bits (964),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA+  FLNENAK+YIRQLPL+RRQSFTE+FPH HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEADFGFLNENAKRYIRQLPLHRRQSFTEKFPHVHPAAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRQRITVEGALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  381  REALAFNPEYQHQ  393



>ref|NP_001234355.1| mitogen-activated protein kinase 2 [Solanum lycopersicum]
 gb|AAP20420.1| mitogen-activated protein kinase 2 [Solanum lycopersicum]
Length=394

 Score =   375 bits (963),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRLTVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>gb|AAF81420.1| MAP kinase 2 [Capsicum annuum]
Length=394

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV QLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVQQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRLTVEDALAHPYLTSLHDISDEPVCTTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>gb|AJA29666.1| mitogen-activated protein kinase 6 [Gossypium hirsutum]
 gb|KJB29906.1| hypothetical protein B456_005G123100 [Gossypium raimondii]
Length=399

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 187/193 (97%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSESDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQLPLYRR+SFTE+FP+ HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLYRRESFTEKFPNVHPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE+ QQ
Sbjct  387  REALAFNPEYLQQ  399



>sp|Q06060.1|MPK_PEA RecName: Full=Mitogen-activated protein kinase homolog D5 [Pisum 
sativum]
 emb|CAA50036.1| MAP kinase homologue [Pisum sativum]
Length=394

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  203  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  262

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  263  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  322

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHAL+EEQMKELIY
Sbjct  323  LVEKMLTFDPRQRITVENALAHPYLTSLHDISDEPVCTTPFSFDFEQHALTEEQMKELIY  382

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  383  REALAFNPEYQQ  394



>emb|CAC79662.1| mitogen activated protein kinase [Capsicum annuum]
Length=392

 Score =   374 bits (960),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGL RVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  200  KICDFGLVRVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  259

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRL+MELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSFTE+FPH +P AID
Sbjct  260  FPGRDHVHQLRLIMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFTEKFPHVNPAAID  319

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE  LAHPYL SLHDISDEP CTTPF+FDFEQHAL+EEQMKELIY
Sbjct  320  LVEKMLTFDPRRRITVEDTLAHPYLASLHDISDEPICTTPFSFDFEQHALTEEQMKELIY  379

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++ 
Sbjct  380  RESIAFNPEYQH  391



>ref|XP_002524853.1| big map kinase/bmk, putative [Ricinus communis]
 gb|EEF37477.1| big map kinase/bmk, putative [Ricinus communis]
Length=402

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  210  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  269

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLPLYRRQSFT++FP+ HP AID
Sbjct  270  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPLYRRQSFTDKFPNVHPAAID  329

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHAL+E+QMKELIY
Sbjct  330  LVEKMLTFDPRLRITVEDALAHPYLTSLHDISDEPVCTTPFSFDFEQHALTEDQMKELIY  389

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++QQ
Sbjct  390  REALAFNPEYQQQ  402



>ref|NP_001235426.1| mitogen-activated protein kinase 2 [Glycine max]
 ref|XP_006574473.1| PREDICTED: mitogen-activated protein kinase 2 isoform X1 [Glycine 
max]
 ref|XP_006574474.1| PREDICTED: mitogen-activated protein kinase 2 isoform X2 [Glycine 
max]
 gb|AAQ14867.1|AF329506_1 mitogen-activated protein kinase 2 [Glycine max]
Length=391

 Score =   374 bits (960),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  200  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  259

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  260  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  319

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  320  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  379

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  380  REALAFNPEYQQ  391



>ref|XP_009366225.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Pyrus 
x bretschneideri]
Length=403

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 185/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELMDRKPL
Sbjct  211  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMDRKPL  270

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE++FLNENAK+YIRQLPLYRRQSFTE+FPH HP AID
Sbjct  271  FPGRDHVHQLRLLMELIGTPSEAELQFLNENAKRYIRQLPLYRRQSFTEKFPHVHPSAID  330

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP RRITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  331  LVEKMLTFDPTRRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  390

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+++
Sbjct  391  REALAFNPEYQR  402



>gb|ACG60597.1| mitogen activated protein kinase 2 [Solanum peruvianum]
Length=394

 Score =   372 bits (955),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCI MELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCISMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAK+YIRQLPLYRRQSF E+FPH +P AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKRYIRQLPLYRRQSFVEKFPHVNPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRRRLTVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++ 
Sbjct  382  REGLAFNPEYQH  393



>emb|CBI24707.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   370 bits (949),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  138  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTVAIDVWSVGCIFMELMDRKPL  197

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLP+YRRQ+FTE+FP  HP AID
Sbjct  198  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPIYRRQTFTEKFPQVHPVAID  257

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHALSEEQMKELIY
Sbjct  258  LVEKMLTFDPRQRITVEEALAHPYLTSLHDISDEPICTTPFSFDFEQHALSEEQMKELIY  317

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++ 
Sbjct  318  REALAFNPEYQN  329



>gb|ADT65136.1| mitogen-activated protein kinase [Gossypium hirsutum]
 gb|ADT65137.1| mitogen-activated protein kinase [Gossypium hirsutum]
Length=399

 Score =   372 bits (955),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSESDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQLPLYRRQSFTE+FP+  P AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLYRRQSFTEKFPNVPPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE+ QQ
Sbjct  387  REALAFNPEYLQQ  399



>ref|XP_004505140.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X1 [Cicer arietinum]
 ref|XP_004505141.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X2 [Cicer arietinum]
Length=393

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 184/192 (96%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  382  REALAFNPEYQQ  393



>gb|AAN65179.1| mitogen-activated protein kinase 6 [Petroselinum crispum]
Length=387

 Score =   370 bits (951),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  195  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  254

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQLPLYRRQS TE+FP+ HP AID
Sbjct  255  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLYRRQSLTEKFPNVHPSAID  314

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRR+TVE ALAHPYLTSLHDISDEP C  PF+FDFEQHAL+EEQM+ELIY
Sbjct  315  LVEKMLTFDPRRRLTVEDALAHPYLTSLHDISDEPVCAAPFSFDFEQHALTEEQMRELIY  374

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE +Q
Sbjct  375  REALAFNPEHQQ  386



>emb|CDP08056.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   371 bits (952),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  211  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTTAIDVWSVGCIFMELMDRKPL  270

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  271  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFGEKFPHVHPAAID  330

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  331  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  390

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  391  REALAFNPEYQQ  402



>ref|XP_007033688.1| Mitogen-activated protein kinase 6 [Theobroma cacao]
 gb|EOY04614.1| Mitogen-activated protein kinase 6 [Theobroma cacao]
Length=427

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  235  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  294

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLPLYRRQSFTE+FP  HP AID
Sbjct  295  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPLYRRQSFTEKFPSVHPLAID  354

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  355  LVEKMLTFDPRQRITVEAALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  414

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE+ QQ
Sbjct  415  REALAFNPEYMQQ  427



>gb|KCW63919.1| hypothetical protein EUGRSUZ_G01599 [Eucalyptus grandis]
Length=279

 Score =   366 bits (939),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  88   KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  147

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV QLRLLMELIGTPSEAE+ FLNENAKKYIRQLPLYRRQSFTE+FPH HP AID
Sbjct  148  FPGRDHVQQLRLLMELIGTPSEAELGFLNENAKKYIRQLPLYRRQSFTEKFPHVHPLAID  207

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR R+TVE ALAHPYL SLHDISDEP+C  PFNFDFEQHAL+EEQM+ELIY
Sbjct  208  LVEKMLTFDPRLRLTVEEALAHPYLNSLHDISDEPTCMNPFNFDFEQHALTEEQMRELIY  267

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  268  REALAFNPEYLQ  279



>gb|KHN32349.1| Mitogen-activated protein kinase like MMK1 [Glycine soja]
Length=430

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  239  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  298

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYR QSF E+FPH HP AID
Sbjct  299  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRCQSFQEKFPHVHPEAID  358

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  359  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEQHALTEEQMKELIY  418

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  419  REALAFNPEYQQ  430



>ref|XP_011097634.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
homolog MMK1-like [Sesamum indicum]
Length=394

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/192 (91%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLP YRRQSFTE+FP  HP AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPPYRRQSFTEKFPQVHPLAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP CTTPF+FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRQRITVEDALAHPYLNSLHDISDEPVCTTPFSFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  382  REALAFNPEYQQ  393



>ref|XP_006583849.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoform 
X2 [Glycine max]
Length=392

 Score =   368 bits (945),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  321  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCLTPFSFDFEQHALTEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            REA+AFN E++Q
Sbjct  381  REALAFNLEYQQ  392



>gb|KHN31012.1| Mitogen-activated protein kinase like MMK1 [Glycine soja]
Length=391

 Score =   368 bits (945),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  200  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  259

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  260  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  319

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  320  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCLTPFSFDFEQHALTEEQMKELIY  379

Query  244  REAVAFNPEFEQ  209
            REA+AFN E++Q
Sbjct  380  REALAFNLEYQQ  391



>ref|XP_003529369.1| PREDICTED: mitogen-activated protein kinase homolog D5-like isoformX1 
[Glycine max]
Length=433

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  242  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  301

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FPH HP AID
Sbjct  302  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPHVHPEAID  361

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  362  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCLTPFSFDFEQHALTEEQMKELIY  421

Query  244  REAVAFNPEFEQ  209
            REA+AFN E++Q
Sbjct  422  REALAFNLEYQQ  433



>ref|XP_010650725.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Vitis 
vinifera]
Length=398

 Score =   368 bits (944),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  206  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTVAIDVWSVGCIFMELMDRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLP+YRRQ+FTE+FP  HP AID
Sbjct  266  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPIYRRQTFTEKFPQVHPVAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP CTTPF+FDFEQHALSEEQMKELIY
Sbjct  326  LVEKMLTFDPRQRITVEEALAHPYLTSLHDISDEPICTTPFSFDFEQHALSEEQMKELIY  385

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++ 
Sbjct  386  REALAFNPEYQN  397



>ref|XP_011001813.1| PREDICTED: mitogen-activated protein kinase homolog NTF4-like 
[Populus euphratica]
Length=395

 Score =   367 bits (942),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  203  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTTAIDVWSVGCIFMELMDRKPL  262

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQLPL+ RQSF E+FP  HP AID
Sbjct  263  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLPLHHRQSFLEKFPTVHPAAID  322

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  323  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  382

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  383  REALAFNPEYQNQ  395



>ref|XP_010066116.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Eucalyptus 
grandis]
 gb|KCW63918.1| hypothetical protein EUGRSUZ_G01599 [Eucalyptus grandis]
Length=395

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV QLRLLMELIGTPSEAE+ FLNENAKKYIRQLPLYRRQSFTE+FPH HP AID
Sbjct  264  FPGRDHVQQLRLLMELIGTPSEAELGFLNENAKKYIRQLPLYRRQSFTEKFPHVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR R+TVE ALAHPYL SLHDISDEP+C  PFNFDFEQHAL+EEQM+ELIY
Sbjct  324  LVEKMLTFDPRLRLTVEEALAHPYLNSLHDISDEPTCMNPFNFDFEQHALTEEQMRELIY  383

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  384  REALAFNPEYLQ  395



>gb|AAF65766.1|AF242308_1 mitogen-activated protein kinase [Euphorbia esula]
Length=389

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  197  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  256

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+ FLNENAK+YIRQ+ ++RRQSFTE+FP  HP AID
Sbjct  257  FPGRDHVHQLRLLMELIGTPSEEELGFLNENAKRYIRQMSVFRRQSFTEKFPTVHPAAID  316

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  317  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  376

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++QQ
Sbjct  377  REALAFNPEYQQQ  389



>ref|XP_004287157.1| PREDICTED: mitogen-activated protein kinase homolog D5 [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAID+WSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDIWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPS+AE+ FLNENAK+YI+QLPLY RQSFTE+FP  HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPSDAELGFLNENAKRYIKQLPLYHRQSFTEKFPQVHPSAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTF+P +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHALSEEQMKELIY
Sbjct  319  LVEKMLTFNPSKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALSEEQMKELIY  378

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++Q 
Sbjct  379  REALAFNPEYQQH  391



>ref|XP_002323707.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
 gb|EEF03840.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
Length=399

 Score =   367 bits (941),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTTAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+EFLNENAK+YIRQL L+RRQSF E+FP  HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELEFLNENAKRYIRQLQLHRRQSFLEKFPTVHPAAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  387  REALAFNPEYQNQ  399



>ref|XP_007153722.1| hypothetical protein PHAVU_003G059500g [Phaseolus vulgaris]
 gb|ESW25716.1| hypothetical protein PHAVU_003G059500g [Phaseolus vulgaris]
Length=394

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  203  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  262

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLY RQS  E+FPH HP AID
Sbjct  263  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYLRQSLQEKFPHVHPEAID  322

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  323  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  382

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  383  REALAFNPEYQQ  394



>gb|AAZ23128.1| mitogen-activated protein kinase 1 [Arachis hypogaea]
Length=397

 Score =   366 bits (940),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/191 (90%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSET+FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSETNFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEA++ FLNENAK+YIRQLPLYRRQSF E+FP  HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEADLGFLNENAKRYIRQLPLYRRQSFQEKFPQVHPAAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPFNFDFE HAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFNFDFEHHALTEEQMKELIY  386

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  387  REALAFNPEYQ  397



>ref|XP_002310398.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
 gb|EEE90848.2| mitogen-activated protein kinase 7 [Populus trichocarpa]
Length=398

 Score =   366 bits (939),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 183/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELMDRKPL
Sbjct  207  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLPL+RRQSFTE+FP  HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPLHRRQSFTEKFPTVHPAAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  327  LIEKMLTFDPRQRITVEEALAHPYLTSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++ 
Sbjct  387  REALAFNPEYQN  398



>sp|Q07176.1|MMK1_MEDSA RecName: Full=Mitogen-activated protein kinase homolog MMK1; 
AltName: Full=MAP kinase ERK1; AltName: Full=MAP kinase MSK7 
[Medicago sativa]
 gb|AAB41548.1| MAP kinase [Medicago sativa]
 emb|CAA47099.1| MAP Kinase [Medicago sativa]
Length=387

 Score =   365 bits (938),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  196  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  255

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE ++ FLNENAK+YIRQLP YRRQSF E+FPH HP AID
Sbjct  256  FPGRDHVHQLRLLMELIGTPSEDDLGFLNENAKRYIRQLPPYRRQSFQEKFPHVHPEAID  315

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  316  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  375

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  376  REALAFNPEYQQ  387



>ref|XP_009358393.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Pyrus x bretschneideri]
Length=406

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  214  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  273

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSE E++FLNENAK+YIRQLP YRRQSFTE+FPH HP AID
Sbjct  274  FPGRDHVHQLRLLLELIGTPSEVELQFLNENAKRYIRQLPFYRRQSFTEKFPHVHPSAID  333

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LV+KMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  334  LVQKMLTFDPTQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  393

Query  244  REAVAFNPEF  215
            REA+AFNPE+
Sbjct  394  REALAFNPEY  403



>ref|XP_011047652.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
 ref|XP_011047653.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
 ref|XP_011047654.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Populus 
euphratica]
Length=396

 Score =   365 bits (938),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELMDRKPL
Sbjct  205  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV QLRLLMELIGTPSEAE+ FLNENAK+YI+QLPLYRRQSFTE+FP  HP AID
Sbjct  265  FPGRDHVQQLRLLMELIGTPSEAELGFLNENAKRYIQQLPLYRRQSFTEKFPTVHPAAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  325  LIEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPICMTPFSFDFEQHALTEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++ 
Sbjct  385  REALAFNPEYQN  396



>ref|XP_010101362.1| Mitogen-activated protein kinase-MMK1-like protein [Morus notabilis]
 gb|EXB88309.1| Mitogen-activated protein kinase-MMK1-like protein [Morus notabilis]
Length=393

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQL LYRRQSFTE+FPH HP AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLQLYRRQSFTEKFPHVHPLAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP   +PF FDFEQHAL+EEQMKELIY
Sbjct  322  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVSLSPFIFDFEQHALTEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  382  REALAFNPEYQQ  393



>ref|XP_008243044.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Prunus 
mume]
Length=407

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  215  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  274

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+ FLNENAK+YIRQLP +RRQS TE+FPH HP AID
Sbjct  275  FPGRDHVHQLRLLMELIGTPSETELGFLNENAKRYIRQLPPHRRQSLTEKFPHVHPSAID  334

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  335  LVEKMLTFDPTKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  394

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  395  REALAFNPEYQPQ  407



>ref|XP_007202173.1| hypothetical protein PRUPE_ppa006536mg [Prunus persica]
 gb|EMJ03372.1| hypothetical protein PRUPE_ppa006536mg [Prunus persica]
Length=407

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  215  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  274

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+ FLNENAK+YIRQLP +RRQS TE+FPH HP AID
Sbjct  275  FPGRDHVHQLRLLMELIGTPSETELGFLNENAKRYIRQLPPHRRQSLTEKFPHVHPSAID  334

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  335  LVEKMLTFDPTKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  394

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++ Q
Sbjct  395  REALAFNPEYQPQ  407



>gb|AHJ80962.1| mitogen-activated protein kinase 2 [Morus notabilis]
Length=398

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQL LYRRQSFTE+FPH HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLQLYRRQSFTEKFPHVHPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP   +PF FDFEQHAL+EEQMKELIY
Sbjct  327  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVSLSPFIFDFEQHALTEEQMKELIY  386

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  387  REALAFNPEYQQ  398



>ref|XP_008445484.1| PREDICTED: mitogen-activated protein kinase homolog D5 isoform 
X2 [Cucumis melo]
Length=356

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  164  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  223

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEA++ FLNENAK+YIRQLP Y RQSFTE+FPH HP AID
Sbjct  224  FPGRDHVHQLRLLLELIGTPSEADLGFLNENAKRYIRQLPYYHRQSFTEKFPHVHPAAID  283

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  284  LVEKMLTFDPGQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  343

Query  244  REAVAFNPEFEQQ  206
             EA+AFNPE+  Q
Sbjct  344  LEALAFNPEYHHQ  356



>ref|XP_003608100.1| Mitogen-activated protein kinase [Medicago truncatula]
 gb|AES90297.1| MAP kinase-like Ntf4 protein [Medicago truncatula]
Length=387

 Score =   363 bits (932),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  196  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  255

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE ++ FLNENAK+YIRQLP YRRQSF E+FP  HP AID
Sbjct  256  FPGRDHVHQLRLLMELIGTPSEDDLGFLNENAKRYIRQLPPYRRQSFQEKFPQVHPEAID  315

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  316  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  375

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  376  REALAFNPEYQQ  387



>gb|KDP35142.1| hypothetical protein JCGZ_10676 [Jatropha curcas]
Length=405

 Score =   363 bits (933),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  213  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  272

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQL LLMELIGTPSEAE+ FLNENAK+YIRQL LYRRQSFTE+FP  HP AID
Sbjct  273  FPGRDHVHQLHLLMELIGTPSEAELGFLNENAKRYIRQLRLYRRQSFTEKFPTIHPAAID  332

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  333  LVEKMLTFDPRQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  392

Query  244  REAVAFNPEFEQQ  206
             EA+AFNPE++ Q
Sbjct  393  GEALAFNPEYQHQ  405



>gb|AID46462.1| MAP kinase 1 [Vigna mungo]
Length=396

 Score =   363 bits (931),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE ++ FLNENAK+YIRQLP Y RQSF E+FPH HP AID
Sbjct  265  FPGRDHVHQLRLLMELIGTPSEDDLGFLNENAKRYIRQLPPYLRQSFQEKFPHVHPEAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  325  LVEKMLTFDPRKRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  385  REALAFNPEYQQ  396



>ref|XP_008445483.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 isoform 
X1 [Cucumis melo]
Length=405

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  213  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  272

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEA++ FLNENAK+YIRQLP Y RQSFTE+FPH HP AID
Sbjct  273  FPGRDHVHQLRLLLELIGTPSEADLGFLNENAKRYIRQLPYYHRQSFTEKFPHVHPAAID  332

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  333  LVEKMLTFDPGQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  392

Query  244  REAVAFNPEFEQQ  206
             EA+AFNPE+  Q
Sbjct  393  LEALAFNPEYHHQ  405



>gb|EYU23922.1| hypothetical protein MIMGU_mgv1a008052mg [Erythranthe guttata]
Length=386

 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDY+AAID+WSVGCIFMELMDRKPL
Sbjct  194  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYSAAIDIWSVGCIFMELMDRKPL  253

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLN+NAK+YIRQLP YRRQSF E+FPH HP AID
Sbjct  254  FPGRDHVHQLRLLMELIGTPSEAELGFLNDNAKRYIRQLPPYRRQSFIEKFPHVHPLAID  313

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVEGALAHPYL SLHDISDEP CT+PFNFDFEQ AL+EEQMK+LIY
Sbjct  314  LVEKMLTFDPRLRITVEGALAHPYLNSLHDISDEPVCTSPFNFDFEQQALTEEQMKDLIY  373

Query  244  REAVAFNPEFE  212
             E++AFNPE++
Sbjct  374  LESLAFNPEYQ  384



>ref|XP_010246606.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Nelumbo 
nucifera]
 ref|XP_010246608.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Nelumbo 
nucifera]
Length=395

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  203  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  262

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA++ F+NENAK+YIRQLP + RQSFTE+FPH HP AID
Sbjct  263  FPGRDHVHQLRLLMELIGTPTEADLGFVNENAKRYIRQLPRHIRQSFTEKFPHVHPAAID  322

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C+TPF+FDFEQHALSEEQMKELIY
Sbjct  323  LVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCSTPFSFDFEQHALSEEQMKELIY  382

Query  244  REAVAFNPEFEQQ  206
             EA+AFNPE+ QQ
Sbjct  383  LEALAFNPEYRQQ  395



>ref|XP_004144187.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Cucumis sativus]
 ref|XP_004163946.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Cucumis sativus]
 gb|KGN47626.1| hypothetical protein Csa_6G365750 [Cucumis sativus]
Length=405

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  213  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  272

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEA++ FLNENAK+YIRQLP Y RQSFTE+FPH HP AID
Sbjct  273  FPGRDHVHQLRLLLELIGTPSEADLGFLNENAKRYIRQLPHYHRQSFTEKFPHVHPAAID  332

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP +RITVE ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIY
Sbjct  333  LVEKMLTFDPGQRITVEDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIY  392

Query  244  REAVAFNPEFEQQ  206
             EA+AFNPE+  Q
Sbjct  393  LEALAFNPEYHHQ  405



>ref|XP_011074877.1| PREDICTED: mitogen-activated protein kinase homolog MMK1-like 
[Sesamum indicum]
Length=391

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLP YRRQSF ++FP  HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPPYRRQSFADKFPRVHPLAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHAL+E+QMKELIY
Sbjct  319  LVEKMLTFDPRQRITVEDALAHPYLNSLHDISDEPVCMTPFSFDFEQHALTEDQMKELIY  378

Query  244  REAVAFNPEFEQ  209
            RE++AFNPE++Q
Sbjct  379  RESLAFNPEYQQ  390



>gb|EYU22909.1| hypothetical protein MIMGU_mgv1a007972mg [Erythranthe guttata]
Length=389

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV SETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  197  KICDFGLARVNSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  256

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            F GRDHVHQLRLL+ELIGTPSEAE+  LN+NAK+YIRQLP YRRQSFT++FP  HP AID
Sbjct  257  FAGRDHVHQLRLLIELIGTPSEAELGLLNDNAKRYIRQLPTYRRQSFTDKFPQVHPLAID  316

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPR+RITVEGALAHPYL SLHDISDEP CTTPFNFDFEQHAL+EEQMKELIY
Sbjct  317  LIEKMLTFDPRQRITVEGALAHPYLNSLHDISDEPVCTTPFNFDFEQHALTEEQMKELIY  376

Query  244  REAVAFNPEFE  212
            REA+AFNP ++
Sbjct  377  REALAFNPAYQ  387



>ref|XP_006442196.1| hypothetical protein CICLE_v10020481mg [Citrus clementina]
 gb|ESR55436.1| hypothetical protein CICLE_v10020481mg [Citrus clementina]
Length=398

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  206  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLNENAKKYI QLP Y+RQSFTE+FP+ HP AID
Sbjct  266  FPGRDHVHQLRLLIELIGTPSEAELGFLNENAKKYICQLPRYQRQSFTEKFPNVHPSAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C +PF+FDFEQHAL+E QMKELIY
Sbjct  326  LVEKMLTFDPRQRITVEDALAHPYLGSLHDISDEPVCMSPFSFDFEQHALTEGQMKELIY  385

Query  244  REAVAFNPEFEQQ  206
            +EA+AFNPE+ QQ
Sbjct  386  QEALAFNPEYRQQ  398



>gb|AAY90121.1| mitogen-activated protein kinase [Rheum australe]
Length=407

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCIFMELMDRKPL
Sbjct  215  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTTAIDVWSVGCIFMELMDRKPL  274

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSEAE+ FLNENAK+YIRQLP Y RQS   +FPH HP AID
Sbjct  275  FPGRDHVHQLRLLMELIGTPSEAELGFLNENAKRYIRQLPQYTRQSIPGKFPHVHPLAID  334

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHALSEEQM+ELIY
Sbjct  335  LVEKMLTFDPRQRITVEDALAHPYLNSLHDISDEPVCMTPFSFDFEQHALSEEQMRELIY  394

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  395  REALAFNPEYQQ  406



>ref|XP_006492790.1| PREDICTED: mitogen-activated protein kinase homolog D5-like [Citrus 
sinensis]
Length=398

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  206  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLNENAKKYI QLP Y+RQSFTE+FP+ HP AID
Sbjct  266  FPGRDHVHQLRLLIELIGTPSEAELGFLNENAKKYICQLPRYQRQSFTEKFPNVHPSAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C +PF+FDFEQHAL+E QMKELIY
Sbjct  326  LVEKMLTFDPRQRITVEDALAHPYLGSLHDISDEPVCMSPFSFDFEQHALTEGQMKELIY  385

Query  244  REAVAFNPEFEQQ  206
            +EA+AFNPE+ QQ
Sbjct  386  QEALAFNPEYRQQ  398



>gb|KJB27808.1| hypothetical protein B456_005G011100 [Gossypium raimondii]
Length=280

 Score =   354 bits (909),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  88   KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  147

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLN NA++YI+QLPLY RQSFTE+FP  HP AID
Sbjct  148  FPGRDHVHQLRLLIELIGTPSEAELGFLNANARRYIQQLPLYHRQSFTEKFPTVHPLAID  207

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYL+SLHD+SDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  208  LVEKMLTFDPRLRITVEDALAHPYLSSLHDLSDEPVCMTPFNFDFEQHALTEEQMKELIY  267

Query  244  REAVAFNPEFEQ  209
            REA+ FNPE+ Q
Sbjct  268  REALTFNPEYVQ  279



>ref|XP_010915532.1| PREDICTED: mitogen-activated protein kinase 1 [Elaeis guineensis]
Length=396

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP Y RQSF E+FPH HP AID
Sbjct  265  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRYARQSFPEKFPHVHPLAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHALSEEQMKELIY
Sbjct  325  LVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCMTPFSFDFEQHALSEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            RE +AFNPE++Q
Sbjct  385  REGLAFNPEYQQ  396



>ref|XP_010530307.1| PREDICTED: mitogen-activated protein kinase 6 [Tarenaya hassleriana]
Length=396

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMERKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV QLRLL+ELIGTPSE E+EFLNENAK+YIRQLP Y RQSF+E+FP+ HP AID
Sbjct  264  FPGRDHVQQLRLLLELIGTPSEDELEFLNENAKRYIRQLPPYPRQSFSEKFPNVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYL SLHDISDEP CTTPF+FDFEQHAL+E+QMKELIY
Sbjct  324  LVEKMLTFDPRRRITVEDALAHPYLNSLHDISDEPECTTPFSFDFEQHALTEDQMKELIY  383

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++Q 
Sbjct  384  REALAFNPEYQQH  396



>gb|KHG30807.1| Mitogen-activated protein kinase MMK1 [Gossypium arboreum]
Length=397

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLN NA++YI+QLPLY RQSFTE+FP  HP AID
Sbjct  265  FPGRDHVHQLRLLIELIGTPSEAELGFLNANARRYIQQLPLYHRQSFTEKFPTVHPLAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYL+SLHD+SDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  325  LVEKMLTFDPRLRITVEDALAHPYLSSLHDLSDEPVCMTPFNFDFEQHALTEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  385  REALAFNPEYVQ  396



>emb|CDX83459.1| BnaA03g20470D [Brassica napus]
Length=395

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV SE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVNSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP+ HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEQEVEFLNENAKRYIRQLPPYPRQSITDKFPNVHPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  321  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  380

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  381  REALAFNPEYQ  391



>emb|CDY44256.1| BnaC03g24480D [Brassica napus]
Length=395

 Score =   358 bits (918),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV SE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVNSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP+ HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEQEVEFLNENAKRYIRQLPPYPRQSITDKFPNVHPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  321  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  380

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  381  REALAFNPEYQ  391



>ref|XP_010672463.1| PREDICTED: mitogen-activated protein kinase homolog MMK1 [Beta 
vulgaris subsp. vulgaris]
Length=402

 Score =   358 bits (918),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  210  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  269

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+ FLNENAK+YIRQLP YRRQS  E+FPH +  AID
Sbjct  270  FPGRDHVHQLRLLMELIGTPSEHELGFLNENAKRYIRQLPQYRRQSLAEKFPHVNSAAID  329

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHALSEEQM+ELIY
Sbjct  330  LVEKMLTFDPRQRITVEDALAHPYLNSLHDISDEPICMTPFSFDFEQHALSEEQMRELIY  389

Query  244  REAVAFNPEF  215
            REA+AFNPEF
Sbjct  390  REALAFNPEF  399



>gb|AGA37189.1| mitogen-activated protein kinase 6.1 [Brassica napus]
Length=395

 Score =   357 bits (917),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV SE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVNSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP+ HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEQEVEFLNENAKRYIRQLPPYPRQSITDKFPNVHPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  321  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  380

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  381  REALAFNPEYQ  391



>gb|AEM97899.1| sucrose-activated protein kinase [Cephalostachyum fuchsianum]
Length=382

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  192  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  251

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP Y RQSF E+FPH HP AID
Sbjct  252  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRYARQSFPEKFPHVHPSAID  311

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHP+L SLHDISDEP CT PF FDFEQHALSEEQMK+LIY
Sbjct  312  LVEKMLTFDPRQRITVEGALAHPFLASLHDISDEPVCTMPFGFDFEQHALSEEQMKDLIY  371

Query  244  REAVAFNPEFE  212
            +EA+AFNPE++
Sbjct  372  QEALAFNPEYQ  382



>ref|XP_009133635.1| PREDICTED: mitogen-activated protein kinase 6-like [Brassica 
rapa]
Length=395

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV SE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIF+ELMDRKPL
Sbjct  201  KICDFGLARVNSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFIELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP+ HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEQEVEFLNENAKRYIRQLPPYPRQSITDKFPNVHPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  321  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  380

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  381  REALAFNPEYQ  391



>gb|KJB27807.1| hypothetical protein B456_005G011100 [Gossypium raimondii]
Length=397

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLN NA++YI+QLPLY RQSFTE+FP  HP AID
Sbjct  265  FPGRDHVHQLRLLIELIGTPSEAELGFLNANARRYIQQLPLYHRQSFTEKFPTVHPLAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYL+SLHD+SDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  325  LVEKMLTFDPRLRITVEDALAHPYLSSLHDLSDEPVCMTPFNFDFEQHALTEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            REA+ FNPE+ Q
Sbjct  385  REALTFNPEYVQ  396



>gb|AEG64802.1| mitogen-activated protein kinase [Gossypium hirsutum]
 gb|AJA29663.1| mitogen-activated protein kinase 3 [Gossypium hirsutum]
Length=397

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEAE+ FLN NA++YI+QLPLY RQSFTE+FP  HP AID
Sbjct  265  FPGRDHVHQLRLLIELIGTPSEAELGFLNANARRYIQQLPLYHRQSFTEKFPTVHPLAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYL+SLHD+SDEP C TPFNFDFEQHAL+EEQMKELIY
Sbjct  325  LVEKMLTFDPRLRITVEDALAHPYLSSLHDLSDEPVCMTPFNFDFEQHALTEEQMKELIY  384

Query  244  REAVAFNPEFEQ  209
            REA+ FNPE+ Q
Sbjct  385  REALTFNPEYVQ  396



>ref|XP_009419763.1| PREDICTED: mitogen-activated protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=393

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH HP AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHPRQSFPEKFPHVHPAAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C  PF+FDFEQHALSEEQMKELIY
Sbjct  322  LVEKMLTFDPRQRITVEEALAHPYLASLHDISDEPVCMMPFSFDFEQHALSEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  382  REALAFNPEYQQ  393



>ref|NP_001266884.1| uncharacterized protein LOC100834779 [Brachypodium distachyon]
 gb|AFS18261.1| MPK6 [Brachypodium distachyon]
Length=391

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF+E+FPH HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFSEKFPHVHPSAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP CT PF+FDFEQHALSEEQMK+LI+
Sbjct  321  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCTMPFSFDFEQHALSEEQMKDLIH  380

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  381  QEALAFNPDYQ  391



>emb|CAH05023.1| putative MAP kinase [Papaver rhoeas]
Length=403

 Score =   355 bits (912),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  212  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  271

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLL+ELIGTPSEA++ F+N+NAK+YIRQLP + RQS TE+FPH HP AID
Sbjct  272  FPGRDHVHQLRLLLELIGTPSEADLGFVNDNAKRYIRQLPRHPRQSLTEKFPHVHPSAID  331

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR RITVE ALAHPYL +LHDISDEP C TPFNFDFEQHALSEEQMKELIY
Sbjct  332  LVEKMLTFDPRVRITVEDALAHPYLATLHDISDEPVCMTPFNFDFEQHALSEEQMKELIY  391

Query  244  REAVAFNPEFE  212
            REA+AFNPE++
Sbjct  392  REALAFNPEYQ  402



>gb|AGO61959.1| MAPK FLRS, partial [Triticum aestivum]
Length=350

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  160  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  219

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQS +E+FPH HP AID
Sbjct  220  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSLSEKFPHVHPSAID  279

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP CT PF+FDFEQHALSEEQMK+LI+
Sbjct  280  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCTMPFSFDFEQHALSEEQMKDLIH  339

Query  244  REAVAFNPEFE  212
            +E +AFNP+++
Sbjct  340  QEGIAFNPDYQ  350



>ref|XP_010526635.1| PREDICTED: mitogen-activated protein kinase 6-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010526643.1| PREDICTED: mitogen-activated protein kinase 6-like isoform X2 
[Tarenaya hassleriana]
Length=393

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  202  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMERKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHV+QLRLL+ELIGTPSE ++EFLNENAK+YIRQL  Y RQSF+E+FP+ HP AID
Sbjct  262  FPGRDHVNQLRLLLELIGTPSEDQLEFLNENAKRYIRQLTPYSRQSFSEKFPNVHPLAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPRRRITVE ALAHPYL SLHDISDEP CT PFNFDFEQHAL+E+QMKELIY
Sbjct  322  LVEKMLTFDPRRRITVEDALAHPYLNSLHDISDEPECTNPFNFDFEQHALTEDQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++ 
Sbjct  382  REALAFNPEYQH  393



>ref|XP_009399824.1| PREDICTED: mitogen-activated protein kinase 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399825.1| PREDICTED: mitogen-activated protein kinase 1 [Musa acuminata 
subsp. malaccensis]
Length=393

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH HP AID
Sbjct  262  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHPRQSFPEKFPHVHPTAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVE+MLTFDPR+RITVE ALAHPYL SLHDISDEP C  PF+FDFEQHALSEEQMKELIY
Sbjct  322  LVERMLTFDPRQRITVEDALAHPYLASLHDISDEPVCMMPFSFDFEQHALSEEQMKELIY  381

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  382  REALAFNPEYQQ  393



>gb|EEE65112.1| hypothetical protein OsJ_20171 [Oryza sativa Japonica Group]
Length=405

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  215  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  274

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH HP AID
Sbjct  275  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVHPLAID  334

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C++PF+FDFEQHALSEEQMK+LIY
Sbjct  335  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSSPFSFDFEQHALSEEQMKDLIY  394

Query  244  REAVAFNPEFE  212
            +E +AFNP+++
Sbjct  395  QEGLAFNPDYQ  405



>ref|XP_008812083.1| PREDICTED: mitogen-activated protein kinase 1 [Phoenix dactylifera]
Length=398

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  206  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YI QLP + RQSF ++FPH HP AID
Sbjct  266  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIHQLPRHARQSFPQKFPHVHPLAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHALSEEQMKELIY
Sbjct  326  LVEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCMTPFSFDFEQHALSEEQMKELIY  385

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE  QQ
Sbjct  386  REALAFNPEHRQQ  398



>gb|ACD76439.1| mitogen activated protein kinase 6 [Oryza sativa Indica Group]
Length=368

 Score =   352 bits (903),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  178  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  237

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH HP AID
Sbjct  238  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVHPLAID  297

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C++PF+FDFEQHALSEEQMK+LIY
Sbjct  298  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSSPFSFDFEQHALSEEQMKDLIY  357

Query  244  REAVAFNPEFE  212
            +E +AFNP+++
Sbjct  358  QEGLAFNPDYQ  368



>dbj|BAJ90351.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86277.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07440.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQS +E+FPH HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSLSEKFPHVHPSAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP CT PF+FDFEQHALSEEQMK+LI+
Sbjct  324  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCTMPFSFDFEQHALSEEQMKDLIH  383

Query  244  REAVAFNPEFE  212
            +E +AFNP+++
Sbjct  384  QEGIAFNPDYQ  394



>ref|NP_001056846.1| Os06g0154500 [Oryza sativa Japonica Group]
 sp|Q84UI5.1|MPK1_ORYSJ RecName: Full=Mitogen-activated protein kinase 1; Short=MAP kinase 
1; AltName: Full=MAP kinase 6; AltName: Full=OsMAPK6; 
AltName: Full=OsSIPK [Oryza sativa Japonica Group]
 emb|CAD59793.1| mitogen-activated protein kinase [Oryza sativa Japonica Group]
 dbj|BAD34534.1| MAP kinase 6 [Oryza sativa Japonica Group]
 dbj|BAD69291.1| MAP kinase 6 [Oryza sativa Japonica Group]
 dbj|BAF18760.1| Os06g0154500 [Oryza sativa Japonica Group]
Length=398

 Score =   352 bits (904),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  208  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  267

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH HP AID
Sbjct  268  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVHPLAID  327

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C++PF+FDFEQHALSEEQMK+LIY
Sbjct  328  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSSPFSFDFEQHALSEEQMKDLIY  387

Query  244  REAVAFNPEFE  212
            +E +AFNP+++
Sbjct  388  QEGLAFNPDYQ  398



>ref|XP_010925649.1| PREDICTED: mitogen-activated protein kinase 1-like [Elaeis guineensis]
Length=397

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  206  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP EA+++F+NENA++YIRQLP + RQSF  RFPH HP AID
Sbjct  266  FPGRDHVHQLRLLMELIGTPDEADLDFVNENARRYIRQLPRHARQSFPGRFPHVHPLAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPR+RITVE ALAHPYL SLHDISDEP C  PF+FDFEQHALSEEQMKELIY
Sbjct  326  LIEKMLTFDPRQRITVEDALAHPYLASLHDISDEPVCMMPFSFDFEQHALSEEQMKELIY  385

Query  244  REAVAFNPEFEQ  209
            +EAVAFNPE++Q
Sbjct  386  QEAVAFNPEYQQ  397



>ref|XP_004964813.1| PREDICTED: mitogen-activated protein kinase 1-like [Setaria italica]
Length=399

 Score =   351 bits (900),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  209  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  268

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH  P AID
Sbjct  269  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVQPLAID  328

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  329  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKDLIY  388

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  389  QEALAFNPDYQ  399



>gb|ACF85409.1| unknown [Zea mays]
 gb|AFW75553.1| putative MAP kinase family protein isoform 1 [Zea mays]
 gb|AFW75554.1| putative MAP kinase family protein isoform 2 [Zea mays]
Length=398

 Score =   350 bits (898),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  208  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  267

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH  P AID
Sbjct  268  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPCHARQSFPEKFPHVQPLAID  327

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  328  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKDLIY  387

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  388  QEALAFNPDYQ  398



>ref|NP_001152745.1| ABA stimulation MAP kinase [Zea mays]
 gb|ACF35309.1| ABA stimulation MAP kinase [Zea mays]
Length=397

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH  P AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPCHARQSFPEKFPHVQPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  327  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKDLIY  386

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  387  QEALAFNPDYQ  397



>ref|XP_002437855.1| hypothetical protein SORBIDRAFT_10g003810 [Sorghum bicolor]
 gb|EER89222.1| hypothetical protein SORBIDRAFT_10g003810 [Sorghum bicolor]
Length=402

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  212  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  271

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NENA++YIRQLP + RQSF E+FPH  P AID
Sbjct  272  FPGRDHVHQLRLLMELIGTPNEADLDFVNENARRYIRQLPRHARQSFPEKFPHVQPLAID  331

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  332  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSMPFSFDFEQHALSEEQMKDLIY  391

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  392  QEALAFNPDYQ  402



>ref|XP_009389895.1| PREDICTED: mitogen-activated protein kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+E +++F+NENA++YIRQLP + RQSF E+F H HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPNEVDLDFVNENARRYIRQLPRHPRQSFPEKFSHVHPAAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVE+MLTFDPR+RITVE ALAHPYL SLHDISDEP C TPF+FDFEQHALSEEQMKELIY
Sbjct  319  LVERMLTFDPRQRITVEDALAHPYLASLHDISDEPVCMTPFSFDFEQHALSEEQMKELIY  378

Query  244  REAVAFNPEFEQ  209
            REA+AFN E++Q
Sbjct  379  REAIAFNLEYQQ  390



>ref|XP_008780958.1| PREDICTED: mitogen-activated protein kinase 1-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008781033.1| PREDICTED: mitogen-activated protein kinase 1-like isoform X1 
[Phoenix dactylifera]
Length=399

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELM+RKPL
Sbjct  208  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMNRKPL  267

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP EA+++F+NENA+ YIRQLP + RQSF  RFPH HP AID
Sbjct  268  FPGRDHVHQLRLLMELIGTPDEADLDFVNENARLYIRQLPRHARQSFPGRFPHVHPLAID  327

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVE ALAHPYL SLHD SDEP C  PF+FDFEQHALSEEQMKELIY
Sbjct  328  LVEKMLTFDPRQRITVEDALAHPYLASLHDTSDEPDCMMPFSFDFEQHALSEEQMKELIY  387

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  388  REALAFNPEYQQ  399



>gb|AFW85791.1| putative MAP kinase family protein [Zea mays]
Length=398

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  208  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  267

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+E +++F+NENA++YIRQLP + RQS  E+FPH  P AID
Sbjct  268  FPGRDHVHQLRLLMELIGTPNEGDLDFVNENARRYIRQLPRHPRQSLPEKFPHVQPLAID  327

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  328  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPGCSMPFSFDFEQHALSEEQMKDLIY  387

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  388  QEALAFNPDYQ  398



>ref|NP_001104843.1| MAP kinase2 [Zea mays]
 dbj|BAA74734.1| MAP kinase 5 [Zea mays]
Length=399

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  209  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  268

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+E +++F+NENA++YIRQLP + RQS  E+FPH  P AID
Sbjct  269  FPGRDHVHQLRLLMELIGTPNEGDLDFVNENARRYIRQLPRHPRQSLPEKFPHVQPLAID  328

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  329  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPGCSMPFSFDFEQHALSEEQMKDLIY  388

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  389  QEALAFNPDYQ  399



>gb|ACG37232.1| MPK6 - putative MAPK [Zea mays]
Length=398

 Score =   345 bits (884),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYV TRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  208  KICDFGLARTTSETDFMTEYVFTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  267

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+E +++F+NENA++YIRQLP + RQS  E+FPH  P AID
Sbjct  268  FPGRDHVHQLRLLMELIGTPNEGDLDFVNENARRYIRQLPRHPRQSLPEKFPHVQPLAID  327

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C+ PF+FDFEQHALSEEQMK+LIY
Sbjct  328  LVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPGCSMPFSFDFEQHALSEEQMKDLIY  387

Query  244  REAVAFNPEFE  212
            +EA+AFNP+++
Sbjct  388  QEALAFNPDYQ  398



>ref|XP_006655804.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
1-like [Oryza brachyantha]
Length=402

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 181/201 (90%), Gaps = 10/201 (5%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  202  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  261

Query  604  FPGRDHVHQLRLLME----------LIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTER  455
            FPGRDHVHQLRLLME          LIGTP+EA+++F+NENA++YIRQLP + RQSF E+
Sbjct  262  FPGRDHVHQLRLLMEVRPVSISXLQLIGTPNEADLDFVNENARRYIRQLPRHARQSFPEK  321

Query  454  FPHAHPGAIDLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHAL  275
            FPH HP AIDLVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP C++PF+FDFEQHAL
Sbjct  322  FPHVHPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCSSPFSFDFEQHAL  381

Query  274  SEEQMKELIYREAVAFNPEFE  212
            SEEQMK+LI++E +AFNP+++
Sbjct  382  SEEQMKDLIHQEGIAFNPDYQ  402



>gb|KFK37200.1| hypothetical protein AALP_AA4G227200 [Arabis alpina]
Length=401

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  210  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  269

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP+Y RQS T++FP  HP AID
Sbjct  270  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPMYPRQSITDKFPTVHPLAID  329

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  330  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  389

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  390  REALAFNPEYQQ  401



>gb|AAO16560.1| mitogen-activated protein kinase [Triticum aestivum]
Length=403

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 10/201 (5%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  203  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  262

Query  604  FPGRDHVHQLRLLME----------LIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTER  455
            FPGRDHVHQLRLLME          LIGTP+EA+++F+NENA++YIRQLP + RQS +E+
Sbjct  263  FPGRDHVHQLRLLMEVFPCGISSLQLIGTPNEADLDFVNENARRYIRQLPRHARQSLSEK  322

Query  454  FPHAHPGAIDLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHAL  275
            FPH HP AIDLVEKMLTFDPR+RITVEGALAHPYL SLHDISDEP CT PF+FDFEQHAL
Sbjct  323  FPHVHPSAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISDEPVCTMPFSFDFEQHAL  382

Query  274  SEEQMKELIYREAVAFNPEFE  212
            SEEQMK+LI++E + FNP+++
Sbjct  383  SEEQMKDLIHQEGITFNPDYQ  403



>ref|XP_009142961.1| PREDICTED: mitogen-activated protein kinase 6 [Brassica rapa]
Length=392

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YI+QLP Y RQS T++FP+ HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIKQLPPYPRQSLTDKFPNVHPLAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  319  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  378

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  379  REALAFNPEYQQ  390



>gb|ADM89008.1| MPK6 protein [Brassica napus]
Length=394

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  201  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YI+QLP Y RQS T++FP+ HP AID
Sbjct  261  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIKQLPPYPRQSLTDKFPNVHPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  321  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTVPFNFDFEQHALSEEQMKELIY  380

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  381  REALAFNPEYQQ  392



>ref|XP_010517958.1| PREDICTED: mitogen-activated protein kinase 6-like [Camelina 
sativa]
Length=397

 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS TE+FP  HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITEKFPTVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT+PFNFDFE HALSEEQMKELIY
Sbjct  324  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTSPFNFDFENHALSEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  384  REALAFNPEYHQ  395



>emb|CDX79801.1| BnaA05g03550D [Brassica napus]
Length=392

 Score =   339 bits (870),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YI+QLP Y RQS T++FP+ HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIKQLPPYPRQSLTDKFPNVHPLAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKML FDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  319  LIEKMLMFDPRRRITVLDALAHPYLNSLHDISDEPECTVPFNFDFEQHALSEEQMKELIY  378

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  379  REALAFNPEYQQ  390



>ref|XP_002880067.1| hypothetical protein ARALYDRAFT_903782 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56326.1| hypothetical protein ARALYDRAFT_903782 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFE HALSEEQMKELIY
Sbjct  327  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIY  386

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  387  REALAFNPEYQQ  398



>ref|XP_010506280.1| PREDICTED: mitogen-activated protein kinase 6-like [Camelina 
sativa]
Length=397

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT+PFNFDFE HALSEEQMKELIY
Sbjct  324  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTSPFNFDFENHALSEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  384  REALAFNPEYHQ  395



>ref|XP_010508373.1| PREDICTED: mitogen-activated protein kinase 6 [Camelina sativa]
Length=397

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT+PFNFDFE HALSEEQMKELIY
Sbjct  324  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTSPFNFDFENHALSEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  384  REALAFNPEYHQ  395



>ref|XP_006397553.1| hypothetical protein EUTSA_v10001439mg [Eutrema salsugineum]
 gb|ESQ39006.1| hypothetical protein EUTSA_v10001439mg [Eutrema salsugineum]
Length=454

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/192 (89%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  263  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  322

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  323  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  382

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  383  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEQHALSEEQMKELIY  442

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  443  REALAFNPEYQQ  454



>emb|CDY17911.1| BnaC04g03080D [Brassica napus]
Length=392

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  199  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  258

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YI+QLP Y RQS T++FP+ HP AID
Sbjct  259  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIKQLPPYPRQSLTDKFPNVHPLAID  318

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFEQHALSEEQMKELIY
Sbjct  319  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTVPFNFDFEQHALSEEQMKELIY  378

Query  244  REAVAFNPEFEQ  209
             EA+AFNPE++Q
Sbjct  379  HEALAFNPEYQQ  390



>ref|NP_181907.1| MAP kinase 6 [Arabidopsis thaliana]
 sp|Q39026.1|MPK6_ARATH RecName: Full=Mitogen-activated protein kinase 6; Short=AtMPK6; 
Short=MAP kinase 6 [Arabidopsis thaliana]
 dbj|BAA04869.1| MAP kinase [Arabidopsis thaliana]
 gb|AAB64027.1| MAP kinase (ATMPK6) [Arabidopsis thaliana]
 gb|AAM53295.1| MAP kinase ATMPK6 [Arabidopsis thaliana]
 gb|AAP68294.1| At2g43790 [Arabidopsis thaliana]
 gb|AEC10325.1| MAP kinase 6 [Arabidopsis thaliana]
Length=395

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFE HALSEEQMKELIY
Sbjct  324  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIY  383

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE++Q
Sbjct  384  REALAFNPEYQQ  395



>ref|XP_006294349.1| hypothetical protein CARUB_v10023366mg [Capsella rubella]
 gb|EOA27247.1| hypothetical protein CARUB_v10023366mg [Capsella rubella]
Length=398

 Score =   338 bits (866),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  207  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  266

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  267  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  326

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFE HALSEEQMKELIY
Sbjct  327  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTVPFNFDFENHALSEEQMKELIY  386

Query  244  REAVAFNPEFEQ  209
            REA+AFNPE+ Q
Sbjct  387  REALAFNPEYHQ  398



>gb|ABG54333.1| double HA-tagged mitogen activated protein kinase 6 [synthetic 
construct]
Length=416

 Score =   338 bits (867),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSE+DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  204  KICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  263

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTPSE E+EFLNENAK+YIRQLP Y RQS T++FP  HP AID
Sbjct  264  FPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAID  323

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EKMLTFDPRRRITV  ALAHPYL SLHDISDEP CT PFNFDFE HALSEEQMKELIY
Sbjct  324  LIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIY  383

Query  244  REAVAFNPEFEQQ  206
            REA+AFNPE++Q+
Sbjct  384  REALAFNPEYQQR  396



>gb|AFK49116.1| unknown [Medicago truncatula]
Length=176

 Score =   327 bits (839),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  736  MTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEL  557
            MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEL
Sbjct  1    MTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMEL  60

Query  556  IGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAIDLVEKMLTFDPRRRITV  377
            IGTPSE ++ FLNENAK+YIRQLP YRRQSF E+FP  HP AIDLVEKMLTFDPR+RITV
Sbjct  61   IGTPSEDDLGFLNENAKRYIRQLPPYRRQSFQEKFPQVHPEAIDLVEKMLTFDPRKRITV  120

Query  376  EGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIYREAVAFNPEFEQ  209
            E ALAHPYLTSLHDISDEP C TPF+FDFEQHAL+EEQMKELIYREA+AFNPE++Q
Sbjct  121  EDALAHPYLTSLHDISDEPVCMTPFSFDFEQHALTEEQMKELIYREALAFNPEYQQ  176



>gb|EPS60369.1| hypothetical protein M569_14432, partial [Genlisea aurea]
Length=397

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYRPPELLL+SSDYTAAIDVWSVGCIFMELMDRKPL
Sbjct  205  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLSSSDYTAAIDVWSVGCIFMELMDRKPL  264

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIG+P+E+++ FLNE+AK Y+ +LP Y RQSF E+FP  HP AID
Sbjct  265  FPGRDHVHQLRLLMELIGSPTESDLGFLNEDAKTYLSRLPPYSRQSFVEKFPRVHPLAID  324

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKML+FDPR+RITVE ALAHPYL SLHDISDEP C  PFNF+FEQ +L+EE+MKELIY
Sbjct  325  LVEKMLSFDPRQRITVEEALAHPYLNSLHDISDEPICPNPFNFNFEQDSLTEEEMKELIY  384

Query  244  REAVAFNPEFEQQ  206
            REA+ FNP    Q
Sbjct  385  REALVFNPTHHYQ  397



>ref|XP_006845036.1| hypothetical protein AMTR_s00058p00218380 [Amborella trichopoda]
 gb|ERN06711.1| hypothetical protein AMTR_s00058p00218380 [Amborella trichopoda]
Length=400

 Score =   332 bits (851),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARVTSETDFMTEYVVTRWYR PELLLNS++YTAAIDVWSVGC+FMEL++R+PL
Sbjct  196  KICDFGLARVTSETDFMTEYVVTRWYRAPELLLNSAEYTAAIDVWSVGCVFMELINRQPL  255

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLME+IGTP+EAE+ F+N++A+KYIRQL  Y RQS   RFP  HP AID
Sbjct  256  FPGRDHVHQLRLLMEMIGTPTEAELGFVNDSARKYIRQLVQYPRQSLAARFPKVHPMAID  315

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITV  ALAHPYL SLHDISDEP C TPF+F+FEQHAL+E+QMKELIY
Sbjct  316  LVEKMLTFDPRQRITVTDALAHPYLASLHDISDEPVCPTPFSFEFEQHALTEDQMKELIY  375

Query  244  REAVAFNPEF  215
            RE++AFNPE+
Sbjct  376  RESLAFNPEY  385



>gb|ACN39979.1| unknown [Picea sitchensis]
Length=344

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  152  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRQPL  211

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGR+HVHQLRLL ELIGTP+EA++ F+ ++NA+++IRQLP Y RQSFT++FPH H  AI
Sbjct  212  FPGRNHVHQLRLLTELIGTPTEADLGFVRSDNARRFIRQLPQYPRQSFTQKFPHVHTLAI  271

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL E+MLTFDP +RITVE ALAHPYL +LHDISDEP+C+ PF+FDFEQH L+E+QMKELI
Sbjct  272  DLCERMLTFDPNQRITVEEALAHPYLANLHDISDEPTCSMPFSFDFEQHTLTEDQMKELI  331

Query  247  YREAVAFNPEFEQ  209
            YREA+ FNPE+ Q
Sbjct  332  YREALVFNPEYAQ  344



>gb|ACN39845.1| unknown [Picea sitchensis]
Length=390

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  198  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRQPL  257

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQLRLL ELIGTP+EA++ F+ ++NA+++IRQLP Y RQSFT++FPH H  AI
Sbjct  258  FPGRDHVHQLRLLTELIGTPTEADLGFVRSDNARRFIRQLPQYPRQSFTQKFPHVHTLAI  317

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL E+MLTFDP +RITVE ALAHPYL +LHDISDEP+C+ PF+FDFEQH L+E+QMKELI
Sbjct  318  DLCERMLTFDPNQRITVEEALAHPYLANLHDISDEPTCSMPFSFDFEQHTLTEDQMKELI  377

Query  247  YREAVAFNPEFEQ  209
            YREA+ FNPE+ Q
Sbjct  378  YREALVFNPEYAQ  390



>gb|ACT63866.1| mitogen activated protein kinase 6 [Pinus taeda]
Length=390

 Score =   329 bits (844),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR+TSETDFMTEYVVTRWYR PELLLNS+DYTAAIDVWSVGCIFMELM+R+PL
Sbjct  198  KICDFGLARITSETDFMTEYVVTRWYRAPELLLNSADYTAAIDVWSVGCIFMELMNRQPL  257

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQLRLL ELIGTP+EA++ F+ ++NA+++IRQLP Y RQSFT++FPH H  AI
Sbjct  258  FPGRDHVHQLRLLTELIGTPTEADLGFVRSDNARRFIRQLPQYPRQSFTQKFPHVHALAI  317

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL EKMLTFDP +RITVE ALAHPYL +LHDISDEP C  PF+FDFEQH L+E+QMKELI
Sbjct  318  DLCEKMLTFDPNQRITVEEALAHPYLANLHDISDEPICAMPFSFDFEQHTLTEDQMKELI  377

Query  247  YREAVAFNPEFEQ  209
            YREA+ FNPE+ Q
Sbjct  378  YREALVFNPEYAQ  390



>gb|AGS78125.1| mitogen activated protein kinase 1 [Curcuma longa]
Length=369

 Score =   328 bits (841),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 176/191 (92%), Gaps = 3/191 (2%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELMDRKPL
Sbjct  182  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMDRKPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDHVHQLRLLMELIGTP+EA+++F+NE A++YIRQLP + RQSF E+FPH HP AID
Sbjct  242  FPGRDHVHQLRLLMELIGTPNEADLDFVNERARRYIRQLPRHIRQSFPEKFPHVHPLAID  301

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RITVEGA+AHPYL  LHDISDEP C +PF+FDFEQHALS EQMK+LIY
Sbjct  302  LVEKMLTFDPRQRITVEGAIAHPYLALLHDISDEPVC-SPFSFDFEQHALS-EQMKDLIY  359

Query  244  REAVAFNPEFE  212
             E +AFNP+++
Sbjct  360  -EGLAFNPDYQ  369



>gb|KHG09868.1| Mitogen-activated protein kinase MMK1 [Gossypium arboreum]
Length=398

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV +E+DFMTEYV+TRWYRPPELLL SS Y+AAID+WSVGCIFMEL  RKPL
Sbjct  206  KICDFGLARVNTESDFMTEYVITRWYRPPELLLYSSQYSAAIDMWSVGCIFMELFIRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDH+HQ+RLL+EL+GTPSEAEME++NENAK+YI+QLP Y RQSF+E+FP+ HP AID
Sbjct  266  FPGRDHLHQVRLLLELLGTPSEAEMEYVNENAKRYIQQLPNYPRQSFSEKFPNVHPLAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L +KMLTFDP++RITVE ALAHPYLT+LHDISDEP C  PF+FDFEQHAL+  QMKEL+Y
Sbjct  326  LAQKMLTFDPKQRITVEEALAHPYLTALHDISDEPVCMIPFSFDFEQHALTMAQMKELVY  385

Query  244  REAVAFNPEFEQQ  206
             EA+AFNP++  Q
Sbjct  386  EEALAFNPDYSLQ  398



>gb|KJB71605.1| hypothetical protein B456_011G132800 [Gossypium raimondii]
Length=398

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLARV +E+DFMTEYV+TRWYRPPELLL SS Y+AAID+WSVGCIFMEL  RKPL
Sbjct  206  KICDFGLARVNTESDFMTEYVITRWYRPPELLLYSSQYSAAIDMWSVGCIFMELFIRKPL  265

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPGRDH+HQ+RLL+EL+GTPSEAEME+LNENAK+YI+QLP Y  QSF+E+FP+ HP AID
Sbjct  266  FPGRDHLHQVRLLLELLGTPSEAEMEYLNENAKRYIQQLPNYPGQSFSEKFPNVHPLAID  325

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L +KMLTFDP++RITVE ALAHPYLT+LHDISDEP C  PF FDFEQHAL+  QMKEL+Y
Sbjct  326  LAQKMLTFDPKQRITVEEALAHPYLTTLHDISDEPVCMIPFTFDFEQHALTMAQMKELVY  385

Query  244  REAVAFNPEFEQQ  206
             EA+AFNP++  Q
Sbjct  386  EEALAFNPDYSLQ  398



>ref|XP_010253496.1| PREDICTED: mitogen-activated protein kinase 3-like [Nelumbo nucifera]
Length=387

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  194  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  253

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL EL+GTP+EAE+ F+ NE+AK+YIRQLPL+ RQSF   FPH HP AI
Sbjct  254  FPGRDHVHQMRLLTELLGTPAEAELGFVKNEDAKRYIRQLPLHPRQSFAHVFPHVHPAAI  313

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTFDP +RITVE ALAHPYL  LHDI+DEP C  PF+F+FE+ AL EEQMKE+I
Sbjct  314  DLIERMLTFDPTKRITVEEALAHPYLERLHDIADEPVCPEPFSFEFEKQALVEEQMKEMI  373

Query  247  YREAVAFNPEF  215
            YREA+AFNPE+
Sbjct  374  YREALAFNPEY  384



>ref|XP_009406947.1| PREDICTED: mitogen-activated protein kinase 5 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNS+DYTAAID+WSVGCIFMELM+RKPL
Sbjct  177  KICDFGLARPTSENEIMTEYVVTRWYRAPELLLNSTDYTAAIDMWSVGCIFMELMNRKPL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ ELIGTP+EAE+EF+ NE+A++Y+R LP Y RQSF   +PH  P AI
Sbjct  237  FPGRDHMHQMRLITELIGTPTEAELEFIQNEDARRYMRHLPRYPRQSFASLYPHISPVAI  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTFDP +RITVE AL HPYL  LHDI+DEP+C  PF+FDFEQHAL+EEQMKELI
Sbjct  297  DLIERMLTFDPTKRITVEEALDHPYLERLHDIADEPTCMEPFSFDFEQHALTEEQMKELI  356

Query  247  YREAVAFNPEF  215
            Y+EA+AFNP +
Sbjct  357  YKEAIAFNPAY  367



>ref|XP_010260161.1| PREDICTED: mitogen-activated protein kinase 3-like [Nelumbo nucifera]
Length=387

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  194  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  253

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RLL EL+GTP+EAE+ F+ NE+A+++IRQLP + RQ F++ FPH HP AI
Sbjct  254  FPGRDHMHQMRLLTELLGTPTEAELGFVKNEDARRFIRQLPPHPRQPFSKMFPHVHPDAI  313

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE ALAHPYL  LHDI+DEP C  PF+F+FE+ AL EEQMKE+I
Sbjct  314  DLIERMLTFNPTKRITVEEALAHPYLARLHDIADEPVCPEPFSFEFEKQALVEEQMKEMI  373

Query  247  YREAVAFNPEF  215
            YREA+ FNPE+
Sbjct  374  YREAIEFNPEY  384



>gb|KJB20240.1| hypothetical protein B456_003G139900 [Gossypium raimondii]
Length=308

 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  117  KICDFGLARPTAENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  176

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP + RQS  E FPH HP AI
Sbjct  177  FPGKDHVHQMRLLTELLGTPTESDLGFLRNEDARRYIRQLPAHPRQSLAEVFPHVHPLAI  236

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDISDEP C  PF+FDFE+  L EEQMK++I
Sbjct  237  DLIDRMLTFDPTRRITVEEALAHPYLERLHDISDEPVCPEPFSFDFERQPLGEEQMKDMI  296

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  297  YQEALALNPTY  307



>gb|AJA29669.1| mitogen-activated protein kinase 9 [Gossypium hirsutum]
Length=375

 Score =   306 bits (784),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPTAENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP + RQS  E FPH HP AI
Sbjct  244  FPGKDHVHQMRLLTELLGTPTESDLGFLRNEDARRYIRQLPAHPRQSLAEVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDISDEP C  PF+FDFEQ  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDISDEPVCPEPFSFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  364  YQEALALNPTY  374



>gb|KHG08689.1| Mitogen-activated protein kinase 3 [Gossypium arboreum]
Length=375

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPTAENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP + RQS  E FPH HP AI
Sbjct  244  FPGKDHVHQMRLLTELLGTPTESDLGFLRNEDARRYIRQLPAHPRQSLAEVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDISDEP C  PF+FDFEQ  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDISDEPVCPEPFSFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  364  YQEALALNPTY  374



>ref|XP_002532266.1| big map kinase/bmk, putative [Ricinus communis]
 gb|EEF30132.1| big map kinase/bmk, putative [Ricinus communis]
Length=280

 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCI+MELM+RKPL
Sbjct  89   KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIYMELMNRKPL  148

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+AK+YIRQL  Y RQ   + FPH HP AI
Sbjct  149  FPGKDHVHQMRLLTELLGTPTESDLGFIKNEDAKRYIRQLTPYPRQPLDKVFPHVHPLAI  208

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPY+  LHDI+DEP C  PF+FDFEQ  L EEQMKE+I
Sbjct  209  DLIDRMLTFDPTKRITVEEALAHPYVARLHDIADEPVCPEPFSFDFEQQPLGEEQMKEMI  268

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  269  YREAIALNPEY  279



>ref|XP_004294685.1| PREDICTED: mitogen-activated protein kinase 3 [Fragaria vesca 
subsp. vesca]
Length=371

 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 168/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  180  KICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHV+Q+RLL EL+GTP+E+++ F+ NE+A++YIRQLP + RQ   + FPH HP AI
Sbjct  240  FPGKDHVNQMRLLTELLGTPTESDLGFVRNEDARRYIRQLPQFPRQQMVKLFPHVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE ALAHPYL  LHD++DEP CT PF+FDFEQ +L EEQMK++I
Sbjct  300  DLVDRMLTFDPTKRITVEEALAHPYLERLHDVADEPICTVPFSFDFEQQSLGEEQMKDMI  359

Query  247  YREAVAFNPEF  215
            YREA+AFNPE+
Sbjct  360  YREAIAFNPEY  370



>ref|XP_010032056.1| PREDICTED: mitogen-activated protein kinase 3 [Eucalyptus grandis]
 gb|KCW51443.1| hypothetical protein EUGRSUZ_J00966 [Eucalyptus grandis]
Length=373

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T+E +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  182  KIIDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL+EL+GTP++A++ F+ NE+A++YIRQLP + RQ     FPH HP AI
Sbjct  242  FPGRDHVHQMRLLVELLGTPADADLGFVRNEDARRYIRQLPQHPRQPLASVFPHVHPLAI  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVEKMLTFDP +RITVE ALAHPYLT LHDI+DEP C  PF+F+FEQ  L EEQMK++I
Sbjct  302  DLVEKMLTFDPTKRITVEEALAHPYLTRLHDIADEPVCRQPFSFEFEQQPLGEEQMKDMI  361

Query  247  YREAVAFNPEF  215
            Y+EA+A NPEF
Sbjct  362  YQEAIALNPEF  372



>gb|KDO73106.1| hypothetical protein CISIN_1g025683mg [Citrus sinensis]
Length=249

 Score =   300 bits (768),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  58   KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  117

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL+EL+GTP++A++ F+ NE+AK+YIRQLP + RQS  + FPH HP AI
Sbjct  118  FPGNDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAI  177

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITV+ ALAHPYL  LHD +DEP C  PF+FDFEQ +L EEQ+K++I
Sbjct  178  DLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIKDMI  237

Query  247  YREAVAFNPEF  215
            Y+EA+A NP F
Sbjct  238  YQEALALNPGF  248



>gb|KJB20241.1| hypothetical protein B456_003G139900 [Gossypium raimondii]
Length=375

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPTAENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP + RQS  E FPH HP AI
Sbjct  244  FPGKDHVHQMRLLTELLGTPTESDLGFLRNEDARRYIRQLPAHPRQSLAEVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDISDEP C  PF+FDFE+  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDISDEPVCPEPFSFDFERQPLGEEQMKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  364  YQEALALNPTY  374



>ref|XP_006424673.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
 gb|ESR37913.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
Length=305

 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  114  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  173

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL+EL+GTP++A++ F+ NE+AK+YIRQLP + RQS  + FPH HP AI
Sbjct  174  FPGNDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAI  233

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITV+ ALAHPYL  LHD +DEP C  PF+FDFEQ +L EEQ+K++I
Sbjct  234  DLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIKDMI  293

Query  247  YREAVAFNPEF  215
            Y+EA+A NP F
Sbjct  294  YQEALALNPGF  304



>gb|AEV89968.1| mitogen activated protein kinase [Humulus lupulus]
Length=380

 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E ++MTEYVVTRWYR PELLLNSSDYTA+IDVWSVGCIFMELM+RKPL
Sbjct  189  KICDFGLARPTAENEYMTEYVVTRWYRAPELLLNSSDYTASIDVWSVGCIFMELMNRKPL  248

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+AK+YIRQLP + RQ     FPH H  AI
Sbjct  249  FPGKDHVHQMRLLTELLGTPTESDLGFIRNEDAKRYIRQLPSFPRQQLGRAFPHVHTLAI  308

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKMLTFDP RRITVE ALAHPYLT LHD++DEP C  PF+F+FEQ  L+EEQMK++I
Sbjct  309  DLIEKMLTFDPNRRITVEEALAHPYLTRLHDVADEPVCPNPFSFEFEQQPLTEEQMKDMI  368

Query  247  YREAVAFNPEF  215
            Y+EA+A NP++
Sbjct  369  YQEAIALNPQY  379



>ref|XP_006402656.1| hypothetical protein EUTSA_v10006460mg [Eutrema salsugineum]
 gb|ESQ44109.1| hypothetical protein EUTSA_v10006460mg [Eutrema salsugineum]
Length=402

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE+  MTEYVVTRWYR PELLLNS DYT AIDVWSVGCIF+ELM+R+PL
Sbjct  202  KICDFGLARGTSESHLMTEYVVTRWYRAPELLLNSCDYTTAIDVWSVGCIFLELMNREPL  261

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+DHVHQLRLLMEL+G+PSE ++  LNENAK+Y+RQLP   RQSF E+FP   P AID
Sbjct  262  FPGKDHVHQLRLLMELVGSPSEEDLGALNENAKRYLRQLPSRPRQSFAEKFPDVPPLAID  321

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            L+EK+LTFDPR+RI+VE ALAHPYL+S+HD+SDEP CT PFNFD E   L+EEQ++EL+Y
Sbjct  322  LMEKILTFDPRQRISVEDALAHPYLSSMHDLSDEPVCTRPFNFDIEDEPLTEEQIQELVY  381

Query  244  REAVAFNPE  218
             EA+AFNPE
Sbjct  382  SEALAFNPE  390



>ref|XP_008792346.1| PREDICTED: mitogen-activated protein kinase 5 [Phoenix dactylifera]
Length=369

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNS+DYTA+ID+WSVGCIFMELM+RKPL
Sbjct  177  KICDFGLARPTSENENMTEYVVTRWYRAPELLLNSTDYTASIDIWSVGCIFMELMNRKPL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E IGTP+EAE+ FL +E+A++Y+R LP Y RQ FT  FPH HP AI
Sbjct  237  FPGRDHMHQMRLITECIGTPTEAELGFLRSEDARRYMRHLPQYPRQPFTSLFPHVHPAAI  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVEKMLTF+P +R+TVE AL+HPYL  LHDI+DEP C  PF+FDFEQ+ALSEEQMKELI
Sbjct  297  DLVEKMLTFNPSKRVTVEEALSHPYLERLHDIADEPVCMEPFSFDFEQNALSEEQMKELI  356

Query  247  YREAVAFNPE  218
            YREA+A N +
Sbjct  357  YREALALNSD  366



>gb|ABM67698.1| mitogen-activated protein kinase [Citrus sinensis]
Length=375

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  184  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL+EL+GTP++A++ F+ NE+AK+YIRQLP + RQS  + FPH HP AI
Sbjct  244  FPGKDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITV+ ALAHPYL  LHD +DEP C  PF+FDFEQ +L EEQ+K++I
Sbjct  304  DLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP F
Sbjct  364  YQEALALNPGF  374



>gb|KDP44133.1| hypothetical protein JCGZ_05600 [Jatropha curcas]
Length=372

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  181  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  240

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+R+L EL+GTP+E+++ F+ NE+A++YIRQL  + RQ   + FPH HP AI
Sbjct  241  FPGKDHVHQMRILTELLGTPTESDLGFVKNEDARRYIRQLSPHPRQPLAQIFPHVHPLAI  300

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPYL  LHDI+DEP C  PF+FDFEQ  L EEQMKE+I
Sbjct  301  DLIDRMLTFDPTKRITVEEALAHPYLARLHDIADEPVCPEPFSFDFEQQPLGEEQMKEMI  360

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  361  YREALALNPEY  371



>ref|XP_006424672.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
 gb|ESR37912.1| hypothetical protein CICLE_v10028667mg [Citrus clementina]
Length=375

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  184  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL+EL+GTP++A++ F+ NE+AK+YIRQLP + RQS  + FPH HP AI
Sbjct  244  FPGNDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITV+ ALAHPYL  LHD +DEP C  PF+FDFEQ +L EEQ+K++I
Sbjct  304  DLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP F
Sbjct  364  YQEALALNPGF  374



>gb|KHN22030.1| Mitogen-activated protein kinase 3 [Glycine soja]
Length=371

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++  + NE+A++YIRQLP Y RQ   + FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTEADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RITVE ALAHPYL  LHD++DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTVDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFDFEQQQLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>ref|XP_003539740.1| PREDICTED: mitogen-activated protein kinase 3-like [Glycine max]
Length=371

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++  + NE+A++YIRQLP Y RQ   + FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTEADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RITVE ALAHPYL  LHD++DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTVDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFDFEQQQLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>ref|NP_001275822.1| mitogen-activated protein kinase 1 [Citrus sinensis]
 gb|AFG26277.1| mitogen-activated protein kinase 1 [Citrus sinensis]
Length=375

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  184  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL+EL+GTP++A++ F+ NE+AK+YIRQLP + RQS  + FPH HP AI
Sbjct  244  FPGNDHVHQMRLLIELLGTPTDADLGFVRNEDAKRYIRQLPQHPRQSLAQVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITV+ ALAHPYL  LHD +DEP C  PF+FDFEQ +L EEQ+K++I
Sbjct  304  DLVDRMLTFDPMKRITVDEALAHPYLARLHDEADEPVCPEPFSFDFEQQSLGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP F
Sbjct  364  YQEALALNPGF  374



>ref|XP_010920941.1| PREDICTED: mitogen-activated protein kinase 5 [Elaeis guineensis]
Length=369

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNS+DYTA+ID+WSVGCIFMELM+R+PL
Sbjct  177  KICDFGLARPTSENENMTEYVVTRWYRAPELLLNSTDYTASIDIWSVGCIFMELMNRRPL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E IGTP+EAE+ FL +E+A++Y+R LP Y RQ F   F H +P AI
Sbjct  237  FPGRDHMHQMRLITECIGTPTEAELGFLRSEDARRYMRHLPQYPRQPFVSLFSHVNPAAI  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE+MLTF+P  RITVE ALAHPYL  LHDI+DEP C  PF+FDFEQHALSEEQMKELI
Sbjct  297  DLVERMLTFNPSTRITVEEALAHPYLERLHDIADEPVCMEPFSFDFEQHALSEEQMKELI  356

Query  247  YREAVAFNPE  218
            Y+EA+AFNPE
Sbjct  357  YQEALAFNPE  366



>gb|KHG13782.1| Mitogen-activated protein kinase 3 [Gossypium arboreum]
Length=376

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  SE +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPASENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP Y RQ     FPH +  A+
Sbjct  244  FPGNDHVHQMRLLTELLGTPTESDLGFLQNEDARRYIRQLPAYPRQQLANVFPHVNRMAL  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDI+DEP C  PFNFDFEQ  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDIADEPVCPEPFNFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEFEQ  209
            YREA+A NP++ +
Sbjct  364  YREALALNPDYAR  376



>gb|KHN05707.1| Mitogen-activated protein kinase 3 [Glycine soja]
Length=370

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIF ELM++KPL
Sbjct  179  KIIDFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFTELMNKKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++  + NE+A++YIRQLP Y RQ   + FPH HP AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTEADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RITVE ALAHPYL  LHD++DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDKMLTVDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFDFEQQQLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREALALNPEY  369



>gb|ABR17734.1| unknown [Picea sitchensis]
Length=277

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR+TSET  MTEYVVTRWYR PELLLNS DYTAAIDVWSVGCIFMELM+RKPL
Sbjct  88   KIADFGLARITSETYLMTEYVVTRWYRAPELLLNSPDYTAAIDVWSVGCIFMELMNRKPL  147

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQLRL+ EL GTP++A++ FL +ENAK  ++QL  + RQS  E+FPH HP AI
Sbjct  148  FPGKDHVHQLRLITELTGTPTDADLGFLRSENAKLLVQQLSQHPRQSLAEKFPHVHPSAI  207

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            D+ E+MLTFDP +RITVE AL HPYL +LHD +DEP+C  PFNF+FE+HAL+EEQM+ELI
Sbjct  208  DICERMLTFDPNQRITVEEALNHPYLANLHDEADEPTCPIPFNFEFEEHALTEEQMRELI  267

Query  247  YREAVAFNP  221
            YREA+ FNP
Sbjct  268  YREALEFNP  276



>ref|XP_002876524.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52783.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T E++ MTEYVVTRWYR PELLL SSDYTAAIDVWSVGCIFME+M+R+PL
Sbjct  201  KICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIMNREPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+D V+QLRLLMELIGTPSE E+  L+E AK+YIRQLP   RQSF+E+FP+  P AID
Sbjct  261  FPGKDQVNQLRLLMELIGTPSEEELGSLSECAKRYIRQLPKLPRQSFSEKFPNVPPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RI+V+ ALAHPYL+ LHDI+DEP C  PFNF+ ++H L+EEQ+KELIY
Sbjct  321  LVEKMLTFDPRQRISVKEALAHPYLSPLHDITDEPECPEPFNFELDEHQLTEEQIKELIY  380

Query  244  REAVAFNPE  218
             EA+AFNPE
Sbjct  381  CEALAFNPE  389



>ref|NP_191538.1| mitogen-activated protein kinase 10 [Arabidopsis thaliana]
 sp|Q9M1Z5.1|MPK10_ARATH RecName: Full=Mitogen-activated protein kinase 10; Short=AtMPK10; 
Short=MAP kinase 10 [Arabidopsis thaliana]
 emb|CAB75798.1| mitogen-activated protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE79969.1| mitogen-activated protein kinase 10 [Arabidopsis thaliana]
Length=393

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T E++ MTEYVVTRWYR PELLL SSDYTAAIDVWSVGCIFME+M+R+PL
Sbjct  201  KICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIMNREPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+D V+QLRLL+ELIGTPSE E+  L+E AK+YIRQLP   RQSFTE+FP+  P AID
Sbjct  261  FPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLPTLPRQSFTEKFPNVPPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP++RI+V+ ALAHPYL+S HDI+DEP C+ PFNFD ++H  SEEQ +ELIY
Sbjct  321  LVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHPFSEEQFRELIY  380

Query  244  REAVAFNPE  218
             EA+AFNPE
Sbjct  381  CEALAFNPE  389



>gb|ADI52626.1| mitogen-activated protein kinase 3 [Gossypium hirsutum]
Length=376

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  SE +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPASENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP Y RQ     FPH +  A+
Sbjct  244  FPGNDHVHQMRLLTELLGTPTESDLGFLQNEDARRYIRQLPAYPRQQLANVFPHVNRMAL  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDI+DEP C  PFNFDFEQ  L EEQMK+++
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDIADEPVCPEPFNFDFEQQPLGEEQMKDMV  363

Query  247  YREAVAFNPEFEQ  209
            YREA+A NP++ +
Sbjct  364  YREALALNPDYAR  376



>ref|XP_008385257.1| PREDICTED: mitogen-activated protein kinase 3 [Malus domestica]
 ref|XP_008366347.1| PREDICTED: mitogen-activated protein kinase 3 [Malus domestica]
Length=370

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQL  + RQ     FPH +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLXQHPRQPLERLFPHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE ALAHPYL  LHD++DEP CT PF+FDFEQ  L EEQMK++I
Sbjct  299  DLVDRMLTFDPTRRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLGEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREAIALNPEY  369



>gb|KJB56016.1| hypothetical protein B456_009G104600 [Gossypium raimondii]
Length=376

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  SE +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPASENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP Y RQ     +PH +  A+
Sbjct  244  FPGNDHVHQMRLLTELLGTPTESDLGFLQNEDARRYIRQLPAYPRQQLANVYPHVNRLAL  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDI+DEP C  PFNFDFEQ  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDIADEPVCPEPFNFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEFEQ  209
            YREA+A NP++ +
Sbjct  364  YREALALNPDYAR  376



>gb|AJA29672.1| mitogen-activated protein kinase 13 [Gossypium hirsutum]
Length=376

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  SE +FMTEYVVTRWYR PE+LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPASENEFMTEYVVTRWYRAPEILLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DHVHQ+RLL EL+GTP+E+++ FL NE+A++YIRQLP Y RQ     +PH +  A+
Sbjct  244  FPGNDHVHQMRLLTELLGTPTESDLGFLQNEDARRYIRQLPAYPRQQLANVYPHVNRLAL  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP RRITVE ALAHPYL  LHDI+DEP C  PFNFDFEQ  L EEQMK++I
Sbjct  304  DLIDRMLTFDPTRRITVEEALAHPYLERLHDIADEPVCPEPFNFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEFEQ  209
            YREA+A NP++ +
Sbjct  364  YREALALNPDYAR  376



>gb|ABG54337.1| double HA-tagged mitogen activated protein kinase 10 [synthetic 
construct]
Length=414

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T E++ MTEYVVTRWYR PELLL SSDYTAAIDVWSVGCIFME+M+R+PL
Sbjct  201  KICDFGLARATPESNLMTEYVVTRWYRAPELLLGSSDYTAAIDVWSVGCIFMEIMNREPL  260

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+D V+QLRLL+ELIGTPSE E+  L+E AK+YIRQLP   RQSFTE+FP+  P AID
Sbjct  261  FPGKDQVNQLRLLLELIGTPSEEELGSLSEYAKRYIRQLPTLPRQSFTEKFPNVPPLAID  320

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDP++RI+V+ ALAHPYL+S HDI+DEP C+ PFNFD ++H  SEEQ +ELIY
Sbjct  321  LVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHPFSEEQFRELIY  380

Query  244  REAVAFNPE  218
             EA+AFNPE
Sbjct  381  CEALAFNPE  389



>ref|XP_010535564.1| PREDICTED: mitogen-activated protein kinase 3 [Tarenaya hassleriana]
Length=372

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDY+AAIDVWSVGCIFMELM+RKPL
Sbjct  181  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYSAAIDVWSVGCIFMELMNRKPL  240

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ     FPH HP AI
Sbjct  241  FPGKDHVHQMRLLTELLGTPTESDLRFTHNEDAKRYIRQLPYHPRQPLGSLFPHVHPMAI  300

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE+MLTFDP RRITVE AL HPYL  LHD  DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  301  DLVERMLTFDPTRRITVEEALNHPYLAKLHDPDDEPICLRPFSFDFEQQPLDEEQIKEMI  360

Query  247  YREAVAFNPEF  215
            YREA+  NP +
Sbjct  361  YREAITLNPTY  371



>ref|NP_001265988.1| mitogen-activated protein kinase 3-like [Cicer arietinum]
 gb|ABF82263.1| MAP kinase [Cicer arietinum]
Length=371

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTMESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP++A++  + NE+A++YIRQLP Y RQ     FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTDADIGLVKNEDARRYIRQLPQYPRQPLNRVFPHVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD++DEP CT PF+F+FEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTVDPTRRITVEEALAHPYLEKLHDVADEPVCTEPFSFEFEQQHLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>ref|XP_010689418.1| PREDICTED: mitogen-activated protein kinase 3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNSSDYTAAID+WSVGCIFMELM+R+PL
Sbjct  185  KICDFGLARPTSENEHMTEYVVTRWYRAPELLLNSSDYTAAIDLWSVGCIFMELMNRRPL  244

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++ FL NE+A++YIRQLP   RQ   + FPH +P AI
Sbjct  245  FPGKDHVHQMRLLTELLGTPTEADLGFLHNEDARRYIRQLPPQPRQQLRQVFPHVNPLAI  304

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKMLTFDP RRITVE AL+HPYL  LHDI+DEP C  PF+F+FEQ AL EEQMK++I
Sbjct  305  DLIEKMLTFDPTRRITVEEALSHPYLARLHDIADEPICQKPFSFEFEQQALGEEQMKDMI  364

Query  247  YREAVAFNPEF  215
            Y EA+A NP +
Sbjct  365  YEEALALNPGY  375



>gb|AGI60283.1| mitogen-activated protein kinase 4 [Dendrobium catenatum]
Length=369

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE D MTEYVVTRWYR PELLLNS+DYTAAID+WSVGCIFMELM+R+ L
Sbjct  177  KICDFGLARPTSENDMMTEYVVTRWYRAPELLLNSTDYTAAIDIWSVGCIFMELMNRRTL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ ELIGTP++AE+ F+ NE+AK YIR LP+  RQSFT  +PH  P AI
Sbjct  237  FPGRDHMHQMRLITELIGTPNDAELGFVRNEDAKTYIRHLPVLPRQSFTALYPHISPAAI  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE+MLTFDP RR+TV+ ALAHPYL  LHD+ DEP C  PF+FDFEQ AL+EE MK+LI
Sbjct  297  DLVERMLTFDPSRRLTVDEALAHPYLERLHDVDDEPVCMEPFSFDFEQQALTEEHMKQLI  356

Query  247  YREAVAFNPEF  215
            Y EA++FNP F
Sbjct  357  YIEALSFNPMF  367



>ref|XP_007016654.1| Mitogen-activated protein kinase 3 [Theobroma cacao]
 gb|EOY34273.1| Mitogen-activated protein kinase 3 [Theobroma cacao]
Length=375

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
             ICDFGLAR  +E +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  NICDFGLARPAAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+A++Y+RQLP + RQ     FPH HP AI
Sbjct  244  FPGKDHVHQMRLLTELLGTPTESDLGFLRNEDARRYLRQLPAHPRQPLANVFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTFDP RRITVE ALAHPYL  LHDI+DEP    PF+FDFEQ  L EEQMK++I
Sbjct  304  DLIERMLTFDPTRRITVEEALAHPYLERLHDIADEPVSAEPFSFDFEQQPLGEEQMKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  364  YKEAIALNPNY  374



>ref|NP_001237882.1| mitogen-activated protein kinase 1 [Glycine max]
 gb|AAQ13491.1|AF104247_1 mitogen-activated protein kinase 1 [Glycine max]
Length=371

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI  FGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIYFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++  + NE+A++YIRQLP Y RQ   + FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTEADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RITVE ALAHPYL  LHD++DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTVDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFDFEQQQLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>ref|XP_007205387.1| hypothetical protein PRUPE_ppa007370mg [Prunus persica]
 ref|XP_008224929.1| PREDICTED: mitogen-activated protein kinase 3 [Prunus mume]
 gb|EMJ06586.1| hypothetical protein PRUPE_ppa007370mg [Prunus persica]
Length=370

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQLP + RQ     FPH +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLPPHPRQPLARLFPHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPYL  LHD++DEP C  PF+FDFEQ  L EEQMK++I
Sbjct  299  DLIDRMLTFDPTKRITVEEALAHPYLERLHDVADEPICNEPFSFDFEQQPLGEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREAIALNPEY  369



>ref|XP_009358265.1| PREDICTED: mitogen-activated protein kinase 3 [Pyrus x bretschneideri]
Length=370

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLL+SSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTAENELLTEYVVTRWYRAPELLLSSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQL    RQ   + FPH HP AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLAPLPRQPLGKLFPHVHPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPYL  LHD++DEP CT PF+FDFEQ  L EEQMK++I
Sbjct  299  DLIDRMLTFDPTKRITVEQALAHPYLERLHDVADEPICTKPFSFDFEQQPLGEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREAIALNPEY  369



>ref|XP_009602556.1| PREDICTED: mitogen-activated protein kinase 3-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  105  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  164

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ FL NE+AK+YIRQLP + RQ     FPH +P AI
Sbjct  165  FPGKDHVHQIRLLTELLGTPTESDLGFLQNEDAKRYIRQLPQHPRQQLANVFPHVNPLAI  224

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD  DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  225  DLVDKMLTLDPTRRITVEEALAHPYLAKLHDAGDEPVCPVPFSFDFEQQGIGEEQIKDMI  284

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  285  YQEALALNPEY  295



>ref|XP_007132165.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
 gb|ESW04159.1| hypothetical protein PHAVU_011G071400g [Phaseolus vulgaris]
Length=371

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTLESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP++A++  + NE+A++YIRQLP Y RQ   + FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTDADLGLVKNEDARRYIRQLPQYPRQPLAQVFPHVHPAAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RITVE ALAHPYL  LHD++DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTIDPTKRITVEEALAHPYLEKLHDVADEPICMEPFSFEFEQQQLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  360  YREALALNPHY  370



>ref|XP_010112333.1| Mitogen-activated protein kinase 3 [Morus notabilis]
 gb|AHJ80961.1| mitogen-activated protein kinase 1 [Morus notabilis]
 gb|EXC33222.1| Mitogen-activated protein kinase 3 [Morus notabilis]
Length=379

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E ++MTEYVVTRWYR PELLLNSSDY+AAIDVWSVGCIFMELM+RKPL
Sbjct  188  KICDFGLARPTAENEYMTEYVVTRWYRAPELLLNSSDYSAAIDVWSVGCIFMELMNRKPL  247

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+AK+YIRQL  + RQ     F H HP AI
Sbjct  248  FPGKDHVHQMRLLTELLGTPTESDLGFVRNEDAKRYIRQLSQFPRQPLGRVFSHVHPLAI  307

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP +RITVE ALAHPY+  LHD++DEP C  PF+F+FEQ  LSE+QMK++I
Sbjct  308  DLVDKMLTFDPNKRITVEEALAHPYMARLHDVADEPVCLEPFSFEFEQQPLSEDQMKDMI  367

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  368  YQEAIALNPEY  378



>gb|AHY02158.1| mitogen-activated protein kinase 3 [Betula platyphylla]
Length=376

 Score =   295 bits (756),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 2/192 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETD-FMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKP  608
            KICDFGLAR T+E D FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKP
Sbjct  184  KICDFGLARPTAENDQFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKP  243

Query  607  LFPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGA  431
            LFPG+DHVHQ+RLL+EL+GTP+++++ F+ N++A++YIRQLP + RQ     FPH HP A
Sbjct  244  LFPGKDHVHQMRLLIELLGTPTDSDLGFVRNDDARRYIRQLPSHPRQQLAMVFPHVHPLA  303

Query  430  IDLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKEL  251
            IDL+EKMLTFDP +RITVE ALAHPY   LHD++DEP C  PF+FDFEQ    EEQMKE+
Sbjct  304  IDLIEKMLTFDPTKRITVEEALAHPYFARLHDVADEPVCPEPFSFDFEQQHFGEEQMKEM  363

Query  250  IYREAVAFNPEF  215
            IY+EA+  NPE+
Sbjct  364  IYQEALGLNPEY  375



>ref|NP_001267653.1| mitogen-activated protein kinase 3-like [Cucumis sativus]
 gb|AAZ57337.1| Trichoderma-induced protein kinase [Cucumis sativus]
 gb|ABG89857.1| NO3-stress-induced mitogen activated protein kinase [Cucumis 
sativus]
 gb|KGN65657.1| hypothetical protein Csa_1G479630 [Cucumis sativus]
Length=370

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNS DYTAAID+WSVGCIF+ELM+R+PL
Sbjct  180  KICDFGLARPTSENECMTEYVVTRWYRAPELLLNS-DYTAAIDIWSVGCIFLELMNRRPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL EL+GTPSE+++ F+ NE++K+Y+RQLP + RQ     FPH HP AI
Sbjct  239  FPGRDHVHQMRLLTELLGTPSESDLGFIRNEDSKRYLRQLPPHPRQPLATVFPHVHPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP +RITVE ALAHPYL  LHDI+DEP C+ PF+F+FEQ  L EEQMKE+I
Sbjct  299  DLVDKMLTFDPTKRITVEEALAHPYLERLHDIADEPVCSEPFSFEFEQQYLDEEQMKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPEF
Sbjct  359  YREALALNPEF  369



>gb|AAF73236.1|AF153061_1 MAP kinase 3 [Pisum sativum]
Length=371

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTMENDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP++A++  + NE+A++YIRQLP Y RQ     FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTDADVGLVKNEDARRYIRQLPQYPRQPLNRVFPHVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL++KMLT DP RRITVE ALAHPYL  LHD++DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  300  DLIDKMLTIDPTRRITVEEALAHPYLEKLHDVADEPICMEPFSFEFEQQHLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>emb|CAA57721.1| protein kinase [Medicago sativa]
Length=371

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E+DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTMESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP++A++  + N++A++YIRQLP Y RQ     FPH HP AI
Sbjct  240  FPGKDHVHQMRLLTELLGTPTDADVGLVKNDDARRYIRQLPQYPRQPLNRVFPHVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD++DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTIDPTRRITVEEALAHPYLEKLHDVADEPICMEPFSFEFEQQHLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>gb|AGV52329.1| MAPK3 [Brassica juncea]
Length=370

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPSFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE AL HPYL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNKRITVEEALNHPYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  359  YREAIALNPTY  369



>gb|AGA37186.1| mitogen-activated protein kinase 3.1 [Brassica napus]
Length=370

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE AL HPYL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNKRITVEEALNHPYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  359  YREAIALNPTY  369



>ref|XP_011007365.1| PREDICTED: mitogen-activated protein kinase 3-like [Populus euphratica]
Length=371

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL EL+G P+E+++ F+ NE+A++YI+QL  + R+S  E FP  HP AI
Sbjct  239  FPGRDHVHQMRLLTELLGKPTESDLGFVRNEDARRYIQQLDSHPRRSLAELFPLVHPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP +RITVE ALAHPYL  LHDI+DEP C  PF+F+FEQ  L+EEQMK++I
Sbjct  299  DLVDKMLTFDPTKRITVEEALAHPYLARLHDIADEPVCLDPFSFEFEQQPLAEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            Y EA+A NPE+
Sbjct  359  YDEAIALNPEY  369



>ref|XP_002314017.1| kinase MMK4 family protein [Populus trichocarpa]
 gb|EEE87972.1| kinase MMK4 family protein [Populus trichocarpa]
Length=371

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+G P+E+++ F+ NE+A++YI+QL  + R+S  E FP  HP AI
Sbjct  239  FPGKDHVHQMRLLTELLGKPTESDLGFVRNEDARRYIQQLDSHPRRSLAELFPLVHPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL++KMLTFDP +RITVE ALAHPYL  LHDI+DEP C  PF+F+FEQ  L+EEQMK++I
Sbjct  299  DLIDKMLTFDPTKRITVEEALAHPYLARLHDIADEPVCLEPFSFEFEQQPLAEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            Y EA+A NPE+
Sbjct  359  YEEALALNPEY  369



>ref|XP_009352415.1| PREDICTED: mitogen-activated protein kinase 3-like [Pyrus x bretschneideri]
Length=370

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTAENELLTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++  + NE+A++YIRQL  + RQ     FPH +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGSVRNEDARRYIRQLAQHPRQPLESVFPHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE ALAHPYL  LHD++DEP CT PF+FDFEQ  L EEQMK++I
Sbjct  299  DLVDRMLTFDPTKRITVEQALAHPYLERLHDVADEPICTEPFSFDFEQQPLVEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREAIALNPEY  369



>ref|XP_009416271.1| PREDICTED: mitogen-activated protein kinase 5-like [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  SE + MTEYVVTRWYR PELLLNS+DYTAAIDVWSVGCIFMELM+R+ L
Sbjct  177  KICDFGLARPASENEIMTEYVVTRWYRAPELLLNSTDYTAAIDVWSVGCIFMELMNRQTL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP+E E+ FL +E+A++Y+R LP Y  +SF   +PH +P AI
Sbjct  237  FPGRDHMHQMRLITEIIGTPTEPELGFLRSEDARRYMRHLPRYPPRSFVGLYPHINPVAI  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE+MLTFDP RRITVE AL HPYL  LHD++DEP+C  PF+FDFEQHAL+EEQMKELI
Sbjct  297  DLVERMLTFDPTRRITVEEALDHPYLERLHDVADEPTCMDPFSFDFEQHALTEEQMKELI  356

Query  247  YREAVAFNPEFE  212
            +RE++AFNP+++
Sbjct  357  HRESIAFNPDYK  368



>gb|ABO84839.1| putative MAP kinase 3 [Catharanthus roseus]
Length=372

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  +E +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RK L
Sbjct  181  KICDFGLARPNTENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKTL  240

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL EL+GTP+E+++ F+ NE+AK+YIRQLP + RQ     F H +P AI
Sbjct  241  FPGRDHVHQMRLLTELLGTPTESDLGFVRNEDAKRYIRQLPRFPRQQLASVFSHINPLAI  300

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL++KMLTFDP +RITV+ ALAHPYL  LHD +DEP C+ PF+FDFEQ A  EEQ+K++I
Sbjct  301  DLIDKMLTFDPAKRITVDEALAHPYLARLHDTADEPVCSEPFSFDFEQQAFGEEQIKDMI  360

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  361  YQEALALNPEY  371



>ref|XP_008358164.1| PREDICTED: mitogen-activated protein kinase 3-like [Malus domestica]
Length=370

 Score =   293 bits (750),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E + +TEYVVTRWYR PELLL+SSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTAENELLTEYVVTRWYRAPELLLSSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQL    RQ     FPH +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLAPLPRQPLERLFPHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            +L+++MLTFDP +RITVE ALAHPYL  LHDI+DEP CT PF+FDFEQ  L EEQMK++I
Sbjct  299  NLIDRMLTFDPTKRITVEQALAHPYLERLHDIADEPICTKPFSFDFEQQPLGEEQMKDMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  359  YREAIALNPEY  369



>ref|XP_006828349.1| hypothetical protein AMTR_s00023p00249950 [Amborella trichopoda]
 gb|ERM95765.1| hypothetical protein AMTR_s00023p00249950 [Amborella trichopoda]
Length=377

 Score =   293 bits (750),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 165/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR ++E DFMTEYVVTRWYR PELLLNS DYTAAID+WSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARTSTEDDFMTEYVVTRWYRAPELLLNSKDYTAAIDIWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD VHQLRL  EL+GTP+E++++F+ +E+AK+Y+R+LP   RQ F E+FPH HP AI
Sbjct  244  FPGRDQVHQLRLQTELLGTPTESDIDFIHSEDAKRYMRRLPPLPRQLFREKFPHVHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P RRITVE ALAHPYL SLHD  DEP+C  PF+ + EQ A+ E+Q+KELI
Sbjct  304  DLMERMLTFNPSRRITVEEALAHPYLASLHDEGDEPTCPEPFSVELEQQAVDEQQIKELI  363

Query  247  YREAVAFNPEF  215
            +REA+AFNPE+
Sbjct  364  HREALAFNPEY  374



>ref|XP_002875737.1| mitogen-activated protein kinase 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51996.1| mitogen-activated protein kinase 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=370

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTEADLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>emb|CDP08947.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR  +E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  138  KIIDFGLARPNTENEVMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  197

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHV+Q+RLL EL+GTP++A++ F+ +E AK+YIRQLP + RQ  ++ FPH +P AI
Sbjct  198  FPGKDHVNQMRLLTELLGTPTDADLGFVRHEEAKRYIRQLPRFPRQQLSKVFPHVNPLAI  257

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP +RITVE ALAHPYL  LHDI+DEP C+ PF+FDFE  A+ EEQ+K++I
Sbjct  258  DLVDKMLTFDPAKRITVEEALAHPYLARLHDIADEPVCSKPFSFDFEHQAVGEEQIKDMI  317

Query  247  YREAVAFNPE  218
            Y+EAVA NPE
Sbjct  318  YQEAVALNPE  327



>ref|XP_006291331.1| hypothetical protein CARUB_v10017466mg [Capsella rubella]
 gb|EOA24229.1| hypothetical protein CARUB_v10017466mg [Capsella rubella]
Length=370

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+EA++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTEADLGFTHNEDAKRYIRQLPSFPRQPLAKLFSHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD SDEP C  PF+F+FEQ  L EEQ+K++I
Sbjct  299  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPSDEPICQKPFSFEFEQQPLDEEQIKDMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>ref|XP_010514890.1| PREDICTED: mitogen-activated protein kinase 3-like [Camelina 
sativa]
Length=370

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQH L EEQ+K++I
Sbjct  299  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPTDEPICQKPFSFEFEQHPLDEEQIKDMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>dbj|BAA09600.1| WIPK [Nicotiana tabacum]
Length=375

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+EA++ FL NE+AK+YIRQLP + RQ   E FPH +P AI
Sbjct  244  FGGKDHVHQIRLLTELLGTPTEADLGFLQNEDAKRYIRQLPQHPRQQLAEVFPHVNPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP RRITVE AL HPYL  LHD  DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  304  DLVDKMLTFDPTRRITVEEALDHPYLAKLHDAGDEPICPVPFSFDFEQQGIGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA++ NPE+
Sbjct  364  YQEALSLNPEY  374



>ref|NP_190150.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 sp|Q39023.2|MPK3_ARATH RecName: Full=Mitogen-activated protein kinase 3; Short=AtMPK3; 
Short=MAP kinase 3 [Arabidopsis thaliana]
 gb|AAK62406.1|AF386961_1 mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 emb|CAB75493.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 gb|AAN15326.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 dbj|BAE98771.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
 gb|AEE78054.1| mitogen-activated protein kinase 3 [Arabidopsis thaliana]
Length=370

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>dbj|BAA04866.1| MAP kinase [Arabidopsis thaliana]
Length=370

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>ref|NP_001284376.1| mitogen-activated protein kinase 3 [Cucumis melo]
 gb|AEG89601.1| mitogen-activated protein [Cucumis melo]
Length=370

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE + MTEYVVTRWYR PELLLNS DYTAAID+WSVGCIF+ELM+R+PL
Sbjct  180  KICDFGLARPTSENECMTEYVVTRWYRAPELLLNS-DYTAAIDIWSVGCIFLELMNRRPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDHVHQ+RLL EL+GTP+E+++ F+ NE++K+Y+RQLP + RQ     FPH HP AI
Sbjct  239  FPGRDHVHQMRLLTELLGTPTESDLGFIRNEDSKRYLRQLPPHPRQPLATVFPHVHPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP +RITVE ALAHPYL  LHD +DEP C+ PF+F+FEQ  L EEQMKE+I
Sbjct  299  DLVDKMLTFDPTKRITVEEALAHPYLERLHDTADEPVCSEPFSFEFEQQYLDEEQMKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NPEF
Sbjct  359  YREALALNPEF  369



>gb|AAZ23129.1| mitogen-activated protein kinase 2 [Arachis hypogaea]
 gb|ABX80392.2| mitogen-activated protein kinase 3 [Arachis hypogaea]
Length=371

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR T E DFMTEYVVTRWYR PELLLNSSDYT+AIDVWSVGCIFMELM++KPL
Sbjct  180  KIIDFGLARPTLENDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
             PG+DHVHQ+RLL EL+GTP+EA++  + +E+A++YIRQLP Y RQ     FPH HP AI
Sbjct  240  LPGKDHVHQMRLLTELLGTPTEADLGLVKSEDARRYIRQLPQYARQPLARIFPHVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP +RIT E ALAHPYL  LHDI+DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  300  DLVDKMLTIDPTKRITDEEALAHPYLEKLHDIADEPVCMEPFSFDFEQQQLDEEQIKEMI  359

Query  247  YREAVAFNPEF  215
            YREA+A NPE+
Sbjct  360  YREALALNPEY  370



>emb|CDX86029.1| BnaC03g55440D [Brassica napus]
Length=370

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +  AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNSLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE AL HPYL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNKRITVEEALNHPYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  359  YREAIALNPTY  369



>gb|ABK25416.1| unknown [Picea sitchensis]
 gb|ABR17824.1| unknown [Picea sitchensis]
Length=372

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 166/193 (86%), Gaps = 1/193 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCIFME++ R+PL
Sbjct  180  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCIFMEILKREPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+V QLRL+ ELIG+P ++++ FL ++NA++YIRQLP + +Q F+++FP+  P A+
Sbjct  240  FPGKDYVQQLRLITELIGSPDDSDLGFLRSDNARRYIRQLPQFPKQPFSQKFPNMAPAAV  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP +RITV+ AL+HPYL SLHDI+DEPSC TPFNFDFEQ + +EE +KELI
Sbjct  300  DLLEKMLVFDPSKRITVQEALSHPYLASLHDINDEPSCPTPFNFDFEQPSFTEEHIKELI  359

Query  247  YREAVAFNPEFEQ  209
            +RE + FNP+  Q
Sbjct  360  WRETLNFNPDMMQ  372



>ref|NP_001234360.1| mitogen-activated protein kinase 3 [Solanum lycopersicum]
 gb|AAP20421.1| mitogen-activated protein kinase 3 [Solanum lycopersicum]
 gb|ACY27517.1| mitogen-activated protein kinase 3 [Solanum lycopersicum]
Length=373

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  182  KICDFGLARPNVENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ FL NE+AK+Y+RQLP + RQ     FPH +P AI
Sbjct  242  FAGKDHVHQIRLLTELLGTPTESDLSFLRNEDAKRYVRQLPQHPRQQLATVFPHVNPLAI  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD +DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  302  DLVDKMLTLDPTRRITVEEALAHPYLAKLHDAADEPVCPIPFSFDFEQQGIGEEQIKDMI  361

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  362  YQEALALNPEY  372



>ref|XP_002298450.1| kinase MMK4 family protein [Populus trichocarpa]
 gb|EEE83255.1| kinase MMK4 family protein [Populus trichocarpa]
Length=370

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQL  +  +S  E FP   P AI
Sbjct  239  FPGKDNVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLDSHPHRSLAELFPLFQPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP RRITVE ALAHPYL  LHDI+DEP C  PF+F+FEQ  L+EEQMK+++
Sbjct  299  DLVDKMLTFDPTRRITVEEALAHPYLARLHDIADEPVCPEPFSFEFEQQPLTEEQMKDMV  358

Query  247  YREAVAFNPEF  215
            Y EA+AFNPE+
Sbjct  359  YEEAIAFNPEY  369



>gb|KFK33939.1| hypothetical protein AALP_AA5G081200 [Arabis alpina]
Length=369

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  178  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  237

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  238  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAI  297

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  298  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  357

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  358  YQEAIALNPTY  368



>gb|ADU54564.1| wound-induced mitogen-activated protein kinase [Nicotiana glutinosa]
Length=374

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  183  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  242

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ FL NE+AK+YIRQLP + RQ   E FPH +P AI
Sbjct  243  FAGKDHVHQIRLLTELLGTPTESDLGFLQNEDAKRYIRQLPQHPRQQLAEVFPHVNPLAI  302

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAH YL  LHD  DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  303  DLVDKMLTLDPTRRITVEEALAHSYLAKLHDAGDEPVCPVPFSFDFEQQGIGEEQIKDMI  362

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  363  YQEALALNPEY  373



>ref|XP_009150063.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
3 [Brassica rapa]
Length=370

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YI QLP + RQ     F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYILQLPNFPRQPLAXLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP +RITVE AL HPYL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPSKRITVEEALNHPYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  359  YREAIALNPTY  369



>gb|AAV34677.1| mitogen-activated protein kinase 3 [Brassica napus]
Length=370

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +  AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNSLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP  RITVE AL HPYL  LHD +DEP C  PF+FDFEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNERITVEEALNHPYLAKLHDPNDEPICLKPFSFDFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            YREA+A NP +
Sbjct  359  YREAIALNPTY  369



>gb|ABG54330.1| double HA-tagged mitogen activated protein kinase 3 [synthetic 
construct]
Length=391

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+KE+I
Sbjct  299  DLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>ref|XP_010425992.1| PREDICTED: mitogen-activated protein kinase 3-like [Camelina 
sativa]
Length=370

 Score =   290 bits (743),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPSFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+K++I
Sbjct  299  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPTDEPICQKPFSFEFEQQPLDEEQIKDMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>emb|CBI16244.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  138  KICDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  197

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ F+ N++A++YI QLP + RQ     FPH HP AI
Sbjct  198  FAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHPLAI  257

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPYL+ LHD +DEP C  PF+F+FEQ AL EEQMK++I
Sbjct  258  DLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMKDMI  317

Query  247  YREAVAFNPEF  215
            Y+EA+ FNP +
Sbjct  318  YQEALFFNPGY  328



>ref|XP_010503182.1| PREDICTED: mitogen-activated protein kinase 3 [Camelina sativa]
Length=370

 Score =   290 bits (742),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE DFMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  179  KICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  239  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  L EEQ+K++I
Sbjct  299  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPTDEPICQKPFSFEFEQQPLDEEQIKDMI  358

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  359  YQEAIALNPTY  369



>gb|ABW34945.1| mitogen-activated protein kinase 3 [Solanum peruvianum]
Length=373

 Score =   290 bits (742),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  182  KICDFGLARPNVENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ FL NE+AK+Y+RQLP + RQ     FPH +P AI
Sbjct  242  FAGKDHVHQIRLLTELLGTPTESDLSFLRNEDAKRYVRQLPQHPRQQLATVFPHVNPLAI  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD +DEP C  PF+FDFEQ  + EEQ+K +I
Sbjct  302  DLVDKMLTLDPTRRITVEEALAHPYLAKLHDAADEPVCPIPFSFDFEQQGIGEEQIKYMI  361

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  362  YQEALALNPEY  372



>ref|XP_011025025.1| PREDICTED: mitogen-activated protein kinase 3-like isoform X1 
[Populus euphratica]
Length=370

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TS  +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGC+FMELM+RKPL
Sbjct  179  KICDFGLARPTSANEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCVFMELMNRKPL  238

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQ+RLL EL+GTP+E+++ F+ NE+A++YIRQL  + R+S  E FP   P AI
Sbjct  239  FPGKDNVHQMRLLTELLGTPTESDLGFVRNEDARRYIRQLDSHPRRSLAELFPLFQPLAI  298

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTFDP RRITVE ALAHPYL  LHDI+DEP C  PF+F+FEQ  L+EEQMK+++
Sbjct  299  DLVDKMLTFDPTRRITVEEALAHPYLARLHDIADEPVCPEPFSFEFEQQPLTEEQMKDMV  358

Query  247  YREAVAFNPEF  215
            Y EA+A NPE+
Sbjct  359  YEEAIALNPEY  369



>dbj|BAM13298.1| MAP kinase 5 [Oryza australiensis]
Length=265

 Score =   286 bits (731),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+AKKY+R LP Y R++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDAKKYMRHLPQYHRRTFANMFPRVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPVCLEPFSFDFEQQALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  253  FNEAIEMNPNF  263



>ref|NP_001275448.1| mitogen-activated protein kinase 3-like [Solanum tuberosum]
 dbj|BAE44363.1| MAP kinase [Solanum tuberosum]
Length=373

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  182  KICDFGLARPNLENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP E+++ FL NE+AK+Y+RQLP + RQ     FPH +P AI
Sbjct  242  FAGKDHVHQIRLLTELLGTPXESDLSFLRNEDAKRYVRQLPQHPRQQLATVFPHVNPLAI  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD +DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  302  DLVDKMLTLDPTRRITVEEALAHPYLXKLHDAADEPVCPIPFSFDFEQQGIGEEQIKDMI  361

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  362  YQEALALNPEY  372



>gb|ABJ89813.1| wound-induced protein kinase [Nicotiana attenuata]
Length=375

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 158/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+EA++ FL NE+AK+YIRQLP + RQ   + FPH +P AI
Sbjct  244  FAGKDHVHQIRLLTELLGTPTEADLGFLQNEDAKRYIRQLPQHPRQQLAKVFPHVNPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE AL HPYL  LHD  DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  304  DLVDKMLTLDPTRRITVEEALDHPYLAKLHDAGDEPVCPVPFSFDFEQQGIGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA++ NPE+
Sbjct  364  YQEALSLNPEY  374



>gb|ABY85198.2| mitogen activated protein kinase 1 [Datura metel]
Length=375

 Score =   289 bits (740),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PE LLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPNLENENMTEYVVTRWYRAPEPLLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ FL NE+AK+YIRQLP + RQ   + FPH +P AI
Sbjct  244  FAGKDHVHQIRLLTELLGTPTESDLSFLRNEDAKRYIRQLPQHPRQQLAKVFPHVNPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE ALAHPYL  LHD +DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  304  DLVDKMLTLDPTRRITVEEALAHPYLAKLHDAADEPVCPIPFSFDFEQQGIGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+A NPE+
Sbjct  364  YQEALALNPEY  374



>ref|XP_009802373.1| PREDICTED: mitogen-activated protein kinase 3 [Nicotiana sylvestris]
 dbj|BAB79636.1| wound induced protein kinase [Nicotiana tabacum]
Length=375

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  184  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL E +GTP+EA++ FL NE+AK+YIRQLP + RQ   E FPH +P AI
Sbjct  244  FAGKDHVHQIRLLTEFLGTPTEADLGFLQNEDAKRYIRQLPQHPRQQLAEVFPHVNPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE AL HPYL  LHD  DEP C  PF+FDFEQ  + EEQ+K++I
Sbjct  304  DLVDKMLTLDPTRRITVEEALDHPYLAKLHDAGDEPICPVPFSFDFEQQGIGEEQIKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA++ NPE+
Sbjct  364  YQEALSLNPEY  374



>ref|XP_002284807.1| PREDICTED: mitogen-activated protein kinase 3 [Vitis vinifera]
Length=375

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T+E +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+R+PL
Sbjct  184  KICDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+E+++ F+ N++A++YI QLP + RQ     FPH HP AI
Sbjct  244  FAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHPLAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+++MLTFDP +RITVE ALAHPYL+ LHD +DEP C  PF+F+FEQ AL EEQMK++I
Sbjct  304  DLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMKDMI  363

Query  247  YREAVAFNPEF  215
            Y+EA+ FNP +
Sbjct  364  YQEALFFNPGY  374



>gb|AII16885.1| mitogen activated protein kinase, partial [Camellia sinensis]
Length=192

 Score =   282 bits (722),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            +I DFGLAR TSE + MTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELM+RKPL
Sbjct  2    EIIDFGLARPTSENEGMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMNRKPL  61

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG DH+HQ+RLL+EL+GTP+E+++EF+ +E+A++Y+RQ P + RQ     FPH +P AI
Sbjct  62   FPGNDHMHQMRLLIELLGTPTESDLEFIRSEDARRYLRQFPQHPRQQLAMVFPHVNPLAI  121

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E MLTFDP +RITVE ALAHPYL  LHDI+DEP CT  F+FDFEQ A+ EEQ+K++I
Sbjct  122  DLIENMLTFDPSKRITVEQALAHPYLARLHDIADEPVCTESFSFDFEQ-AMGEEQIKDMI  180

Query  247  YREAVAFNPEF  215
            Y+EA+  NPEF
Sbjct  181  YQEAIVLNPEF  191



>gb|KJB24765.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
Length=284

 Score =   285 bits (728),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  92   KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMSRQPL  151

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP   RQ+F+ RFP+  PGAI
Sbjct  152  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQNPRQNFSSRFPNMSPGAI  211

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+GAL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  212  DLLEKMLIFDPHRRITVDGALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKELI  271

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  272  YRESVKFNPD  281



>dbj|BAM13295.1| MAP kinase 5 [Oryza officinalis]
 dbj|BAM13296.1| MAP kinase 5 [Oryza latifolia]
Length=265

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQQALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  253  FNEAIEMNPNF  263



>gb|KJB24767.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
 gb|KJB24768.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
Length=280

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  88   KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMSRQPL  147

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP   RQ+F+ RFP+  PGAI
Sbjct  148  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQNPRQNFSSRFPNMSPGAI  207

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+GAL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  208  DLLEKMLIFDPHRRITVDGALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKELI  267

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  268  YRESVKFNPD  277



>ref|XP_003633959.1| PREDICTED: mitogen-activated protein kinase homolog MMK2 [Vitis 
vinifera]
 emb|CAN75543.1| hypothetical protein VITISV_000466 [Vitis vinifera]
 emb|CBI40425.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  182  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ F  RFP+  PGAI
Sbjct  242  FPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQQFQARFPNMSPGAI  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITVEGAL+HPYL  LHDI++EP C  PF FDFEQ + +EE +KELI
Sbjct  302  DLLEKMLVFDPNRRITVEGALSHPYLAPLHDINEEPVCPRPFVFDFEQPSFTEENIKELI  361

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  362  WRESVKFNPD  371



>dbj|BAM13291.1| MAP kinase 5 [Oryza nivara]
 dbj|BAM13292.1| MAP kinase 5 [Oryza rufipogon]
 dbj|BAM13293.1| MAP kinase 5 [Oryza barthii]
Length=265

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  253  FNEAIEMNPNF  263



>ref|XP_006828303.1| hypothetical protein AMTR_s00023p00233730 [Amborella trichopoda]
 gb|ERM95719.1| hypothetical protein AMTR_s00023p00233730 [Amborella trichopoda]
Length=371

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCIFME+M R+PL
Sbjct  180  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCIFMEIMKREPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+V QLRL+ EL+G+P ++++ FL ++NA++Y+RQLP + +Q F+E+FP   P AI
Sbjct  240  FPGKDYVQQLRLITELLGSPEDSDLGFLRSDNARRYVRQLPHFPKQPFSEKFPDLSPEAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVEKML FDP +RI+VE AL HP+L+SLH+I++EP C++PFNFDFEQ + +EE +KELI
Sbjct  300  DLVEKMLVFDPCKRISVEEALRHPFLSSLHEINEEPICSSPFNFDFEQASFTEEDIKELI  359

Query  247  YREAVAFNPEFE  212
            YRE+++FNP+ +
Sbjct  360  YRESLSFNPDMK  371



>dbj|BAC53771.1| wound-inuduced protein kinase [Nicotiana benthamiana]
Length=376

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 156/191 (82%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   E + MTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  185  KICDFGLARPNIENENMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  244

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+GTP+EA++ FL NE+AK+YIRQLP + RQ     FPH +P AI
Sbjct  245  FAGKDHVHQIRLLTELLGTPTEADLGFLQNEDAKRYIRQLPQHPRQQLANVFPHVNPLAI  304

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLT DP RRITVE AL HPYL  LHD  DEP C  P +FDFEQ  + EEQ+K++I
Sbjct  305  DLVDKMLTLDPTRRITVEEALDHPYLAKLHDAGDEPICPVPSSFDFEQQGIGEEQIKDMI  364

Query  247  YREAVAFNPEF  215
            Y+EA++ NPE+
Sbjct  365  YQEALSLNPEY  375



>dbj|BAM13299.1| MAP kinase 5 [Oryza brachyantha]
Length=265

 Score =   282 bits (721),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y  ++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDEELGFIRNEDARKYMRHLPQYPHRTFASMFPQVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALEHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  253  FNEAIEMNPNF  263



>ref|XP_009624465.1| PREDICTED: mitogen-activated protein kinase homolog MMK2, partial 
[Nicotiana tomentosiformis]
Length=229

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            K+ DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  37   KVGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  96

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQL+L+ ELIG+P +A + FL ++NA++Y+RQLP Y RQ F  RFP++ PGA+
Sbjct  97   FPGKDYVHQLKLITELIGSPDDASLGFLRSDNARRYVRQLPQYPRQQFAARFPNSSPGAV  156

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RR+TV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  157  DLLEKMLVFDPSRRVTVDQALCHPYLAPLHDINEEPICPKPFSFDFEQPSFTEENIKELI  216

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  217  WRESVKFNPD  226



>dbj|BAM13294.1| MAP kinase 5 [Oryza punctata]
Length=265

 Score =   281 bits (720),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQQALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + E +  NP F
Sbjct  253  FNETIEMNPNF  263



>gb|KJB24766.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
 gb|KJB24769.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
 gb|KJB24770.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
 gb|KJB24771.1| hypothetical protein B456_004G159400 [Gossypium raimondii]
Length=370

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  178  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMSRQPL  237

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP   RQ+F+ RFP+  PGAI
Sbjct  238  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQNPRQNFSSRFPNMSPGAI  297

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+GAL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  298  DLLEKMLIFDPHRRITVDGALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKELI  357

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  358  YRESVKFNPD  367



>ref|XP_004143889.1| PREDICTED: mitogen-activated protein kinase 4-like [Cucumis sativus]
 ref|XP_004166231.1| PREDICTED: mitogen-activated protein kinase 4-like [Cucumis sativus]
 ref|XP_008437327.1| PREDICTED: mitogen-activated protein kinase 4-like [Cucumis melo]
 ref|XP_008437328.1| PREDICTED: mitogen-activated protein kinase 4-like [Cucumis melo]
 gb|KGN50066.1| hypothetical protein Csa_5G152810 [Cucumis sativus]
Length=383

 Score =   285 bits (730),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAIDVWSVGCI  E+M R+PL
Sbjct  184  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILGEIMTREPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ EL+G+P +A + FL ++NA++Y++QLP YR+Q F+ RFP+  P A+
Sbjct  244  FPGKDYVHQLRLITELLGSPDDASLGFLRSDNARRYVKQLPQYRKQQFSARFPNMSPSAL  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP +RITVE AL HPYL SLHDI+DEP C  PFNFDFEQ + +EE +KELI
Sbjct  304  DLLEKMLVFDPNKRITVEEALCHPYLQSLHDINDEPVCARPFNFDFEQPSCTEEHIKELI  363

Query  247  YREAVAFNPE  218
            ++E+V FNP+
Sbjct  364  WKESVRFNPD  373



>ref|XP_007051730.1| MAP kinase 4 [Theobroma cacao]
 gb|EOX95887.1| MAP kinase 4 [Theobroma cacao]
Length=374

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  182  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPL  241

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F+ RFP+  PGA+
Sbjct  242  FPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSARFPYMSPGAV  301

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  302  DLLEKMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKELI  361

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  362  YRESVKFNPD  371



>gb|AJA29676.1| mitogen-activated protein kinase 18 [Gossypium hirsutum]
Length=370

 Score =   285 bits (728),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  178  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMSRQPL  237

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP   RQ+F+ RFP+  PGAI
Sbjct  238  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQNPRQNFSSRFPNLSPGAI  297

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+GAL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  298  DLLEKMLIFDPHRRITVDGALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKELI  357

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  358  YRESVKFNPD  367



>gb|AAV68711.1| mitogen-activated protein kinase 3 [Chorispora bungeana]
Length=369

 Score =   285 bits (728),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 159/191 (83%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSE +FMTEYVVTRWYR PELLLNSS+YTAAIDVWSVGCIFMELM+RKPL
Sbjct  178  KICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSEYTAAIDVWSVGCIFMELMNRKPL  237

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+DHVHQ+RLL EL+GTP+E+++ F  NE+AK+YIRQLP + RQ   + F H +P AI
Sbjct  238  FPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPSFPRQPLAKLFSHVNPLAI  297

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV++MLTFDP RRITVE AL H YL  LHD +DEP C  PF+F+FEQ  +  EQ+KE+I
Sbjct  298  DLVDRMLTFDPNRRITVEEALNHQYLAKLHDPNDEPICQKPFSFEFEQQPMDVEQIKEMI  357

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  358  YKEAIALNPTY  368



>gb|AJP75153.1| mitogen-activated protein kinase 4 [Gossypium hirsutum]
Length=365

 Score =   285 bits (728),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  173  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  232

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F+ RFP+  PGA+
Sbjct  233  FPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSVRFPNMSPGAV  292

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+ML FDP RRITV+ AL HPYL  LHDI++EP C  PFNFDFEQ + +EE +KELI
Sbjct  293  DLLERMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPRPFNFDFEQPSFTEENIKELI  352

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  353  YRESVKFNPD  362



>gb|AFW88747.1| putative MAP kinase family protein [Zea mays]
Length=321

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  129  KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  188

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP + R+ F   FP   P A+
Sbjct  189  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQFPRRPFVSLFPRMQPVAL  248

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHD++DEP CT PF+FDFEQ AL+E+QMK+LI
Sbjct  249  DLIERMLTFNPLQRITVEEALEHPYLERLHDVADEPICTDPFSFDFEQQALTEDQMKQLI  308

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  309  FNEAIELNPNF  319



>gb|AAL87690.1|AF479884_1 MAP kinase MAPK5b [Oryza sativa]
Length=265

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLI  252

Query  247  YREAVAFNP  221
            + EA+  NP
Sbjct  253  FNEAIEMNP  261



>ref|XP_008660261.1| PREDICTED: mitogen-activated protein kinase 5 isoform X2 [Zea 
mays]
 gb|AFW88744.1| putative MAP kinase family protein [Zea mays]
Length=330

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  138  KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  197

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP + R+ F   FP   P A+
Sbjct  198  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQFPRRPFVSLFPRMQPVAL  257

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHD++DEP CT PF+FDFEQ AL+E+QMK+LI
Sbjct  258  DLIERMLTFNPLQRITVEEALEHPYLERLHDVADEPICTDPFSFDFEQQALTEDQMKQLI  317

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  318  FNEAIELNPNF  328



>gb|KJB06428.1| hypothetical protein B456_001G1588001, partial [Gossypium raimondii]
 gb|KJB06429.1| hypothetical protein B456_001G1588001, partial [Gossypium raimondii]
 gb|KJB06430.1| hypothetical protein B456_001G1588001, partial [Gossypium raimondii]
 gb|KJB06431.1| hypothetical protein B456_001G1588001, partial [Gossypium raimondii]
Length=318

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  126  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  185

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F+ RFP+  PGA+
Sbjct  186  FPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSVRFPNTSPGAV  245

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+ML FDP RRITV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  246  DLLERMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEEDIKELI  305

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  306  YRESVKFNPD  315



>gb|AAK01710.1|AF332873_1 MAP kinase BIMK1 [Oryza sativa Indica Group]
 gb|EEC75005.1| hypothetical protein OsI_11072 [Oryza sativa Indica Group]
Length=369

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  177  KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  236

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  237  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  296

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  297  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLI  356

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  357  FNEAIEMNPNF  367



>gb|KFK30715.1| hypothetical protein AALP_AA6G018100 [Arabis alpina]
Length=374

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            K+ DFGLAR  SETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E M R+PL
Sbjct  183  KLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPL  242

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F  RFP+  PGA+
Sbjct  243  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSPGAV  302

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+ AL HPYL  LHDI++EP C  PFNFDFEQ +LSEE +KELI
Sbjct  303  DLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCLRPFNFDFEQPSLSEENIKELI  362

Query  247  YREAVAFNPE  218
            YRE V FNP+
Sbjct  363  YRETVKFNPQ  372



>ref|XP_010512256.1| PREDICTED: mitogen-activated protein kinase 10-like [Camelina 
sativa]
Length=394

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T E+  MTEYVVTRWYR PELLL +SDYTAAIDVWSVGCIFME+M+RK L
Sbjct  203  KICDFGLARSTPESHEMTEYVVTRWYRAPELLLGTSDYTAAIDVWSVGCIFMEMMNRKTL  262

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+D VHQLRL +EL+GTP+E ++E  +ENAK+YIR L  + RQSF+E FP+  P AID
Sbjct  263  FPGKDQVHQLRLHLELLGTPTEEDLELFSENAKRYIRHLSKHPRQSFSEIFPNVPPLAID  322

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RI+V+ ALAHPYL+SLHD SDEP C  PF  D E+ +L+EEQ+KELIY
Sbjct  323  LVEKMLTFDPRKRISVKEALAHPYLSSLHDPSDEPECMMPFTSDLEESSLTEEQVKELIY  382

Query  244  REAVAFNPEFE  212
             EA+AFNPE +
Sbjct  383  CEALAFNPEHQ  393



>gb|KHG15311.1| Mitogen-activated protein kinase 4 [Gossypium arboreum]
Length=387

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  195  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMSRQPL  254

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F+ RFP+  PGAI
Sbjct  255  FPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSSRFPNMSPGAI  314

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  315  DLLEKMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPMPFSFDFEQPSFTEENIKELI  374

Query  247  YREAVAFNPE  218
            YRE+V FNP+
Sbjct  375  YRESVKFNPD  384



>gb|AJA29674.1| mitogen-activated protein kinase 16 [Gossypium hirsutum]
Length=365

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  173  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  232

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P ++ + FL ++NA++Y+RQLP Y RQ+F+ RFP+  PGA+
Sbjct  233  FPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSVRFPNMSPGAV  292

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+ML FDP RRITV+ AL HPYL  LHDI++EP C  PFNFDFEQ + +EE +KELI
Sbjct  293  DLLERMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPRPFNFDFEQPSFTEENIKELI  352

Query  247  YREAVAFNPE  218
            YRE V FNP+
Sbjct  353  YREPVKFNPD  362



>ref|XP_001763232.1| predicted protein [Physcomitrella patens]
 gb|EDQ72109.1| predicted protein [Physcomitrella patens]
Length=380

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAIDVWSVGCIFMEL++R+PL
Sbjct  184  KICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNREPL  243

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+V QLRL+ ELIG+P + ++ FL ++NA++YIRQLP + RQ    +FP+  P AI
Sbjct  244  FPGRDYVQQLRLITELIGSPEDHDLGFLRSDNARRYIRQLPRFARQPLDRKFPNMGPAAI  303

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE ML FDP RRITVE ALAHPYL +LHDI+DEP C +PF FDFEQ + +EE +KELI
Sbjct  304  DLVEHMLRFDPARRITVEEALAHPYLATLHDINDEPICHSPFEFDFEQPSFTEEHIKELI  363

Query  247  YREAVAFNP  221
              EA+AFNP
Sbjct  364  MMEAIAFNP  372



>dbj|BAM13297.1| MAP kinase 5 [Oryza latifolia]
Length=265

 Score =   280 bits (715),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  73   KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  132

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP     A+
Sbjct  133  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFANMFPRVQHAAL  192

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  193  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQQALNEDQMKQLI  252

Query  247  YREAVAFNPEF  215
            + EA+  NP F
Sbjct  253  FNEAIEMNPNF  263



>gb|KJB20599.1| hypothetical protein B456_003G155700 [Gossypium raimondii]
Length=234

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLL+ S+YTAAID+WSVGCI  E+M R+PL
Sbjct  42   KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLSCSEYTAAIDIWSVGCILGEIMTREPL  101

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P +A + FL ++NA++Y+RQLP  R+Q F+ RFP+   GA+
Sbjct  102  FPGKDYVHQLRLITELIGSPDDASLGFLRSDNARRYVRQLPQCRKQQFSARFPNMSAGAV  161

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+ AL+HPYL SLHDI+DEP C  PF FDFEQ + SE+ +KELI
Sbjct  162  DLLEKMLVFDPDRRITVDEALSHPYLASLHDINDEPVCARPFIFDFEQLSCSEDHIKELI  221

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  222  WRESVKFNPD  231



>gb|KJB20598.1| hypothetical protein B456_003G155700 [Gossypium raimondii]
Length=250

 Score =   279 bits (713),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLL+ S+YTAAID+WSVGCI  E+M R+PL
Sbjct  58   KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLSCSEYTAAIDIWSVGCILGEIMTREPL  117

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P +A + FL ++NA++Y+RQLP  R+Q F+ RFP+   GA+
Sbjct  118  FPGKDYVHQLRLITELIGSPDDASLGFLRSDNARRYVRQLPQCRKQQFSARFPNMSAGAV  177

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RRITV+ AL+HPYL SLHDI+DEP C  PF FDFEQ + SE+ +KELI
Sbjct  178  DLLEKMLVFDPDRRITVDEALSHPYLASLHDINDEPVCARPFIFDFEQLSCSEDHIKELI  237

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  238  WRESVKFNPD  247



>gb|ADT91692.1| mitogen-activated protein kinase 4 [Nicotiana attenuata]
Length=373

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            K+ DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  181  KVGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  240

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P +A + FL ++NA++Y+RQLP Y RQ F  RFP++ PGA+
Sbjct  241  FPGKDYVHQLRLITELIGSPDDASLGFLRSDNARRYVRQLPQYPRQQFAARFPNSSPGAV  300

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RR+TV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  301  DLLEKMLVFDPSRRVTVDQALCHPYLAPLHDINEEPICPKPFSFDFEQPSFTEENIKELI  360

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  361  WRESVKFNPD  370



>gb|AGD94958.1| mitogen-activated protein kinase [Lilium regale]
Length=375

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KI DFGLAR TSETDFMTEYVVTRWYR PELLLN SDYTAAID+WSVGCI  E++ R+P+
Sbjct  183  KIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSDYTAAIDIWSVGCILGEIVTREPI  242

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+VHQLRL+ ELIG+P +  + FL ++NA++Y+RQLP Y +Q F  RFP   PGA+
Sbjct  243  FPGRDYVHQLRLITELIGSPDDTSLGFLRSDNARRYVRQLPQYPKQQFATRFPTMSPGAV  302

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP +RITV+ AL HPYL SLHDI+DEP C+ PF+FDFEQ   +EE +KELI
Sbjct  303  DLLEKMLVFDPSKRITVDEALCHPYLASLHDINDEPVCSAPFSFDFEQPTFTEENIKELI  362

Query  247  YREAVAFNPE  218
            +REA+ FNP+
Sbjct  363  WREALKFNPD  372



>gb|ADQ85914.1| mitogen-activated protein kinase [Ipomoea batatas]
Length=365

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR   + +FMTEYVVTRWYR PELLLNSSDYTAAIDVWSVGCIFMELM+RKPL
Sbjct  175  KICDFGLARTNLDNEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPL  234

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RL+ EL+GTP+++++  + NENA++YIRQLPL  RQ     FPH HP AI
Sbjct  235  FQGKDHVHQMRLITELLGTPTDSDLGSIQNENARRYIRQLPLRPRQQLANVFPHVHPLAI  294

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLV+KMLTF+P +RITVE ALAHPYL  LHD SDEP C  PF  DFE+ A  EEQ+K++I
Sbjct  295  DLVDKMLTFNPSKRITVEEALAHPYLAQLHDKSDEPICPVPFT-DFEKQAYGEEQIKDMI  353

Query  247  YREAVAFNPEF  215
            Y+EA+A NP +
Sbjct  354  YQEALAMNPGY  364



>ref|XP_010469270.1| PREDICTED: mitogen-activated protein kinase 10-like [Camelina 
sativa]
Length=329

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR T E+  MTEYVVTRWYR PELLL +SDYTAAIDVWSVGCIFME+M+RK L
Sbjct  136  KICDFGLARSTPESHEMTEYVVTRWYRAPELLLGTSDYTAAIDVWSVGCIFMEMMNRKTL  195

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFLNENAKKYIRQLPLYRRQSFTERFPHAHPGAID  425
            FPG+D VHQLRL +ELIGTP+E ++E  +ENAK+YIRQL  + RQ F+E+FP+  P AID
Sbjct  196  FPGKDQVHQLRLHLELIGTPTEEDLELFSENAKRYIRQLSKHPRQPFSEKFPNVPPLAID  255

Query  424  LVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELIY  245
            LVEKMLTFDPR+RI+V+ ALAHPYL+SLHD +DEP C  PF FD ++ +L+EEQ+KE IY
Sbjct  256  LVEKMLTFDPRKRISVKEALAHPYLSSLHDPTDEPECMMPFTFDSDERSLTEEQIKEFIY  315

Query  244  REAVAF-NPEFEQQ  206
             EA+AF NPE  Q 
Sbjct  316  CEALAFNNPEQHQH  329



>ref|XP_009767886.1| PREDICTED: mitogen-activated protein kinase homolog MMK2 [Nicotiana 
sylvestris]
Length=373

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            K+ DFGLAR TSETDFMTEYVVTRWYR PELLLN S+YTAAID+WSVGCI  E+M R+PL
Sbjct  181  KVGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQPL  240

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPG+D+VHQLRL+ ELIG+P +A + FL ++NA++Y+RQLP Y RQ F  RFP++ PGA+
Sbjct  241  FPGKDYVHQLRLITELIGSPDDASLGFLRSDNARRYVRQLPQYPRQQFAARFPNSSPGAV  300

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+EKML FDP RR+TV+ AL HPYL  LHDI++EP C  PF+FDFEQ + +EE +KELI
Sbjct  301  DLLEKMLVFDPSRRVTVDQALCHPYLAPLHDINEEPICPKPFSFDFEQPSFTEENIKELI  360

Query  247  YREAVAFNPE  218
            +RE+V FNP+
Sbjct  361  WRESVKFNPD  370



>ref|XP_002976336.1| hypothetical protein SELMODRAFT_449423 [Selaginella moellendorffii]
 ref|XP_002994058.1| hypothetical protein SELMODRAFT_449420 [Selaginella moellendorffii]
 gb|EFJ04892.1| hypothetical protein SELMODRAFT_449420 [Selaginella moellendorffii]
 gb|EFJ22596.1| hypothetical protein SELMODRAFT_449423 [Selaginella moellendorffii]
Length=374

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR TSETD+MTEYVVTRWYR PELLLN S+YTAAIDVWSVGCIFMEL++R+PL
Sbjct  180  KICDFGLARTTSETDYMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCIFMELLNREPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRD+V QLRL+ ELIG+P +A++ FL N+NA++Y+RQL  Y RQSF  RFP+  P A+
Sbjct  240  FPGRDYVQQLRLITELIGSPEDADLGFLRNDNARRYVRQLQRYPRQSFAHRFPNVPPLAV  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DLVE+ML F+P+ RI+V  ALAHPYLT+LHD++DEPSC  PF+FDFEQ   SE+ +KELI
Sbjct  300  DLVERMLVFNPQNRISVTEALAHPYLTNLHDVNDEPSCHGPFDFDFEQPTFSEDNIKELI  359

Query  247  YREAVAF  227
            Y E++ F
Sbjct  360  YEESLTF  366



>gb|AAO16999.1| Putative MAP kinase 1 [Oryza sativa Japonica Group]
Length=357

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 160/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR +SE+D MTEYVVTRWYR PELLLNS+DY+AAIDVWSVGCIFMEL++R+PL
Sbjct  165  KICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPL  224

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            FPGRDH+HQ+RL+ E+IGTP++ E+ F+ NE+A+KY+R LP Y R++F   FP   P A+
Sbjct  225  FPGRDHMHQMRLITEVIGTPTDDELGFIRNEDARKYMRHLPQYPRRTFASMFPRVQPAAL  284

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL+E+MLTF+P +RITVE AL HPYL  LHDI+DEP C  PF+FDFEQ AL+E+QMK+LI
Sbjct  285  DLIERMLTFNPLQRITVEEALDHPYLERLHDIADEPICLEPFSFDFEQKALNEDQMKQLI  344

Query  247  YREAVAFNPEF  215
            + EA+  NP  
Sbjct  345  FNEAIEMNPNI  355



>emb|CAA73323.1| MAP kinase I [Petroselinum crispum]
Length=371

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -2

Query  784  KICDFGLARVTSETDFMTEYVVTRWYRPPELLLNSSDYTAAIDVWSVGCIFMELMDRKPL  605
            KICDFGLAR  ++ +FMTEYVVTRWYR PELLLNSSDYT AIDVWSVGCI+MELM+RKPL
Sbjct  180  KICDFGLARHNTDDEFMTEYVVTRWYRAPELLLNSSDYTVAIDVWSVGCIYMELMNRKPL  239

Query  604  FPGRDHVHQLRLLMELIGTPSEAEMEFL-NENAKKYIRQLPLYRRQSFTERFPHAHPGAI  428
            F G+DHVHQ+RLL EL+G+P+EA++ F+ NE+AK++I QLP + RQ   + +P  HP AI
Sbjct  240  FAGKDHVHQMRLLTELLGSPTEADLGFVRNEDAKRFILQLPRHPRQPLRQLYPQVHPLAI  299

Query  427  DLVEKMLTFDPRRRITVEGALAHPYLTSLHDISDEPSCTTPFNFDFEQHALSEEQMKELI  248
            DL++KMLTFDP +RITVE ALAHPYL  LHDI+DEP CT PF+F+FE   L EEQ+K++I
Sbjct  300  DLIDKMLTFDPSKRITVEEALAHPYLARLHDIADEPICTKPFSFEFETAHLGEEQIKDMI  359

Query  247  YREAVAFNPE  218
            Y+EA+AFNP+
Sbjct  360  YQEALAFNPD  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150