BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007A22

Length=725
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592903.1|  PREDICTED: pentatricopeptide repeat-containi...    256   9e-78   Nicotiana tomentosiformis
ref|XP_009774058.1|  PREDICTED: pentatricopeptide repeat-containi...    254   2e-77   Nicotiana sylvestris
ref|XP_006347992.1|  PREDICTED: pentatricopeptide repeat-containi...    249   4e-75   Solanum tuberosum [potatoes]
ref|XP_004229730.1|  PREDICTED: pentatricopeptide repeat-containi...    245   1e-73   Solanum lycopersicum
emb|CDP09418.1|  unnamed protein product                                232   1e-69   Coffea canephora [robusta coffee]
ref|XP_011085741.1|  PREDICTED: pentatricopeptide repeat-containi...    228   2e-67   Sesamum indicum [beniseed]
ref|XP_004307244.1|  PREDICTED: pentatricopeptide repeat-containi...    224   1e-65   Fragaria vesca subsp. vesca
gb|KHG14992.1|  hypothetical protein F383_17735                         222   5e-65   Gossypium arboreum [tree cotton]
ref|XP_002270492.1|  PREDICTED: pentatricopeptide repeat-containi...    222   5e-65   Vitis vinifera
ref|XP_011017395.1|  PREDICTED: pentatricopeptide repeat-containi...    221   2e-64   Populus euphratica
ref|XP_008232381.1|  PREDICTED: pentatricopeptide repeat-containi...    220   3e-64   Prunus mume [ume]
ref|XP_007218971.1|  hypothetical protein PRUPE_ppa003822mg             220   3e-64   Prunus persica
ref|XP_010246096.1|  PREDICTED: pentatricopeptide repeat-containi...    219   5e-64   Nelumbo nucifera [Indian lotus]
gb|KJB22842.1|  hypothetical protein B456_004G069400                    219   6e-64   Gossypium raimondii
ref|XP_002526471.1|  pentatricopeptide repeat-containing protein,...    218   1e-63   Ricinus communis
ref|XP_002301239.2|  pentatricopeptide repeat-containing family p...    218   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010540211.1|  PREDICTED: pentatricopeptide repeat-containi...    218   2e-63   Tarenaya hassleriana [spider flower]
emb|CAN75355.1|  hypothetical protein VITISV_002476                     221   2e-63   Vitis vinifera
ref|XP_006375170.1|  pentatricopeptide repeat-containing family p...    217   4e-63   
ref|XP_010052788.1|  PREDICTED: pentatricopeptide repeat-containi...    216   6e-63   Eucalyptus grandis [rose gum]
ref|XP_010089787.1|  hypothetical protein L484_008037                   216   1e-62   Morus notabilis
ref|XP_007052358.1|  Tetratricopeptide repeat (TPR)-like superfam...    213   1e-62   
ref|XP_009375366.1|  PREDICTED: pentatricopeptide repeat-containi...    214   4e-62   Pyrus x bretschneideri [bai li]
ref|XP_008343713.1|  PREDICTED: pentatricopeptide repeat-containi...    214   5e-62   
ref|XP_011032472.1|  PREDICTED: pentatricopeptide repeat-containi...    214   7e-62   Populus euphratica
ref|XP_008344410.1|  PREDICTED: pentatricopeptide repeat-containi...    214   7e-62   
ref|XP_008343638.1|  PREDICTED: pentatricopeptide repeat-containi...    213   1e-61   Malus domestica [apple tree]
emb|CDX90079.1|  BnaA10g00030D                                          211   3e-61   
ref|XP_007052357.1|  Tetratricopeptide repeat (TPR)-like superfam...    212   4e-61   
ref|XP_002892022.1|  pentatricopeptide repeat-containing protein        211   4e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_009338668.1|  PREDICTED: pentatricopeptide repeat-containi...    210   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010496689.1|  PREDICTED: pentatricopeptide repeat-containi...    208   1e-60   
gb|KDP28877.1|  hypothetical protein JCGZ_14648                         210   2e-60   Jatropha curcas
ref|XP_009119759.1|  PREDICTED: pentatricopeptide repeat-containi...    209   2e-60   Brassica rapa
ref|XP_006306047.1|  hypothetical protein CARUB_v10011354mg             210   2e-60   Capsella rubella
ref|XP_006445447.1|  hypothetical protein CICLE_v10019658mg             209   3e-60   Citrus clementina [clementine]
emb|CDY15126.1|  BnaC05g00050D                                          209   4e-60   Brassica napus [oilseed rape]
ref|NP_171717.2|  pentatricopeptide repeat-containing protein           208   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19786.1|  At1g02150/T7I23.8                                       208   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|EYU40343.1|  hypothetical protein MIMGU_mgv1a004109mg                208   9e-60   Erythranthe guttata [common monkey flower]
ref|XP_010496474.1|  PREDICTED: pentatricopeptide repeat-containi...    207   2e-59   
ref|XP_006418504.1|  hypothetical protein EUTSA_v10007383mg             207   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010479321.1|  PREDICTED: pentatricopeptide repeat-containi...    207   2e-59   Camelina sativa [gold-of-pleasure]
emb|CBI16683.3|  unnamed protein product                                204   4e-59   Vitis vinifera
ref|XP_008438222.1|  PREDICTED: pentatricopeptide repeat-containi...    206   9e-59   Cucumis melo [Oriental melon]
ref|XP_004133941.1|  PREDICTED: pentatricopeptide repeat-containi...    204   4e-58   Cucumis sativus [cucumbers]
ref|XP_010692029.1|  PREDICTED: pentatricopeptide repeat-containi...    202   1e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31110.1|  Pentatricopeptide repeat-containing protein             199   1e-57   Glycine soja [wild soybean]
ref|XP_003520417.1|  PREDICTED: pentatricopeptide repeat-containi...    199   4e-56   Glycine max [soybeans]
ref|XP_003530115.1|  PREDICTED: pentatricopeptide repeat-containi...    197   1e-55   Glycine max [soybeans]
gb|AFK44508.1|  unknown                                                 187   1e-54   Medicago truncatula
gb|KEH17920.1|  PPR containing plant-like protein                       188   2e-53   Medicago truncatula
ref|XP_004515320.1|  PREDICTED: pentatricopeptide repeat-containi...    187   1e-51   Cicer arietinum [garbanzo]
ref|XP_009387580.1|  PREDICTED: pentatricopeptide repeat-containi...    174   3e-48   
ref|XP_008794909.1|  PREDICTED: pentatricopeptide repeat-containi...    176   4e-48   Phoenix dactylifera
ref|XP_010933566.1|  PREDICTED: pentatricopeptide repeat-containi...    176   1e-47   Elaeis guineensis
ref|XP_007134411.1|  hypothetical protein PHAVU_010G045500g             175   2e-47   Phaseolus vulgaris [French bean]
ref|XP_010919766.1|  PREDICTED: pentatricopeptide repeat-containi...    171   6e-46   Elaeis guineensis
ref|XP_008786192.1|  PREDICTED: pentatricopeptide repeat-containi...    168   5e-45   Phoenix dactylifera
gb|EPS66397.1|  hypothetical protein M569_08380                         163   2e-43   Genlisea aurea
ref|XP_003636175.1|  ATP-dependent DNA helicase PIF1                    163   3e-42   
ref|XP_004956425.1|  PREDICTED: pentatricopeptide repeat-containi...    159   8e-42   
ref|XP_006652599.1|  PREDICTED: pentatricopeptide repeat-containi...    155   2e-40   
ref|XP_002448264.1|  hypothetical protein SORBIDRAFT_06g024190          155   4e-40   Sorghum bicolor [broomcorn]
dbj|BAK02297.1|  predicted protein                                      153   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85010.1|  predicted protein                                      153   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAE04345.1|  OSJNBb0038F03.9                                        149   4e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ31514.1|  hypothetical protein OsJ_15655                          149   4e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EAY95037.1|  hypothetical protein OsI_16851                          149   4e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001168310.1|  hypothetical protein                               149   4e-38   Zea mays [maize]
ref|XP_010227218.1|  PREDICTED: uncharacterized protein LOC100829762    150   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_006849761.1|  hypothetical protein AMTR_s00024p00251490          145   8e-37   
gb|EMT27370.1|  Pentatricopeptide repeat-containing protein             148   9e-37   
ref|NP_001053460.2|  Os04g0544400                                       144   4e-36   
gb|KEH18912.1|  PPR repeat protein                                      134   5e-35   Medicago truncatula
gb|EEC77735.1|  hypothetical protein OsI_16848                          137   8e-33   Oryza sativa Indica Group [Indian rice]
gb|ABR18022.1|  unknown                                                 125   1e-29   Picea sitchensis
ref|XP_010242929.1|  PREDICTED: pentatricopeptide repeat-containi...    125   1e-29   Nelumbo nucifera [Indian lotus]
emb|CAN73453.1|  hypothetical protein VITISV_024964                     124   4e-29   Vitis vinifera
ref|XP_009398991.1|  PREDICTED: pentatricopeptide repeat-containi...    122   9e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273904.2|  PREDICTED: pentatricopeptide repeat-containi...    125   1e-28   Vitis vinifera
ref|XP_002520753.1|  pentatricopeptide repeat-containing protein,...    122   2e-28   
ref|XP_010918492.1|  PREDICTED: pentatricopeptide repeat-containi...    122   2e-28   Elaeis guineensis
ref|XP_006838525.1|  hypothetical protein AMTR_s00002p00190720          120   4e-28   
ref|XP_008796719.1|  PREDICTED: pentatricopeptide repeat-containi...    120   6e-28   Phoenix dactylifera
gb|KDO68752.1|  hypothetical protein CISIN_1g010458mg                   119   7e-28   Citrus sinensis [apfelsine]
ref|XP_008790994.1|  PREDICTED: pentatricopeptide repeat-containi...    120   9e-28   Phoenix dactylifera
ref|XP_006444085.1|  hypothetical protein CICLE_v10019771mg             120   1e-27   Citrus clementina [clementine]
ref|XP_002324293.2|  hypothetical protein POPTR_0018s05820g             118   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002517926.1|  pentatricopeptide repeat-containing protein,...    118   5e-27   Ricinus communis
gb|KDP24141.1|  hypothetical protein JCGZ_25798                         117   6e-27   Jatropha curcas
ref|XP_002527905.1|  pentatricopeptide repeat-containing protein,...    117   6e-27   Ricinus communis
ref|XP_002282230.1|  PREDICTED: pentatricopeptide repeat-containi...    116   1e-26   Vitis vinifera
gb|KCW49953.1|  hypothetical protein EUGRSUZ_K03412                     115   3e-26   Eucalyptus grandis [rose gum]
gb|KDP24137.1|  hypothetical protein JCGZ_25794                         115   3e-26   Jatropha curcas
ref|XP_011077261.1|  PREDICTED: pentatricopeptide repeat-containi...    115   4e-26   Sesamum indicum [beniseed]
ref|XP_011029463.1|  PREDICTED: pentatricopeptide repeat-containi...    114   4e-26   Populus euphratica
emb|CBI20322.3|  unnamed protein product                                117   5e-26   Vitis vinifera
ref|XP_011043458.1|  PREDICTED: pentatricopeptide repeat-containi...    114   6e-26   Populus euphratica
ref|XP_010038139.1|  PREDICTED: pentatricopeptide repeat-containi...    115   6e-26   Eucalyptus grandis [rose gum]
gb|KDP21467.1|  hypothetical protein JCGZ_21938                         114   9e-26   Jatropha curcas
ref|XP_011029462.1|  PREDICTED: pentatricopeptide repeat-containi...    114   1e-25   Populus euphratica
ref|XP_002316903.2|  hypothetical protein POPTR_0011s12150g             114   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010255941.1|  PREDICTED: pentatricopeptide repeat-containi...    114   1e-25   Nelumbo nucifera [Indian lotus]
ref|NP_001176989.1|  Os12g0531500                                       112   1e-25   
ref|XP_002267979.1|  PREDICTED: pentatricopeptide repeat-containi...    113   1e-25   Vitis vinifera
ref|XP_010272480.1|  PREDICTED: pentatricopeptide repeat-containi...    113   1e-25   Nelumbo nucifera [Indian lotus]
gb|EAY83341.1|  hypothetical protein OsI_38557                          113   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010921943.1|  PREDICTED: pentatricopeptide repeat-containi...    114   2e-25   Elaeis guineensis
gb|EAZ20702.1|  hypothetical protein OsJ_36321                          113   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009789509.1|  PREDICTED: pentatricopeptide repeat-containi...    113   2e-25   Nicotiana sylvestris
ref|XP_010682416.1|  PREDICTED: pentatricopeptide repeat-containi...    113   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010272479.1|  PREDICTED: pentatricopeptide repeat-containi...    113   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009594138.1|  PREDICTED: pentatricopeptide repeat-containi...    112   3e-25   Nicotiana tomentosiformis
gb|ABA99305.2|  pentatricopeptide, putative, expressed                  113   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010245038.1|  PREDICTED: pentatricopeptide repeat-containi...    112   4e-25   Nelumbo nucifera [Indian lotus]
gb|KDP26635.1|  hypothetical protein JCGZ_17793                         112   4e-25   Jatropha curcas
ref|XP_006350932.1|  PREDICTED: pentatricopeptide repeat-containi...    112   4e-25   Solanum tuberosum [potatoes]
gb|KEH19430.1|  PPR containing plant-like protein                       111   5e-25   Medicago truncatula
ref|XP_008345197.1|  PREDICTED: pentatricopeptide repeat-containi...    111   7e-25   
gb|KDO82308.1|  hypothetical protein CISIN_1g011226mg                   110   8e-25   Citrus sinensis [apfelsine]
ref|XP_004290659.1|  PREDICTED: pentatricopeptide repeat-containi...    111   1e-24   Fragaria vesca subsp. vesca
ref|XP_009788488.1|  PREDICTED: pentatricopeptide repeat-containi...    111   1e-24   Nicotiana sylvestris
ref|XP_002442234.1|  hypothetical protein SORBIDRAFT_08g016710          111   1e-24   
ref|XP_008368855.1|  PREDICTED: pentatricopeptide repeat-containi...    111   2e-24   
gb|KDO82307.1|  hypothetical protein CISIN_1g011226mg                   110   2e-24   Citrus sinensis [apfelsine]
emb|CDP14775.1|  unnamed protein product                                111   2e-24   Coffea canephora [robusta coffee]
ref|XP_009401682.1|  PREDICTED: pentatricopeptide repeat-containi...    111   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009368491.1|  PREDICTED: pentatricopeptide repeat-containi...    110   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_011037317.1|  PREDICTED: pentatricopeptide repeat-containi...    110   3e-24   Populus euphratica
ref|XP_006355517.1|  PREDICTED: pentatricopeptide repeat-containi...    110   3e-24   
ref|XP_008451368.1|  PREDICTED: pentatricopeptide repeat-containi...    110   3e-24   Cucumis melo [Oriental melon]
ref|XP_006878583.1|  hypothetical protein AMTR_s00011p00250030          109   3e-24   
ref|XP_011014138.1|  PREDICTED: pentatricopeptide repeat-containi...    110   3e-24   Populus euphratica
gb|AFK47046.1|  unknown                                                 109   4e-24   Lotus japonicus
gb|EPS60165.1|  hypothetical protein M569_14638                         109   5e-24   Genlisea aurea
ref|XP_004243349.1|  PREDICTED: pentatricopeptide repeat-containi...    109   6e-24   
ref|XP_008337472.1|  PREDICTED: pentatricopeptide repeat-containi...    109   7e-24   
ref|XP_010693618.1|  PREDICTED: pentatricopeptide repeat-containi...    109   7e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010241951.1|  PREDICTED: pentatricopeptide repeat-containi...    109   7e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004301350.1|  PREDICTED: pentatricopeptide repeat-containi...    109   8e-24   Fragaria vesca subsp. vesca
ref|XP_009357845.1|  PREDICTED: pentatricopeptide repeat-containi...    108   8e-24   Pyrus x bretschneideri [bai li]
ref|XP_007050629.1|  Pentatricopeptide repeat (PPR) superfamily p...    109   8e-24   
ref|XP_007226594.1|  hypothetical protein PRUPE_ppa023558mg             108   8e-24   
gb|KEH20176.1|  PPR containing plant protein                            108   8e-24   Medicago truncatula
ref|XP_004962880.1|  PREDICTED: pentatricopeptide repeat-containi...    108   9e-24   Setaria italica
ref|XP_004148903.1|  PREDICTED: pentatricopeptide repeat-containi...    108   1e-23   Cucumis sativus [cucumbers]
gb|KHG24373.1|  hypothetical protein F383_30483                         108   1e-23   Gossypium arboreum [tree cotton]
gb|EMT17732.1|  hypothetical protein F775_09007                         108   1e-23   
ref|XP_008219370.1|  PREDICTED: pentatricopeptide repeat-containi...    108   1e-23   Prunus mume [ume]
ref|XP_004508130.1|  PREDICTED: pentatricopeptide repeat-containi...    108   1e-23   Cicer arietinum [garbanzo]
ref|XP_006438303.1|  hypothetical protein CICLE_v10031342mg             108   1e-23   Citrus clementina [clementine]
ref|XP_006483923.1|  PREDICTED: pentatricopeptide repeat-containi...    108   1e-23   Citrus sinensis [apfelsine]
ref|XP_008446176.1|  PREDICTED: pentatricopeptide repeat-containi...    108   1e-23   Cucumis melo [Oriental melon]
ref|XP_004249932.1|  PREDICTED: pentatricopeptide repeat-containi...    108   2e-23   Solanum lycopersicum
ref|XP_010237220.1|  PREDICTED: pentatricopeptide repeat-containi...    108   2e-23   Brachypodium distachyon [annual false brome]
emb|CAN64701.1|  hypothetical protein VITISV_037299                     110   2e-23   Vitis vinifera
ref|XP_007198830.1|  hypothetical protein PRUPE_ppa006648mg             107   2e-23   
ref|XP_002527601.1|  pentatricopeptide repeat-containing protein,...    108   2e-23   Ricinus communis
ref|XP_011037319.1|  PREDICTED: pentatricopeptide repeat-containi...    107   2e-23   Populus euphratica
ref|XP_006381714.1|  pentatricopeptide repeat-containing family p...    107   2e-23   Populus trichocarpa [western balsam poplar]
emb|CDP14776.1|  unnamed protein product                                107   2e-23   Coffea canephora [robusta coffee]
gb|EMS62788.1|  hypothetical protein TRIUR3_25805                       107   3e-23   Triticum urartu
ref|XP_008387199.1|  PREDICTED: pentatricopeptide repeat-containi...    103   3e-23   
ref|XP_009757638.1|  PREDICTED: pentatricopeptide repeat-containi...    106   3e-23   Nicotiana sylvestris
ref|XP_002307578.1|  pentatricopeptide repeat-containing family p...    107   3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009595568.1|  PREDICTED: pentatricopeptide repeat-containi...    107   3e-23   Nicotiana tomentosiformis
gb|KDP27040.1|  hypothetical protein JCGZ_20975                         107   3e-23   Jatropha curcas
ref|XP_006664068.1|  PREDICTED: pentatricopeptide repeat-containi...    107   3e-23   Oryza brachyantha
ref|XP_010662166.1|  PREDICTED: pentatricopeptide repeat-containi...    107   4e-23   
ref|XP_011032725.1|  PREDICTED: pentatricopeptide repeat-containi...    107   4e-23   Populus euphratica
ref|XP_007211848.1|  hypothetical protein PRUPE_ppa004720mg             107   4e-23   Prunus persica
emb|CDP17058.1|  unnamed protein product                                107   4e-23   Coffea canephora [robusta coffee]
ref|XP_004514343.1|  PREDICTED: pentatricopeptide repeat-containi...    107   4e-23   Cicer arietinum [garbanzo]
ref|XP_008338901.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    107   5e-23   
ref|XP_011037318.1|  PREDICTED: pentatricopeptide repeat-containi...    106   5e-23   Populus euphratica
ref|XP_010266573.1|  PREDICTED: pentatricopeptide repeat-containi...    107   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010098672.1|  hypothetical protein L484_026048                   104   5e-23   
ref|XP_008339193.1|  PREDICTED: putative pentatricopeptide repeat...    108   5e-23   
ref|XP_004240342.1|  PREDICTED: pentatricopeptide repeat-containi...    107   5e-23   Solanum lycopersicum
ref|XP_009778648.1|  PREDICTED: pentatricopeptide repeat-containi...    106   6e-23   Nicotiana sylvestris
gb|AES60905.2|  PPR containing plant protein                            106   6e-23   Medicago truncatula
gb|KJB50098.1|  hypothetical protein B456_008G153900                    106   6e-23   Gossypium raimondii
ref|XP_010266564.1|  PREDICTED: pentatricopeptide repeat-containi...    107   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010662164.1|  PREDICTED: pentatricopeptide repeat-containi...    106   7e-23   Vitis vinifera
gb|EPS60636.1|  hypothetical protein M569_14165                         106   7e-23   Genlisea aurea
ref|XP_006348243.1|  PREDICTED: pentatricopeptide repeat-containi...    106   7e-23   Solanum tuberosum [potatoes]
ref|XP_007044736.1|  Tetratricopeptide repeat (TPR)-like superfam...    106   7e-23   
gb|KFK40762.1|  hypothetical protein AALP_AA2G037700                    106   8e-23   Arabis alpina [alpine rockcress]
ref|XP_006392119.1|  hypothetical protein EUTSA_v10023426mg             105   9e-23   Eutrema salsugineum [saltwater cress]
ref|XP_003590654.1|  WD repeat-containing protein                       106   9e-23   
ref|XP_009593035.1|  PREDICTED: pentatricopeptide repeat-containi...    106   9e-23   Nicotiana tomentosiformis
ref|XP_002283946.2|  PREDICTED: pentatricopeptide repeat-containi...    105   1e-22   Vitis vinifera
ref|XP_004244223.1|  PREDICTED: pentatricopeptide repeat-containi...    106   1e-22   Solanum lycopersicum
ref|XP_008221878.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    105   1e-22   
gb|EMT03168.1|  hypothetical protein F775_14546                         105   1e-22   
ref|XP_004137021.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-22   
ref|XP_006376504.1|  pentatricopeptide repeat-containing family p...    105   1e-22   
ref|XP_011037316.1|  PREDICTED: pentatricopeptide repeat-containi...    105   1e-22   Populus euphratica
ref|XP_010520653.1|  PREDICTED: uncharacterized protein LOC104799713    107   1e-22   
ref|XP_006376506.1|  pentatricopeptide repeat-containing family p...    105   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006357486.1|  PREDICTED: pentatricopeptide repeat-containi...    105   1e-22   
ref|XP_010474556.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-22   
ref|XP_009103962.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22   Brassica rapa
gb|KDO74080.1|  hypothetical protein CISIN_1g011236mg                   105   2e-22   Citrus sinensis [apfelsine]
dbj|BAK02972.1|  predicted protein                                      105   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN03794.1|  Pentatricopeptide repeat-containing protein, mito...    104   2e-22   Glycine soja [wild soybean]
gb|EYU46589.1|  hypothetical protein MIMGU_mgv1a004554mg                105   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_007149856.1|  hypothetical protein PHAVU_005G104300g             105   2e-22   Phaseolus vulgaris [French bean]
emb|CDP03624.1|  unnamed protein product                                105   2e-22   Coffea canephora [robusta coffee]
gb|KDP24136.1|  hypothetical protein JCGZ_25793                         104   2e-22   Jatropha curcas
emb|CBI21839.3|  unnamed protein product                                105   2e-22   Vitis vinifera
ref|XP_009373544.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_009627474.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22   
ref|XP_004243348.2|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-22   
gb|KJB23095.1|  hypothetical protein B456_004G080600                    105   2e-22   Gossypium raimondii
ref|XP_008229146.1|  PREDICTED: pentatricopeptide repeat-containi...    105   2e-22   Prunus mume [ume]
ref|XP_007144631.1|  hypothetical protein PHAVU_007G171700g             105   3e-22   Phaseolus vulgaris [French bean]
ref|XP_010455119.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010553613.1|  PREDICTED: pentatricopeptide repeat-containi...    104   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_006366127.1|  PREDICTED: pentatricopeptide repeat-containi...    104   3e-22   Solanum tuberosum [potatoes]
ref|XP_004155523.1|  PREDICTED: pentatricopeptide repeat-containi...    100   4e-22   
ref|XP_004509657.1|  PREDICTED: pentatricopeptide repeat-containi...    104   4e-22   Cicer arietinum [garbanzo]
gb|KGN43608.1|  hypothetical protein Csa_7G047430                       103   4e-22   Cucumis sativus [cucumbers]
gb|KDP20961.1|  hypothetical protein JCGZ_21432                         103   4e-22   Jatropha curcas
ref|XP_008366628.1|  PREDICTED: pentatricopeptide repeat-containi...    104   4e-22   
ref|XP_008226646.1|  PREDICTED: pentatricopeptide repeat-containi...    103   4e-22   Prunus mume [ume]
gb|KDP24140.1|  hypothetical protein JCGZ_25797                         103   5e-22   Jatropha curcas
ref|XP_006451898.1|  hypothetical protein CICLE_v10007647mg             105   5e-22   
dbj|BAK01353.1|  predicted protein                                      104   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007222350.1|  hypothetical protein PRUPE_ppa004842mg             103   5e-22   Prunus persica
gb|EYU39860.1|  hypothetical protein MIMGU_mgv1a005194mg                103   5e-22   Erythranthe guttata [common monkey flower]
ref|XP_009379667.1|  PREDICTED: pentatricopeptide repeat-containi...    103   5e-22   
ref|XP_011098322.1|  PREDICTED: pentatricopeptide repeat-containi...    103   5e-22   Sesamum indicum [beniseed]
ref|XP_010105079.1|  hypothetical protein L484_012430                   103   5e-22   
ref|XP_004514446.1|  PREDICTED: pentatricopeptide repeat-containi...    103   6e-22   Cicer arietinum [garbanzo]
ref|XP_010494007.1|  PREDICTED: pentatricopeptide repeat-containi...    103   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_004155477.1|  PREDICTED: pentatricopeptide repeat-containi...    103   6e-22   
ref|XP_006354566.1|  PREDICTED: pentatricopeptide repeat-containi...    103   6e-22   Solanum tuberosum [potatoes]
ref|XP_008452263.1|  PREDICTED: pentatricopeptide repeat-containi...    103   6e-22   Cucumis melo [Oriental melon]
ref|XP_008455539.1|  PREDICTED: uncharacterized protein LOC103495690    105   7e-22   
ref|XP_010473256.1|  PREDICTED: pentatricopeptide repeat-containi...    103   7e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003536907.1|  PREDICTED: pentatricopeptide repeat-containi...    103   8e-22   Glycine max [soybeans]
gb|AGN52922.1|  hypothetical protein                                    101   8e-22   Silene latifolia
ref|XP_010421607.1|  PREDICTED: pentatricopeptide repeat-containi...    103   8e-22   
ref|XP_010249903.1|  PREDICTED: pentatricopeptide repeat-containi...    103   9e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008383747.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21   Malus domestica [apple tree]
ref|NP_176276.1|  pentatricopeptide repeat-containing protein           103   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007198989.1|  hypothetical protein PRUPE_ppa004422mg             103   1e-21   Prunus persica
gb|EYU26391.1|  hypothetical protein MIMGU_mgv1a004262mg                103   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_008243635.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-21   
ref|XP_002886593.1|  pentatricopeptide repeat-containing protein        102   1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_006841257.1|  hypothetical protein AMTR_s00135p00094680          101   1e-21   
gb|KGN43610.1|  hypothetical protein Csa_7G047450                       102   1e-21   Cucumis sativus [cucumbers]
ref|XP_004137019.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21   
ref|XP_010099567.1|  hypothetical protein L484_011573                   102   2e-21   Morus notabilis
ref|XP_007212982.1|  hypothetical protein PRUPE_ppa022486mg             102   2e-21   Prunus persica
emb|CDY50358.1|  BnaA09g13070D                                        99.8    2e-21   Brassica napus [oilseed rape]
ref|XP_002322749.2|  hypothetical protein POPTR_0016s06320g             102   2e-21   
emb|CAN73943.1|  hypothetical protein VITISV_032243                     102   2e-21   Vitis vinifera
ref|XP_009359185.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    102   2e-21   
ref|XP_008243634.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-21   
ref|XP_003539532.2|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-21   Glycine max [soybeans]
ref|XP_009762286.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-21   Nicotiana sylvestris
ref|XP_010091037.1|  hypothetical protein L484_006401                   101   2e-21   
ref|NP_001151760.1|  tetratricopeptide-like helical                     102   2e-21   Zea mays [maize]
ref|XP_008383746.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-21   Malus domestica [apple tree]
ref|XP_004296672.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Fragaria vesca subsp. vesca
ref|XP_004495206.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Cicer arietinum [garbanzo]
ref|XP_009800693.1|  PREDICTED: pentatricopeptide repeat-containi...    101   3e-21   Nicotiana sylvestris
ref|XP_008368256.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Malus domestica [apple tree]
gb|AFN53641.1|  pentatricopeptide repeat-containing protein             102   3e-21   Linum usitatissimum
ref|XP_007199471.1|  hypothetical protein PRUPE_ppa027115mg             100   3e-21   
ref|XP_010323363.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Solanum lycopersicum
ref|XP_006302183.1|  hypothetical protein CARUB_v10020193mg             101   3e-21   Capsella rubella
gb|KHG13694.1|  hypothetical protein F383_19313                         102   3e-21   Gossypium arboreum [tree cotton]
ref|XP_009762284.1|  PREDICTED: pentatricopeptide repeat-containi...    101   3e-21   Nicotiana sylvestris
ref|XP_008235277.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Prunus mume [ume]
ref|XP_007200782.1|  hypothetical protein PRUPE_ppa024012mg             101   3e-21   
gb|KFK26483.1|  hypothetical protein AALP_AA8G255000                    101   4e-21   
ref|XP_007153764.1|  hypothetical protein PHAVU_003G063200g             101   4e-21   
ref|XP_011079842.1|  PREDICTED: pentatricopeptide repeat-containi...    101   5e-21   
ref|XP_010538678.1|  PREDICTED: pentatricopeptide repeat-containi...    101   5e-21   
ref|XP_011039574.1|  PREDICTED: uncharacterized protein LOC105136086    102   5e-21   
ref|NP_198098.1|  pentatricopeptide repeat-containing protein           100   6e-21   
ref|XP_004135263.1|  PREDICTED: pentatricopeptide repeat-containi...    100   6e-21   
ref|XP_008349216.1|  PREDICTED: pentatricopeptide repeat-containi...    100   7e-21   
ref|XP_002872270.1|  pentatricopeptide repeat-containing protein        100   8e-21   
ref|XP_010538697.1|  PREDICTED: pentatricopeptide repeat-containi...    100   8e-21   
gb|KGN43609.1|  hypothetical protein Csa_7G047440                       100   9e-21   
ref|XP_009802167.1|  PREDICTED: pentatricopeptide repeat-containi...    101   9e-21   
ref|XP_004136821.1|  PREDICTED: pentatricopeptide repeat-containi...    100   9e-21   
emb|CDX99984.1|  BnaC09g03170D                                          100   1e-20   
ref|XP_003572464.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20   
ref|XP_010921472.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20   
ref|XP_008442422.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20   
ref|XP_006376509.1|  hypothetical protein POPTR_0013s13650g           99.8    1e-20   
ref|XP_004487291.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    1e-20   
ref|XP_010538695.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-20   
ref|XP_002322750.1|  hypothetical protein POPTR_0016s06330g             100   2e-20   
ref|XP_010023484.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    2e-20   
ref|XP_009618814.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-20   
gb|KHN37169.1|  Pentatricopeptide repeat-containing protein, mito...  98.6    2e-20   
gb|KJB31193.1|  hypothetical protein B456_005G180200                  98.6    2e-20   
ref|XP_006827770.1|  hypothetical protein AMTR_s00009p00264540        99.4    2e-20   
emb|CDY25035.1|  BnaC02g39730D                                        99.4    2e-20   
gb|KHG25821.1|  hypothetical protein F383_00433                       99.4    3e-20   
emb|CDY34141.1|  BnaC01g28810D                                        99.0    3e-20   
ref|XP_006481675.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    3e-20   
ref|XP_010267968.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    3e-20   
emb|CDX96239.1|  BnaC02g14120D                                        99.0    3e-20   
gb|AIZ68164.1|  pentatricopeptide repeat-containing protein At1g6...  99.0    3e-20   
ref|XP_008389701.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    3e-20   
gb|KDO70775.1|  hypothetical protein CISIN_1g018924mg                 97.4    3e-20   
ref|XP_009782480.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    4e-20   
ref|NP_001140872.1|  uncharacterized protein LOC100272948             99.0    4e-20   
ref|XP_009615280.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    4e-20   
ref|XP_010522989.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    4e-20   
gb|KDP21918.1|  hypothetical protein JCGZ_03056                       98.6    5e-20   
ref|XP_009338632.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    5e-20   
ref|XP_010249890.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    5e-20   
ref|XP_009768016.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    5e-20   
emb|CDY46999.1|  BnaC09g14050D                                        98.2    5e-20   
gb|KJB46994.1|  hypothetical protein B456_008G004700                  98.6    5e-20   
ref|XP_006394965.1|  hypothetical protein EUTSA_v10004079mg           98.2    5e-20   
gb|KJB31192.1|  hypothetical protein B456_005G180200                  98.2    6e-20   
gb|KDO70776.1|  hypothetical protein CISIN_1g011472mg                 98.2    6e-20   
ref|XP_009113186.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-20   
ref|XP_009610168.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-20   
ref|XP_011096300.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-20   
ref|XP_002454707.1|  hypothetical protein SORBIDRAFT_04g035970        98.2    6e-20   
gb|KJB13385.1|  hypothetical protein B456_002G071700                  98.2    6e-20   
ref|XP_009129864.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    7e-20   
ref|XP_003594181.1|  Pentatricopeptide repeat-containing protein      95.9    7e-20   
ref|XP_007203456.1|  hypothetical protein PRUPE_ppa022158mg           97.8    7e-20   
ref|XP_011043365.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    7e-20   
ref|XP_008806388.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    8e-20   
ref|XP_006383508.1|  hypothetical protein POPTR_0005s17540g           95.5    8e-20   
emb|CDO99551.1|  unnamed protein product                              97.4    8e-20   
ref|XP_009354430.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    8e-20   
ref|XP_004501675.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    9e-20   
ref|XP_004501674.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    9e-20   
ref|XP_003526072.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    1e-19   
ref|XP_010062875.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    1e-19   
emb|CDO99769.1|  unnamed protein product                              96.7    1e-19   
ref|NP_001048388.1|  Os02g0796400                                     97.8    1e-19   
gb|EAY87860.1|  hypothetical protein OsI_09282                        97.8    1e-19   
ref|XP_011027842.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    1e-19   
ref|XP_006289878.1|  hypothetical protein CARUB_v10003493mg           97.4    1e-19   
ref|XP_010024443.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    1e-19   
ref|XP_010647278.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    1e-19   
ref|XP_010100377.1|  hypothetical protein L484_027687                 97.1    1e-19   
ref|XP_004303401.2|  PREDICTED: uncharacterized protein LOC101303140  98.6    2e-19   
ref|XP_006827771.1|  hypothetical protein AMTR_s00009p00264580        95.9    2e-19   
ref|XP_002517927.1|  pentatricopeptide repeat-containing protein,...  96.7    2e-19   
ref|XP_006429968.1|  hypothetical protein CICLE_v10011545mg           96.7    2e-19   
ref|XP_011027841.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    2e-19   
ref|XP_009409291.1|  PREDICTED: pentatricopeptide repeat-containi...  97.1    2e-19   
gb|KCW90381.1|  hypothetical protein EUGRSUZ_A02520                   96.3    2e-19   
emb|CDY05574.1|  BnaA02g31170D                                        96.7    2e-19   
ref|XP_008225086.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    2e-19   
emb|CDY19721.1|  BnaA09g03740D                                        96.3    3e-19   
ref|XP_006648047.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  96.7    3e-19   
ref|XP_011014826.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    3e-19   
ref|XP_009357846.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    3e-19   
ref|XP_010058578.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    3e-19   
gb|KEH35719.1|  PPR containing plant-like protein                     96.3    3e-19   
emb|CBI23460.3|  unnamed protein product                              95.5    3e-19   
gb|KHN36632.1|  Pentatricopeptide repeat-containing protein, mito...  95.9    3e-19   
ref|XP_008371361.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    3e-19   
ref|XP_010556784.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    3e-19   
gb|KEH35718.1|  PPR containing plant-like protein                     96.3    3e-19   
gb|KEH39117.1|  PPR containing plant protein                          95.9    3e-19   
ref|XP_010099566.1|  hypothetical protein L484_011572                 95.1    4e-19   
ref|NP_973492.1|  pentatricopeptide repeat-containing protein         94.7    4e-19   
ref|XP_003632962.1|  PREDICTED: pentatricopeptide repeat-containi...  95.9    4e-19   
ref|XP_002305141.1|  pentatricopeptide repeat-containing family p...  95.9    4e-19   
ref|XP_004954219.1|  PREDICTED: pentatricopeptide repeat-containi...  95.9    4e-19   
ref|XP_008386165.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    4e-19   
ref|XP_007025640.1|  Tetratricopeptide repeat-like superfamily pr...  96.7    4e-19   
gb|KDP35619.1|  hypothetical protein JCGZ_09057                       95.5    5e-19   
emb|CBI19224.3|  unnamed protein product                              95.9    5e-19   
emb|CAN64166.1|  hypothetical protein VITISV_006333                   95.5    5e-19   
ref|XP_004146649.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    6e-19   
emb|CBI21840.3|  unnamed protein product                              94.7    6e-19   
ref|XP_006449328.1|  hypothetical protein CICLE_v10015002mg           95.1    6e-19   
gb|EMT03814.1|  hypothetical protein F775_18970                       94.4    6e-19   
ref|XP_008229148.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    6e-19   
ref|XP_007018137.1|  Tetratricopeptide repeat-like superfamily pr...  95.5    6e-19   
ref|XP_010087220.1|  hypothetical protein L484_009729                 94.4    8e-19   
ref|NP_179663.1|  pentatricopeptide repeat-containing protein         94.7    8e-19   
ref|XP_007221478.1|  hypothetical protein PRUPE_ppa005037mg           94.7    8e-19   
ref|XP_006481674.1|  PREDICTED: pentatricopeptide repeat-containi...  95.1    9e-19   
ref|XP_007136298.1|  hypothetical protein PHAVU_009G034500g           95.1    9e-19   
ref|XP_006299518.1|  hypothetical protein CARUB_v10015690mg           94.7    9e-19   
gb|AFW83046.1|  hypothetical protein ZEAMMB73_939845                  94.4    9e-19   
ref|XP_010108201.1|  hypothetical protein L484_014527                 94.7    1e-18   
ref|XP_004133705.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    1e-18   
ref|XP_006396507.1|  hypothetical protein EUTSA_v10028573mg           94.7    1e-18   
ref|XP_008781131.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    1e-18   
ref|XP_002515265.1|  pentatricopeptide repeat-containing protein,...  94.7    1e-18   
ref|XP_010510912.1|  PREDICTED: pentatricopeptide repeat-containi...  94.4    1e-18   
ref|XP_006377346.1|  pentatricopeptide repeat-containing family p...  94.4    1e-18   
ref|XP_006472525.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    1e-18   
ref|XP_002438963.1|  hypothetical protein SORBIDRAFT_10g029040        94.7    1e-18   
ref|XP_006361033.1|  PREDICTED: pentatricopeptide repeat-containi...  94.4    1e-18   
ref|XP_007198902.1|  hypothetical protein PRUPE_ppa005316mg           94.4    1e-18   
ref|XP_009349931.1|  PREDICTED: pentatricopeptide repeat-containi...  94.7    1e-18   
ref|XP_002884218.1|  pentatricopeptide repeat-containing protein      94.4    1e-18   
gb|KDP41442.1|  hypothetical protein JCGZ_15849                       94.4    1e-18   
emb|CDO99549.1|  unnamed protein product                              94.4    1e-18   
ref|XP_008442434.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    1e-18   
gb|KJB69510.1|  hypothetical protein B456_011G027300                  94.0    1e-18   
ref|XP_006467809.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    2e-18   
ref|XP_010555122.1|  PREDICTED: pentatricopeptide repeat-containi...  94.0    2e-18   
ref|XP_002513996.1|  pentatricopeptide repeat-containing protein,...  94.0    2e-18   
gb|KGN64671.1|  hypothetical protein Csa_1G073780                     94.0    2e-18   
ref|XP_003570298.2|  PREDICTED: pentatricopeptide repeat-containi...  94.0    2e-18   
ref|XP_009612936.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    2e-18   
ref|XP_009612935.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    2e-18   
ref|XP_011006374.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    2e-18   
ref|XP_004168984.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    2e-18   
gb|KEH19654.1|  PPR containing plant protein                          93.6    3e-18   
gb|KCW49905.1|  hypothetical protein EUGRSUZ_K03371                   92.8    3e-18   
gb|EYU27966.1|  hypothetical protein MIMGU_mgv1a004933mg              93.6    3e-18   
gb|KHF99488.1|  hypothetical protein F383_17053                       93.2    3e-18   
emb|CDP11458.1|  unnamed protein product                              93.6    3e-18   
ref|XP_006661923.1|  PREDICTED: pentatricopeptide repeat-containi...  93.6    3e-18   
gb|EMT03815.1|  Pentatricopeptide repeat-containing protein           93.6    3e-18   
ref|XP_009612934.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    3e-18   
ref|XP_002519054.1|  pentatricopeptide repeat-containing protein,...  93.2    3e-18   
ref|XP_006644107.1|  PREDICTED: pentatricopeptide repeat-containi...  93.2    3e-18   
ref|XP_004288536.2|  PREDICTED: pentatricopeptide repeat-containi...  93.2    3e-18   
ref|XP_003531991.1|  PREDICTED: pentatricopeptide repeat-containi...  92.8    4e-18   
ref|NP_001042824.1|  Os01g0301700                                     93.2    4e-18   
ref|XP_006349176.1|  PREDICTED: pentatricopeptide repeat-containi...  92.8    4e-18   
ref|XP_006433895.1|  hypothetical protein CICLE_v10000753mg           93.2    5e-18   
ref|XP_006347050.1|  PREDICTED: pentatricopeptide repeat-containi...  92.4    5e-18   
ref|XP_010039256.1|  PREDICTED: pentatricopeptide repeat-containi...  92.8    6e-18   
emb|CDP05907.1|  unnamed protein product                              93.2    6e-18   
ref|XP_008381254.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    6e-18   
ref|XP_008342919.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    6e-18   
ref|XP_008353788.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    6e-18   
gb|KGN64672.1|  hypothetical protein Csa_1G073790                     92.0    7e-18   
gb|AAM93669.1|  putative leaf protein                                 92.4    7e-18   
ref|XP_010489001.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    7e-18   
ref|XP_010467774.1|  PREDICTED: pentatricopeptide repeat-containi...  92.0    8e-18   
ref|XP_004233832.2|  PREDICTED: pentatricopeptide repeat-containi...  92.0    8e-18   
gb|KDP21919.1|  hypothetical protein JCGZ_03057                       90.1    8e-18   
ref|XP_009770415.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   
ref|XP_004229380.2|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   
ref|XP_009111762.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   
ref|XP_003527890.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   
gb|KHN08970.1|  Pentatricopeptide repeat-containing protein           91.7    1e-17   
gb|EAY79101.1|  hypothetical protein OsI_34208                        90.1    1e-17   
ref|XP_010942641.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   
ref|XP_008353787.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    2e-17   
ref|XP_008453823.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    2e-17   
ref|XP_008342918.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    2e-17   
gb|EYU27967.1|  hypothetical protein MIMGU_mgv1a005819mg              90.9    2e-17   
ref|XP_009390562.1|  PREDICTED: pentatricopeptide repeat-containi...  91.3    2e-17   
ref|XP_002874893.1|  pentatricopeptide repeat-containing protein      91.3    2e-17   
ref|XP_008381253.1|  PREDICTED: pentatricopeptide repeat-containi...  90.9    2e-17   
ref|XP_002517929.1|  pentatricopeptide repeat-containing protein,...  90.5    2e-17   
ref|XP_009629681.1|  PREDICTED: pentatricopeptide repeat-containi...  90.9    2e-17   
gb|KDP28274.1|  hypothetical protein JCGZ_14045                       90.9    2e-17   
ref|XP_004233831.1|  PREDICTED: pentatricopeptide repeat-containi...  90.9    2e-17   
ref|XP_010467773.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    2e-17   
ref|XP_008227878.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    3e-17   
ref|XP_010430409.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    3e-17   
ref|XP_010455929.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    3e-17   
gb|KHG22237.1|  hypothetical protein F383_27601                       90.5    3e-17   
ref|XP_003632411.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  90.5    3e-17   
ref|NP_192191.1|  pentatricopeptide repeat-containing protein         90.1    4e-17   
gb|AAL32523.1|  Unknown protein                                       90.1    4e-17   
gb|KFK40443.1|  hypothetical protein AALP_AA3G373800                  89.7    4e-17   
ref|XP_008453822.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    4e-17   
ref|XP_004295631.1|  PREDICTED: pentatricopeptide repeat-containi...  90.1    4e-17   
gb|ADI87991.1|  PPR protein                                           87.0    4e-17   
dbj|BAJ86699.1|  predicted protein                                    89.7    4e-17   
gb|ADI88001.1|  PPR protein                                           87.0    4e-17   
gb|ADI88005.1|  PPR protein                                           87.0    5e-17   
gb|ADI87989.1|  PPR protein                                           87.0    5e-17   
gb|ADI88027.1|  PPR protein                                           87.0    5e-17   
gb|EMT11631.1|  Pentatricopeptide repeat-containing protein           90.9    5e-17   
gb|ADI87999.1|  PPR protein                                           87.0    5e-17   
gb|KJB58960.1|  hypothetical protein B456_009G232300                  89.7    5e-17   
gb|ADI88012.1|  PPR protein                                           87.0    5e-17   
gb|ADI88009.1|  PPR protein                                           87.0    5e-17   
gb|ADI87986.1|  PPR protein                                           87.0    5e-17   
gb|ADI87985.1|  PPR protein                                           87.0    5e-17   
gb|ADI88004.1|  PPR protein                                           86.7    5e-17   
gb|ADI87990.1|  PPR protein                                           86.7    5e-17   
gb|ADI88477.1|  PPR protein                                           86.7    6e-17   
gb|ADI88021.1|  PPR protein                                           86.7    6e-17   
gb|ADI88015.1|  PPR protein                                           86.7    6e-17   
gb|ADI88030.1|  PPR protein                                           86.7    6e-17   
gb|ADI88026.1|  PPR protein                                           86.7    6e-17   
gb|ADI88006.1|  PPR protein                                           86.7    6e-17   
gb|ADI88010.1|  PPR protein                                           86.7    6e-17   



>ref|XP_009592903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana tomentosiformis]
Length=539

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 152/203 (75%), Gaps = 3/203 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G KEEV RIW  Y+S FP IPN  YHS+I++L+RLDD+E AE I+DEWL  KS YDP
Sbjct  329  GSLGKKEEVLRIWKTYQSQFPTIPNLGYHSVISALVRLDDIEGAEKIYDEWLPVKSHYDP  388

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  YVRKG  ++A  FL Q+++AG KPN  TWEI+A+GHI+ERR+SEALSCLK+
Sbjct  389  RLGNLLLGYYVRKGSVDKAIAFLDQMVEAGAKPNSMTWEIVAEGHIRERRLSEALSCLKD  448

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A S EGSK+WRP PA +SS  +LCE E+DT+SKE L+EVLKQ GCL  E Y+S IP  NG
Sbjct  449  AVSTEGSKSWRPKPANVSSILRLCEQEEDTQSKEALMEVLKQVGCLDDEKYMSYIPLSNG  508

Query  183  SNTNNEPDTWEEDSFLDNNDDKS  115
            + T++EP   E D    +ND+ S
Sbjct  509  TFTSDEP---EIDKDTSDNDEGS  528



>ref|XP_009774058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nicotiana sylvestris]
Length=538

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 151/203 (74%), Gaps = 3/203 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G KEEV RIW  Y+S FP IPN  YHS+I+SL+RLDD+E AE I+DEWL  KS YDP
Sbjct  328  GSLGKKEEVLRIWKTYQSQFPTIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKSHYDP  387

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  YVRKG  ++A  FL Q+++AG KPN  TWEI+A+GHI+ERR+S+ALSCLK+
Sbjct  388  RLGNLLLGYYVRKGSVDKAIAFLDQMVEAGAKPNSMTWEIVAEGHIRERRLSKALSCLKD  447

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A S EGSK+WRP PA +SS  +LCE E+DT+SKE L+EVLKQ GCL  E Y+S IP  NG
Sbjct  448  AVSTEGSKSWRPKPANVSSILRLCEQEEDTQSKEALMEVLKQVGCLDDEKYMSYIPLSNG  507

Query  183  SNTNNEPDTWEEDSFLDNNDDKS  115
            + T +EP   E D    +ND+ S
Sbjct  508  TFTGDEP---EIDKDTSDNDEGS  527



>ref|XP_006347992.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Solanum tuberosum]
Length=545

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G KEEV RIW  Y+S FP IPN  YHS+I+SL+RLDD+E AE I+DEWL  K  YDP
Sbjct  335  GSLGKKEEVLRIWKTYQSQFPNIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKVHYDP  394

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  YVRKG  ++A  F  Q+I AG KPN  T EILA+GHI++RRISEALSCLK+
Sbjct  395  RIGNLLLGYYVRKGFVDKASAFFDQMIGAGGKPNSMTCEILAEGHIRDRRISEALSCLKD  454

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A S EGSK+WRP PAT+SS  +LCE EDDT++KE L+EVLKQ GCL  E Y+S IP  NG
Sbjct  455  AVSTEGSKSWRPKPATVSSILRLCEQEDDTQNKEALLEVLKQVGCLDDEKYMSYIPLSNG  514

Query  183  SNTNNEPDTWEEDS  142
            + T++EP+  ++ S
Sbjct  515  TITSSEPEIEKDTS  528



>ref|XP_004229730.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Solanum lycopersicum]
Length=545

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 0/201 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G KE+V RIW  Y+S FP IPN  YHS+I+SL+RLDD+E AE I+DEWL  K  YDP
Sbjct  335  GSLGKKEDVLRIWKTYQSQFPNIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKVHYDP  394

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  YVRKG  ++A  F  Q+I AG KPN  T EILA+GHI++RRISEALSCLK+
Sbjct  395  RIGNLLLGYYVRKGFVDKASAFFDQMIGAGGKPNSMTCEILAEGHIRDRRISEALSCLKD  454

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A S+EGSK+WRP PAT+SS  +LCE EDD ++KE+L+EVLKQ GCL  E Y+S IP  NG
Sbjct  455  AVSSEGSKSWRPKPATVSSILRLCEQEDDIQNKEVLLEVLKQVGCLDDEKYMSYIPLSNG  514

Query  183  SNTNNEPDTWEEDSFLDNNDD  121
            S T++E +  ++ S  D   D
Sbjct  515  SFTSSEREIEKDTSDNDEGSD  535



>emb|CDP09418.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 136/184 (74%), Gaps = 0/184 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VG KEEV+R+W++YKS F  IPN  YH++I+SL+R+ D+E AE I++EWLS KS YDPRV
Sbjct  248  VGKKEEVYRVWDLYKSIFSIIPNLGYHAVISSLIRVGDIEGAEKIYNEWLSVKSMYDPRV  307

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NLLL CYVR G  ++AE F  ++I+ G + N  TWEILA+GH+++R+ISEALSCLK A 
Sbjct  308  GNLLLACYVRNGFSDKAEAFFDEMIEVGGRANSVTWEILAEGHVRDRKISEALSCLKNAV  367

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGSN  178
            SAEGS+ WRP P  +SS  KLCE E D  SKE L+ VL+QAGCL  E Y+S IP   GS 
Sbjct  368  SAEGSQGWRPKPVNVSSVLKLCEQEGDISSKEALMGVLRQAGCLDDETYMSFIPMSTGSF  427

Query  177  TNNE  166
            T  E
Sbjct  428  TGVE  431



>ref|XP_011085741.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Sesamum indicum]
Length=546

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 146/206 (71%), Gaps = 7/206 (3%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               GNKEEV+R+WN YK++F  IPN  YH++I++L+R++D++ AE I+DEWLS KS YDP
Sbjct  333  GSAGNKEEVYRVWNTYKASFFNIPNLGYHTVISALVRINDIDGAEKIYDEWLSVKSVYDP  392

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLLL  YVRKG  ++AE F  Q+I+ G KPN  TWEIL + HI+ RRISEALSCLK 
Sbjct  393  RVGNLLLSSYVRKGLSQKAETFFDQMIEVGGKPNSMTWEILGEDHIRNRRISEALSCLKN  452

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIP-TPN  187
            A SAEGSK WRP P  +SS  K+ E E DT +K+ L+EVL+Q GCL    Y+S IP + +
Sbjct  453  AASAEGSKTWRPKPINVSSILKISEQESDTATKDALLEVLRQTGCLDDVSYMSYIPISDS  512

Query  186  GSNTNNEPDTWEEDSFLDNNDDKSGD  109
            G+ T+++P      +  D  D+ +GD
Sbjct  513  GTITSHDP------TIEDRADNDAGD  532



>ref|XP_004307244.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Fragaria vesca subsp. vesca]
Length=541

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             GVGNK+E++R+WNVYKS+FP IPN  YH+IIA+L+R+ DVE AE IF+EWL+ K  YDP
Sbjct  323  GGVGNKDEIYRVWNVYKSSFPSIPNLGYHAIIAALIRVGDVEGAEKIFEEWLTVKPSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL +V Y+ +G F++A+ F   +++AG KPN  TWE LA+GHI+E+RISEALSC KE
Sbjct  383  RIVNLFIVSYIEEGDFDKAQSFFDNMVEAGGKPNSSTWEALAEGHIEEKRISEALSCWKE  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  AEGSK+WRP P  +++F++ CE E D  SKE+ + +L+Q+G L  + Y   +   + 
Sbjct  443  AFMAEGSKSWRPKPVNVTTFYEFCEQEGDLRSKEIFLGLLRQSGQLKNKSYALLVGLSDE  502

Query  183  SNTNNEPDTWEEDSFLDNN--DDKSGD  109
             +++N+  + E+DS  DN   D+KS D
Sbjct  503  DSSDNDI-SLEKDSINDNQDGDEKSDD  528



>gb|KHG14992.1| hypothetical protein F383_17735 [Gossypium arboreum]
Length=533

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNKEEV+RIW VYKS FP IPN  YH++I+SL+R  D+E AE I++EWLS K+ YDPR+
Sbjct  325  VGNKEEVYRIWKVYKSIFPSIPNLGYHAMISSLVRASDIEGAEKIYEEWLSVKTSYDPRI  384

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            ANLL+  YV++G  ++A+ F   I D G KPN  +WEILA+G+I+E RI EALSCLKEA 
Sbjct  385  ANLLMGLYVKEGNLDKAQSFFNHIADVGGKPNSSSWEILAEGNIQEERIDEALSCLKEAF  444

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGSN  178
            + EGS++WRP P  +S+FF LC+ ++DTE++E+++ +L+Q+G L  E Y SQI   +G+ 
Sbjct  445  ATEGSRSWRPKPTNVSAFFNLCDEKEDTETREVVVGLLRQSGYLKNEAYASQIGLSDGAV  504

Query  177  TNNEPDTWEEDSFLDNNDDKS  115
             +  P     D   +N DD S
Sbjct  505  ESVLPTYSSGD---ENQDDDS  522



>ref|XP_002270492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Vitis vinifera]
Length=527

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 137/204 (67%), Gaps = 9/204 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               GNK EV+R WN+YKS FP IPN  YH++I+SL+R+ D+E AE I++EWLS KS YDP
Sbjct  309  GSTGNKAEVYRAWNIYKSKFPNIPNLGYHALISSLVRVGDLEGAEKIYEEWLSVKSSYDP  368

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL CYV++G  E+AEGFL  +I+AG KPN  TWEILA+G+   ++IS+ALSC K 
Sbjct  369  RIGNLLLGCYVKEGFLEKAEGFLDHMIEAGGKPNSTTWEILAEGNTGVKKISDALSCFKR  428

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  AEGS  W+P P  +S+F  LCE E DT +KE L+ +L+Q GCL  E Y S      G
Sbjct  429  AVLAEGSNGWKPKPVNVSAFLDLCEEEADTATKEALMGLLRQMGCLEDEPYASLFGLHTG  488

Query  183  SNTNNEPDTWEEDSFLDNNDDKSG  112
            S T NE         L N  D++G
Sbjct  489  SVTGNE---------LSNEKDRTG  503



>ref|XP_011017395.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Populus euphratica]
Length=539

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 1/205 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEEV+R+WN+YKS FP IPN  YH++I+SL+R+DD+E AE I++EWLS K+ YDP
Sbjct  323  GNVGNKEEVYRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  +V +G  ++AE F   +++ G KPN  TWEILA GHI ERR SEALSCLKE
Sbjct  383  RIANLFMAAFVYQGNLDKAESFFDHMLEEGGKPNSHTWEILAQGHISERRTSEALSCLKE  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTP-N  187
            A +  GSK+W+P PA +SSFFKLCE E D  SKE L   L+Q+G L  + Y   +  P  
Sbjct  443  AFATPGSKSWKPNPANVSSFFKLCEEEVDMASKEALESFLRQSGHLKDKAYALLLGMPAT  502

Query  186  GSNTNNEPDTWEEDSFLDNNDDKSG  112
            G + + + +  E+    + NDD +G
Sbjct  503  GDDLSTKEERTEDQIDNEENDDDNG  527



>ref|XP_008232381.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Prunus mume]
Length=546

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+WN+YKS+FP IPN  YH+I++SLLR+ DVE AE I++EWL+ KS YDP
Sbjct  325  GNVGNKEELYRVWNIYKSSFPSIPNLGYHAIMSSLLRVGDVEGAEKIYEEWLTVKSTYDP  384

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+AN+ +  Y++ G FE+A+ F   ++D G KPN  TWE LA+GH +E+RISEALSC KE
Sbjct  385  RIANVFIAYYIKDGDFEKAQSFYDHMVDVGGKPNSSTWETLAEGHTEEQRISEALSCWKE  444

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGSK+WRP P  +S+F +LCE E ++ SKE+ + +LKQ+G L  + Y S I   + 
Sbjct  445  AFSAEGSKSWRPKPVNVSAFLELCEQEANSVSKEVFMGLLKQSGQLKNKSYASLIGLADE  504

Query  183  SNTNNEPDTWEEDSFLDNNDD  121
              ++++    ++ + + N+DD
Sbjct  505  DVSDDDLSLKKDRTNITNDDD  525



>ref|XP_007218971.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
 gb|EMJ20170.1| hypothetical protein PRUPE_ppa003822mg [Prunus persica]
Length=546

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+WN+YKS+FP IPN  YH+I++SLLR+ DVE AE I++EWL+ KS YDP
Sbjct  325  GNVGNKEELYRVWNIYKSSFPSIPNLGYHAIMSSLLRVGDVEGAEKIYEEWLTVKSTYDP  384

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+AN+ +  Y++ G FE+A+ F   ++D G KPN  TWE LA+GHI+E+RISEALSC KE
Sbjct  385  RIANVFIAYYIKDGDFEKAQSFYDHMVDVGGKPNSTTWETLAEGHIEEQRISEALSCWKE  444

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A SAEGSK+WRP P  +S+F +LCE E ++ SKE  + +LKQ+G L  + Y S I
Sbjct  445  AFSAEGSKSWRPKPVNVSAFLELCEQEANSVSKEFFMGLLKQSGQLKNKSYASLI  499



>ref|XP_010246096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Nelumbo nucifera]
Length=515

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             G+G+KEEV+RIWN YKSNFP IPN  YH++IASL+RL D+  AE I++EWLS +S YDP
Sbjct  325  GGIGSKEEVYRIWNKYKSNFPSIPNLGYHAMIASLVRLGDISGAEIIYEEWLSVRSNYDP  384

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YVR+G  E+AE FL+ + + G K N  TWEI+A+GHIK+++I EALSC+K+
Sbjct  385  RICNLLIGWYVREGSLEKAETFLSHVTEVGGKLNSNTWEIIAEGHIKKKQIVEALSCMKK  444

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A  AEG+KNWRP    +S+F  LCE E D  SK+ LIEVL+Q GCL    Y S +
Sbjct  445  ASVAEGAKNWRPKLTNVSAFLSLCEEESDIASKDALIEVLRQVGCLENATYKSLV  499



>gb|KJB22842.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22843.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
 gb|KJB22844.1| hypothetical protein B456_004G069400 [Gossypium raimondii]
Length=533

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 143/201 (71%), Gaps = 3/201 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNKEEV+RIW VYKS FP IPN  YH++I+SL+R  D+E AE I++EWLS K+ YDPR+
Sbjct  325  VGNKEEVYRIWKVYKSIFPSIPNLGYHAMISSLVRASDIEGAEKIYEEWLSVKTSYDPRI  384

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            ANLL+  YV++G   +A+ F   I D G KPN  +WEILA+G+I+E RI EALSCLKEA 
Sbjct  385  ANLLMGLYVKEGNLGKAQSFFNHIADVGGKPNSSSWEILAEGNIQEERIDEALSCLKEAF  444

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGSN  178
            + EGS++WRP P  +S+FF LC+ ++DTES+E+++ +L+Q+G L  E Y SQI   + + 
Sbjct  445  ATEGSRSWRPKPTNVSAFFNLCDEKEDTESREVVVGLLQQSGYLKNEAYASQIGLSDSAV  504

Query  177  TNNEPDTWEEDSFLDNNDDKS  115
             +  P     D   +N DD S
Sbjct  505  ESVLPTYSSGD---ENQDDDS  522



>ref|XP_002526471.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF35862.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=533

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 140/206 (68%), Gaps = 8/206 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+WN+YKS F  IPN  YH+II+SL+R+DD+E AE I++EWL  KS YDP
Sbjct  323  GNVGNKEEIYRVWNIYKSIFATIPNLGYHAIISSLVRMDDIEGAEKIYEEWLPVKSSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YVR G  ++AE F   +++ G KPN  TWEILADGH +E+RISEALSC KE
Sbjct  383  RIGNLLMGWYVRGGNLDKAESFFDHMMEVGGKPNSSTWEILADGHTREKRISEALSCFKE  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  A+GSK+W+P P  ISSFFKLCE E D  S  +L ++L Q+G L  + Y S I +   
Sbjct  443  AFLAQGSKSWKPKPVIISSFFKLCEEEADMASTGVLEDLLAQSGYLEDKTYASLIGSSVP  502

Query  183  SN--------TNNEPDTWEEDSFLDN  130
            SN        T +  +  E ++FL+ 
Sbjct  503  SNELSTEKDRTGDRNEVEENETFLNQ  528



>ref|XP_002301239.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE80512.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 140/205 (68%), Gaps = 2/205 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEEV+R+WN+YKS FP IPN  YH++I+SL+R+DD+E AE I++EWLS K+ YDP
Sbjct  323  GNVGNKEEVYRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  +V +G  ++AE F   +++ G KPN  +WEILA GHI ERR SEALSCLKE
Sbjct  383  RIANLFMAAFVYQGNLDKAESFFDHMLEEGGKPNSHSWEILAQGHISERRTSEALSCLKE  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A +  GSK+W+P PA +SSFFKLCE E D  SKE L   L+Q+G L  + Y   +  P  
Sbjct  443  AFATPGSKSWKPNPANVSSFFKLCEEEVDMASKEALASFLRQSGHLKDKAYALLLGMPVT  502

Query  183  SNTNNEPDTWEEDSFLDNNDDKSGD  109
             +  +  +   ED    +N++  GD
Sbjct  503  GDELSTKEERTEDQI--DNEENDGD  525



>ref|XP_010540211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Tarenaya hassleriana]
Length=561

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GNK+EV+R+WNVYKS FP IPN  YH++I+SL+R+ D+E AE +++EWL  KS YDPR+
Sbjct  345  TGNKKEVYRVWNVYKSVFPSIPNLGYHALISSLVRIGDIEGAERVYEEWLPVKSSYDPRI  404

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            ANLL+  YV+  Q  +AEGFL  +I+ G KP+P +WEILA+GHI++RRISEAL+CLKEA 
Sbjct  405  ANLLMSAYVKNDQLSKAEGFLDHMIEMGGKPSPSSWEILAEGHIRKRRISEALTCLKEAF  464

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
             AEGS NWRP   T+SSFF+LCE E D  SK+ ++++L+++G L  + Y + I
Sbjct  465  VAEGSNNWRPKALTLSSFFELCEEESDFPSKDAIVQLLRESGHLQEKSYEALI  517



>emb|CAN75355.1| hypothetical protein VITISV_002476 [Vitis vinifera]
Length=736

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 137/204 (67%), Gaps = 9/204 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               GNK EV+R WN+YKS FP IPN  YH++I+SL+R+ D+E AE I++EWLS KS YDP
Sbjct  518  GSTGNKAEVYRAWNIYKSKFPNIPNLGYHALISSLVRVGDLEGAEKIYEEWLSVKSSYDP  577

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL CYV++G  E+AEGFL  +I+AG KPN  TWEILA+G+   ++IS+ALSC K 
Sbjct  578  RIGNLLLGCYVKEGFLEKAEGFLDHMIEAGGKPNSTTWEILAEGNTGVKKISDALSCFKR  637

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  AEGS  W+P P  +S+F  LCE E DT +KE L+ +L+Q GCL  E Y S      G
Sbjct  638  AVLAEGSNGWKPKPVNVSAFLDLCEEEADTATKEALMGLLRQMGCLEDEPYASLFGLHTG  697

Query  183  SNTNNEPDTWEEDSFLDNNDDKSG  112
            S T NE         L N  D++G
Sbjct  698  SVTGNE---------LSNEKDRTG  712



>ref|XP_006375170.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP52967.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=539

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 128/176 (73%), Gaps = 0/176 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNKEEV+R+WN+YKS FP IPN  YH+II+SL+RLDD+E AE IF+EWLS K+ YDPR+
Sbjct  325  VGNKEEVYRVWNIYKSIFPSIPNLGYHAIISSLVRLDDIEGAEKIFEEWLSIKTSYDPRI  384

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            ANL +  YV +G  + A+ F   +++ G KPN  TWEILA GHI ERR SEALSCLKEA 
Sbjct  385  ANLFIAAYVYQGNLDEAKSFFDHMLEDGGKPNSNTWEILAQGHISERRTSEALSCLKEAF  444

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTP  190
               GSK+W+P PA ++SFFKLCE E D  +KE L   L+Q+G L  + Y S +  P
Sbjct  445  VTPGSKSWKPNPANVTSFFKLCEEEADMANKEALEGFLRQSGHLKDKAYASLLGMP  500



>ref|XP_010052788.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Eucalyptus grandis]
 gb|KCW76861.1| hypothetical protein EUGRSUZ_D01216 [Eucalyptus grandis]
Length=528

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNKEE +R+WN YKS FP IPN  YH++I+SL+R+ D+E AE +++EWLS ++ +DPR+
Sbjct  325  VGNKEETYRVWNTYKSVFPTIPNLGYHALISSLVRIGDIEGAEKMYEEWLSVRTSFDPRI  384

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NLL+  YV++G+ ++AEG L Q+++ G KPN  TWEILA+GH KERRISEA SC K+A 
Sbjct  385  GNLLMNFYVKEGKLDKAEGILDQMVELGGKPNSTTWEILAEGHTKERRISEAFSCFKDAF  444

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGS  181
             A+G K+WRP P T+S FF LCE E + E+KE L+ +L+Q+G L  + Y S +   NG+
Sbjct  445  LADGWKSWRPKPVTLSYFFDLCEEEGNLETKEALVGLLRQSGFLEDKTYSSSVGLSNGA  503



>ref|XP_010089787.1| hypothetical protein L484_008037 [Morus notabilis]
 gb|EXB38379.1| hypothetical protein L484_008037 [Morus notabilis]
Length=546

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 140/207 (68%), Gaps = 3/207 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+W VYK+ FP IPN  YH+II+SLLR+ D+E AENI++EWL  KS YDP
Sbjct  330  GSVGNKEEIYRVWKVYKAIFPSIPNLGYHAIISSLLRIGDIEGAENIYNEWLPVKSSYDP  389

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  YVR G  E+A   +  II+ G KPN  TWEILA GH  ERRISEALS  KE
Sbjct  390  RIANLFMSYYVRNGNLEKATSLVDHIIEVGGKPNSATWEILAAGHTGERRISEALSYWKE  449

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A +AEG+KNWRP P  +S+F  LCE E D E KE+L+ +L++AG L  + Y S +   + 
Sbjct  450  AFAAEGAKNWRPKPVNVSAFLDLCEQEADLECKEVLVGLLREAGYLKDQSYASFVGFSHE  509

Query  183  SNTNN---EPDTWEEDSFLDNNDDKSG  112
            +  +N     D   E+   +N DD+SG
Sbjct  510  AINDNGITSVDVSFENDNDENKDDESG  536



>ref|XP_007052358.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 ref|XP_007052359.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96515.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOX96516.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=420

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             GVGN+EEV+R+W VYKS FP IPN  +H++I+SL+R  D++ AE I++EWL+ K+ YDP
Sbjct  202  GGVGNREEVYRVWKVYKSIFPSIPNLGFHAVISSLVRAGDIQGAERIYEEWLTVKTSYDP  261

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANLL+  YV++G  ++AE   + I + G KPN  +WEILA+GHI E+RI +ALSCLK+
Sbjct  262  RIANLLMGWYVKEGNLDKAESLFSHIAEVGGKPNSSSWEILAEGHILEKRIPDALSCLKD  321

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A + EGS+ WRP P ++S+FF LCE + D  S+E+ + +L+Q+GCL  E Y S I
Sbjct  322  AFATEGSRGWRPKPTSVSAFFNLCEEKVDMASREVFVGLLRQSGCLKNEAYASLI  376



>ref|XP_009375366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Pyrus x bretschneideri]
Length=534

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 144/205 (70%), Gaps = 9/205 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KE+ +R+WNVYK+ FP IPN  YH+I++SLLRL DVE AE +++EWL+ KS YDP
Sbjct  324  GSVGKKEDAYRVWNVYKAIFPSIPNLGYHAIMSSLLRLGDVEGAEKLYEEWLTVKSTYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +V Y+++G F+ A+ F   ++D G KPN  TWE LA+GH++E+RISEALSC KE
Sbjct  384  RIANLFIVFYIKEGDFDSAQSFYDHMVDVGGKPNSSTWESLAEGHMEEKRISEALSCWKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGSK+WRP P  +S+F +LCE E D+ SKE+L+ +L+Q+G L  + Y S +   + 
Sbjct  444  AFSAEGSKSWRPKPVNVSAFLELCEQESDSVSKEVLMGLLRQSGQLKNKLYASFLGLTDD  503

Query  183  SNTNNEPDTWEEDSFLDNNDDKSGD  109
             N         + + ++ +DD+  D
Sbjct  504  VN---------DKTIVNEDDDEKAD  519



>ref|XP_008343713.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Malus domestica]
Length=531

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KEE +R+WNVYK++FP IPN  YH+I++SLLRL D+E AE +++EWL+ KS YDP
Sbjct  320  GSVGKKEEAYRVWNVYKASFPSIPNLGYHAIMSSLLRLGDIEGAEKLYEEWLTVKSTYDP  379

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  Y+++G F  A+ F   ++D G KPN  TWE LA+GHI E+RISEALSC KE
Sbjct  380  RIANLFITFYIKEGDFVNAQSFYDHMVDVGGKPNSSTWEALAEGHIAEKRISEALSCWKE  439

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A SAEGSK+WRP P  +S+F +LCE E D+ SKE+ + +L Q+G L  + YVS +
Sbjct  440  AFSAEGSKSWRPKPVNVSAFLELCEQEGDSVSKEVFMGLLSQSGQLRNKLYVSLL  494



>ref|XP_011032472.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Populus euphratica]
Length=539

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEEV+R+WN+YKS FP IPN  YH++I+SL+R+DD+E AE I++EWLS K+ YDP
Sbjct  323  GNVGNKEEVYRVWNIYKSIFPSIPNLGYHAMISSLVRMDDIEGAEKIYEEWLSIKTSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  YV +G  + A+ F   +++ G KPN  TWEILA GHI ERR SEALSCLKE
Sbjct  383  RIANLFIAAYVYQGNLDEAKRFFDHMLEEGGKPNSNTWEILAQGHISERRTSEALSCLKE  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTP  190
            A    GSK+W+P PA ++SFFKLCE E D  +KE L   L+Q+G L  + Y S +  P
Sbjct  443  AFVTPGSKSWKPNPANVTSFFKLCEEEADMANKEALEGFLRQSGHLKDKAYASLLGMP  500



>ref|XP_008344410.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Malus domestica]
Length=537

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KEE +R+WNVYK++FP IPN  YH+I++SLLRL D+E AE +++EWL+ KS YDP
Sbjct  326  GSVGKKEEAYRVWNVYKASFPSIPNLGYHAIMSSLLRLGDIEGAEKLYEEWLTVKSTYDP  385

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  Y+++G F  A+ F   ++D G KPN  TWE LA+GHI E+RISEALSC KE
Sbjct  386  RIANLFITFYIKEGDFVNAQSFYDHMVDVGGKPNSSTWEALAEGHIAEKRISEALSCWKE  445

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN-  187
            A SAEGSK+WRP P  +S+F +LC+ E D  SKE+ + +L Q+G L  + YVS +   + 
Sbjct  446  AFSAEGSKSWRPKPVNVSAFLELCZQEGDXVSKEVFMGLLSQSGQLRNKLYVSLLGLADE  505

Query  186  ----GSNTNNEPDTWEEDS--FLDNN  127
                 +N N + D   +D   FL N 
Sbjct  506  DVNYKTNVNEDDDEKADDGSEFLLNQ  531



>ref|XP_008343638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
isoform X1 [Malus domestica]
Length=535

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 0/182 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KEE +R+WNVYK++FP IPN  YH+II+SLLRL DVE +E +++EWL+ KS YDP
Sbjct  324  GSVGKKEEAYRVWNVYKASFPTIPNLGYHAIISSLLRLGDVEGSEKLYEEWLTVKSTYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  Y+++G F+ A+ F   ++D G KPN  TWE L +GH++ERRISEALSC KE
Sbjct  384  RIANLFITFYIKEGDFDSAQSFYNHMVDVGGKPNSSTWESLTEGHMEERRISEALSCWKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGSK+WRP P  +S+F +LCE E D+ SKE+ + +L Q+G L  + Y S +   + 
Sbjct  444  AFSAEGSKSWRPKPVNVSAFLELCEQEADSVSKEVFMGLLSQSGQLKNKLYASLLGLTDD  503

Query  183  SN  178
             N
Sbjct  504  VN  505



>emb|CDX90079.1| BnaA10g00030D [Brassica napus]
Length=512

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E+FR+WNVYKS  P IPN  YH++++SL+R+ DVE AE +++EWL  KS YDP
Sbjct  317  GSVGNKKELFRVWNVYKSVVPSIPNLGYHALVSSLVRMGDVEAAEKVYEEWLPVKSSYDP  376

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q ++AEG    +I+ G KP+P TWEILADGH ++R I+EAL+CLKE
Sbjct  377  RIPNLLMNVYVKNDQLDKAEGLFDHMIEMGGKPSPGTWEILADGHTRKRSITEALACLKE  436

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A SA+GS NWRP    +S FFKLCE E D  SKE ++E+L Q+G L  + Y + I
Sbjct  437  AFSAQGSSNWRPKVLVLSGFFKLCEEESDVTSKETVLELLSQSGHLQDKSYQALI  491



>ref|XP_007052357.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOX96514.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=549

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             GVGN+EEV+R+W VYKS FP IPN  +H++I+SL+R  D++ AE I++EWL+ K+ YDP
Sbjct  323  GGVGNREEVYRVWKVYKSIFPSIPNLGFHAVISSLVRAGDIQGAERIYEEWLTVKTSYDP  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANLL+  YV++G  ++AE   + I + G KPN  +WEILA+GHI E+RI +ALSCLK+
Sbjct  383  RIANLLMGWYVKEGNLDKAESLFSHIAEVGGKPNSSSWEILAEGHILEKRIPDALSCLKD  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A + EGS+ WRP P ++S+FF LCE + D  S+E+ + +L+Q+GCL  E Y S I
Sbjct  443  AFATEGSRGWRPKPTSVSAFFNLCEEKVDMASREVFVGLLRQSGCLKNEAYASLI  497



>ref|XP_002892022.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68281.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=523

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 137/202 (68%), Gaps = 1/202 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+WNVYKS  P IPN  YH++++SL R+ D+E AE +++EWL  KS YDP
Sbjct  320  GSVGNKKELYRVWNVYKSVVPSIPNLGYHALVSSLARMGDIEGAEKVYEEWLPVKSSYDP  379

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E+AEG    +++ G KP+  TWEILADGH ++R I EAL+CL++
Sbjct  380  RIPNLLMNVYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRK  439

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT-PN  187
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+Q+G L  + Y + I    N
Sbjct  440  AFSAEGSSNWRPKVLMLSGFFKLCEEESDVTSKEAVLELLRQSGHLEDKAYQALIDVDEN  499

Query  186  GSNTNNEPDTWEEDSFLDNNDD  121
             +  N+E D  E D+ L    D
Sbjct  500  RTENNSEIDAHETDALLTQLQD  521



>ref|XP_009338668.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Pyrus x bretschneideri]
Length=530

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KEE +R+WNVYK++FP IPN  YH+I++SLLRL D+E AE +++EWL+ KS YDP
Sbjct  324  GSVGKKEEAYRVWNVYKASFPSIPNLGYHAIMSSLLRLGDIEGAEKLYEEWLTVKSTYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  Y+++G F  A+ F   ++D G KPN  TWE LA+GHI E+RIS ALSC KE
Sbjct  384  RIANLFITFYIKEGDFVNAQSFYDHMVDVGGKPNSSTWEALAEGHIAEKRISAALSCWKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS +WRP P  +S+F +LCE E D+ SKE+ + +L Q+G L  + YVS +   + 
Sbjct  444  AFSAEGSNSWRPKPVNVSAFLELCEQEADSVSKEVFMGLLSQSGQLRNKLYVSLLGLAD-  502

Query  183  SNTNNEPDTWEED  145
             + N++ +  E+D
Sbjct  503  EDVNDKTNVNEDD  515



>ref|XP_010496689.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=447

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+WNVYKS  P IPN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  246  GSVGNKKELYRVWNVYKSVAPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  305

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E+AEG    +++ G KP+  TWEILADGH ++R I EAL+CL++
Sbjct  306  RIPNLLMNAYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRK  365

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+Q+G L  + Y + I   + 
Sbjct  366  AFSAEGSSNWRPKVLMLSGFFKLCEEESDVTSKEAVLELLRQSGHLQDKSYQALIDV-DE  424

Query  183  SNTNNEPDTWEEDSFLDNNDD  121
            +N+ N+    E D  L    D
Sbjct  425  NNSENDAHDHESDVLLTQLQD  445



>gb|KDP28877.1| hypothetical protein JCGZ_14648 [Jatropha curcas]
Length=528

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 133/190 (70%), Gaps = 4/190 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEEV+R+WN+YKS FP IPN  YH+II+SL+R+ D+E AE  ++EWL  K+ YDP
Sbjct  324  GNVGNKEEVYRVWNIYKSVFPNIPNLGYHAIISSLIRVGDIEGAEKTYEEWLPIKTSYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV++G F++AE F   + DAG KPN  TWEILADG IKE+R+ EALSC KE
Sbjct  384  RIGNLLMSWYVKEGNFDKAENFFNHMADAGGKPNANTWEILADGQIKEKRVPEALSCFKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVS----QIP  196
            A  AEG+ +W+P P  +S+FF LCE + D  SK +  ++L+Q+G L  E Y S     I 
Sbjct  444  AFIAEGASSWKPKPVLVSAFFNLCEEKADMASKGVFEDLLRQSGYLEDETYASLLKLSIT  503

Query  195  TPNGSNTNNE  166
            + N  +T N+
Sbjct  504  SSNKLSTEND  513



>ref|XP_009119759.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Brassica rapa]
Length=512

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E+FR+WNVYKS  P IPN  YH++++SL+R+ DVE AE +++EWL  KS YDP
Sbjct  317  GSVGNKKELFRVWNVYKSVVPSIPNLGYHALVSSLVRMGDVEAAEKVYEEWLPVKSSYDP  376

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q ++AEG    +I+ G KP+P TWEILADGH ++R I+EAL+CLKE
Sbjct  377  RIPNLLMNVYVKNDQLDKAEGLFDHMIEMGGKPSPGTWEILADGHTRKRSITEALACLKE  436

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A SA+GS +WRP    +S FFKLCE E D  SKE ++E+L Q+G L  + Y + I
Sbjct  437  AFSAQGSSSWRPKVLVLSGFFKLCEEESDVTSKETVLELLSQSGHLQDKSYQALI  491



>ref|XP_006306047.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
 gb|EOA38945.1| hypothetical protein CARUB_v10011354mg [Capsella rubella]
Length=524

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 133/194 (69%), Gaps = 1/194 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+WNVYKS  P IPN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  319  GSVGNKKELYRVWNVYKSVAPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  378

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E+AEG    +++ G KP+  TWEILADGH ++R I EAL+CL++
Sbjct  379  RIPNLLMNVYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRK  438

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+QAG L  + Y + I     
Sbjct  439  AFSAEGSSNWRPKVLMLSGFFKLCEEESDITSKEAVLELLRQAGHLQDKSYQALIDVDEN  498

Query  183  SNTNN-EPDTWEED  145
               NN E D  E D
Sbjct  499  RTVNNSENDAHESD  512



>ref|XP_006445447.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 ref|XP_006464406.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Citrus sinensis]
 gb|ESR58687.1| hypothetical protein CICLE_v10019658mg [Citrus clementina]
 gb|KDO85468.1| hypothetical protein CISIN_1g009424mg [Citrus sinensis]
Length=535

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 137/200 (69%), Gaps = 4/200 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG KEEV+R+WN+Y+S FP + N  YH++I+SL R+ D+E  E IF+EWLS KS YDP
Sbjct  328  GSVGKKEEVYRVWNLYRSVFPGVTNLGYHAMISSLARIGDIEGMEKIFEEWLSVKSSYDP  387

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL++  YV++G F++AE F   II+ G KPN  +WE LA+GHI+ERRI EALSCLK 
Sbjct  388  RIANLMMSWYVKEGNFDKAEAFFNSIIEEGGKPNSTSWETLAEGHIRERRILEALSCLKG  447

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A +AEG+K+WRP P  + +FFK CE E D  SKE  + +L+Q G    +DY+S I   + 
Sbjct  448  AFAAEGAKSWRPKPVNVINFFKACEEESDMGSKEAFVALLRQPGYRKEKDYMSLIGLTDE  507

Query  183  S----NTNNEPDTWEEDSFL  136
            +    N  N+ D+ E+   L
Sbjct  508  AVAENNKKNDEDSDEDSEML  527



>emb|CDY15126.1| BnaC05g00050D [Brassica napus]
Length=512

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E+FR+WNVYKS  P IPN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  317  GSVGNKKELFRVWNVYKSVVPSIPNLGYHALVSSLVRMGDIEAAEKVYEEWLPVKSSYDP  376

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q ++A+G    +I+ G KP+P TWEILADGH ++R I+EAL+CLKE
Sbjct  377  RIPNLLMNVYVKNDQLDKAQGLFDHMIEMGGKPSPGTWEILADGHTRKRSITEALACLKE  436

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A SA+GS NWRP    +S FFKLCE E D  SKE ++E+L Q+G L  + Y + I
Sbjct  437  AFSAQGSCNWRPKVLVLSGFFKLCEEESDVISKETVLELLSQSGHLQDKSYQTLI  491



>ref|NP_171717.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q8LPS6.2|PPR3_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g02150 
[Arabidopsis thaliana]
 gb|AAC24372.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE27393.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=524

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 135/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK+E++R+W+VYKS  P IPN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  321  GSLGNKKELYRVWHVYKSVVPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  380

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E AEG    +++ G KP+  TWEILA GH ++R ISEAL+CL+ 
Sbjct  381  RIPNLLMNAYVKNDQLETAEGLFDHMVEMGGKPSSSTWEILAVGHTRKRCISEALTCLRN  440

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+Q+G L  + Y++ I     
Sbjct  441  AFSAEGSSNWRPKVLMLSGFFKLCEEESDVTSKEAVLELLRQSGDLEDKSYLALIDVDEN  500

Query  183  SNTNN-EPDTWEEDSFLDNNDD  121
               NN E D  E D+ L    D
Sbjct  501  RTVNNSEIDAHETDALLTQLQD  522



>gb|AAM19786.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
 gb|AAO64747.1| At1g02150/T7I23.8 [Arabidopsis thaliana]
Length=524

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 135/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK+E++R+W+VYKS  P IPN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  321  GSLGNKKELYRVWHVYKSVVPSIPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  380

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E AEG    +++ G KP+  TWEILA GH ++R ISEAL+CL+ 
Sbjct  381  RIPNLLMNAYVKNDQLETAEGLFDHMVEMGGKPSSSTWEILAVGHTRKRCISEALTCLRN  440

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+Q+G L  + Y++ I     
Sbjct  441  AFSAEGSSNWRPKVLMLSGFFKLCEEESDVTSKEAVLELLRQSGDLEDKSYLALIDVDEN  500

Query  183  SNTNN-EPDTWEEDSFLDNNDD  121
               NN E D  E D+ L    D
Sbjct  501  RTVNNSEIDAHETDALLTQLQD  522



>gb|EYU40343.1| hypothetical protein MIMGU_mgv1a004109mg [Erythranthe guttata]
Length=543

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 129/176 (73%), Gaps = 0/176 (0%)
 Frame = -3

Query  711  NKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVAN  532
            NK+EV+R+WN+YK++F  IPN  YH++I++L R D++E AE I+DEWLS KS +DPR+ N
Sbjct  337  NKDEVYRVWNLYKASFFNIPNLGYHTVISALARTDEMEGAEKIYDEWLSVKSFFDPRITN  396

Query  531  LLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSA  352
            +LL  YVRKG  ++AE    Q+I+AG KPN  TWEI A+ HI+  RISEALSCL  A  A
Sbjct  397  ILLSSYVRKGLSQKAETMFGQMIEAGGKPNSMTWEIFAEDHIRNTRISEALSCLNSATLA  456

Query  351  EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            +GSKNWRP P+ +SS  K+CE + D  SK+ L+ +L++ GCL+   Y+S IP  +G
Sbjct  457  DGSKNWRPNPSNVSSILKICEQQADVASKDALLAILRRMGCLNDVSYMSYIPMLSG  512



>ref|XP_010496474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Camelina sativa]
Length=521

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+W+VYKS  P +PN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  319  GSVGNKKELYRVWHVYKSVAPSVPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  378

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E+AEG    +++ G KP+  TWEILADGH ++R I EAL+CL++
Sbjct  379  RIPNLLMNAYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRK  438

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E    SKE ++E+L+Q+G L  + Y + I   + 
Sbjct  439  AFSAEGSSNWRPKVLMLSGFFKLCEEESAVTSKEAVLELLRQSGHLQDKSYQALIDVVDE  498

Query  183  SNTNNEPDTWEEDSFLDNNDD  121
            +N+ N+    E D  L    D
Sbjct  499  NNSENDSHDHESDVLLTQLQD  519



>ref|XP_006418504.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
 gb|ESQ36857.1| hypothetical protein EUTSA_v10007383mg [Eutrema salsugineum]
Length=517

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 131/186 (70%), Gaps = 0/186 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+WNVYKS  P IPN  YH++++SL+R+ D++ AE +++EWL  KS YDP
Sbjct  319  GSVGNKKELYRVWNVYKSVVPSIPNLGYHALVSSLVRMGDIQGAEKVYEEWLPVKSSYDP  378

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q ++AEG    +I+ G KP+  TWEILA GH ++R I+EAL+CLKE
Sbjct  379  RIPNLLMNVYVKNDQLDKAEGLFDHMIEMGGKPSSSTWEILAHGHTRKRNITEALTCLKE  438

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E D  SKE ++E+L+Q+G L  + Y + I     
Sbjct  439  AFSAEGSSNWRPKVFMLSGFFKLCEEESDVASKEAVLELLRQSGHLQDKSYQALIDDAQE  498

Query  183  SNTNNE  166
            S + +E
Sbjct  499  SESESE  504



>ref|XP_010479321.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Camelina sativa]
Length=559

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+E++R+W+VYKS  P +PN  YH++++SL+R+ D+E AE +++EWL  KS YDP
Sbjct  357  GSVGNKKELYRVWHVYKSVAPSVPNLGYHALVSSLVRMGDIEGAEKVYEEWLPVKSSYDP  416

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+  Q E+AEG    +++ G KP+  TWEILADGH ++R I EAL+CL++
Sbjct  417  RIPNLLMNAYVKNDQLEKAEGLFDHMVEMGGKPSSSTWEILADGHTRKRCIPEALTCLRK  476

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A SAEGS NWRP    +S FFKLCE E    SKE ++E+L+Q+G L  + Y + I   + 
Sbjct  477  AFSAEGSSNWRPKVLMLSGFFKLCEEESAVTSKEAVLELLRQSGHLQDKSYQALIDVVDE  536

Query  183  SNTNNEPDTWEEDSFLDNNDD  121
            +N+ N+    E D  L    D
Sbjct  537  NNSENDSHDHESDVLLTQLQD  557



>emb|CBI16683.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               GNK EV+R WN+YKS FP IPN  YH++I+SL+R+ D+E AE I++EWLS KS YDP
Sbjct  243  GSTGNKAEVYRAWNIYKSKFPNIPNLGYHALISSLVRVGDLEGAEKIYEEWLSVKSSYDP  302

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL CYV++G  E+AEGFL  +I+AG KPN  TWEILA+G+   ++IS+ALSC K 
Sbjct  303  RIGNLLLGCYVKEGFLEKAEGFLDHMIEAGGKPNSTTWEILAEGNTGVKKISDALSCFKR  362

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A  AEGS  W+P P  +S+F  LCE E DT +KE L+ +L+Q G
Sbjct  363  AVLAEGSNGWKPKPVNVSAFLDLCEEEADTATKEALMGLLRQMG  406



>ref|XP_008438222.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Cucumis melo]
Length=537

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 137/205 (67%), Gaps = 11/205 (5%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+WN+YK+ FP IPN  YH+II++L+R+ DVE AE I++EWL+ K+ YDP
Sbjct  324  GSVGNKEEMYRVWNIYKNVFPTIPNLGYHAIISALIRVGDVEGAEKIYEEWLTVKATYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  YV++    +AEGF   +++ G KPN  TWEILADGH KE R+S+AL+  KE
Sbjct  384  RIANLFIGWYVKEANMSKAEGFFDHMVEVGGKPNSSTWEILADGHTKEGRVSDALASWKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI-----  199
            A S+EGSK+WRP P  + ++F LCE E D  SKE+L+  L+Q   L  + Y S I     
Sbjct  444  AFSSEGSKSWRPKPYNVLAYFDLCEKEGDIASKEVLVGFLRQPKYLQDKSYASLIGLLDE  503

Query  198  ------PTPNGSNTNNEPDTWEEDS  142
                   +  GS+ N+E D  E +S
Sbjct  504  TIDNDEVSEKGSSINDEIDKTEYES  528



>ref|XP_004133941.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 ref|XP_004169913.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cucumis sativus]
 gb|KGN56639.1| hypothetical protein Csa_3G127020 [Cucumis sativus]
Length=537

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 136/205 (66%), Gaps = 11/205 (5%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKEE++R+WN+YK+ FP IPN  YH+II++L+R+ DVE AE I++EWL+ KS YDP
Sbjct  324  GSVGNKEEMYRVWNIYKNVFPTIPNLGYHAIISALIRVGDVEGAEKIYEEWLTVKSTYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  YV++G   +AE F   +++ G KPN  TWEIL D H KE R+S+AL+  KE
Sbjct  384  RIANLFIGWYVKEGNTSKAESFFDHMVEVGGKPNSSTWEILVDRHTKEGRVSDALASWKE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI-----  199
            A SAEGSK+WRP P  + ++F LCE E D  SKE+L+ +L+Q   L  + Y S I     
Sbjct  444  AFSAEGSKSWRPKPYNVLAYFDLCEKEGDIASKEVLVGLLRQPKYLQDKTYASLIGLLDE  503

Query  198  ------PTPNGSNTNNEPDTWEEDS  142
                   +  GSN N+E D  E +S
Sbjct  504  TIDNNEVSEKGSNINDEIDKTEYES  528



>ref|XP_010692029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 133/198 (67%), Gaps = 4/198 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNKEEV R+WN YKS F  IPN  YH++I++L+RL D+E AE +++EWL  K+ YDP
Sbjct  324  GSIGNKEEVNRVWNTYKSTFSSIPNWGYHAMISALIRLGDIEGAEKMYEEWLPVKTSYDP  383

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            +VANLL+  Y+R+  FE+A+ F   +I+ G KPN  +WEIL +GHIKE RISEALSC +E
Sbjct  384  KVANLLMGWYIREEPFEKAQNFFNSMIEGGAKPNSGSWEILEEGHIKEGRISEALSCFRE  443

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  AE  KNW P P+ +S+F +LC+ E D  SKE  I +L+Q GCL  E Y S +     
Sbjct  444  AMLAETPKNWYPKPSNVSAFLELCDQEGDNASKEDYIVLLRQLGCLQDESYRSLLV----  499

Query  183  SNTNNEPDTWEEDSFLDN  130
             + + E    E  SF+DN
Sbjct  500  GHVDVEVGEGEGKSFIDN  517



>gb|KHN31110.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=418

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG K+EV+R+WN YKS FP IPN  YH+II+SL++LDD+E AE +++EW+S KS YDP
Sbjct  197  GSVGKKDEVYRVWNTYKSIFPRIPNLGYHAIISSLVKLDDIEGAEKLYEEWISVKSSYDP  256

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+K   ++A  F  QI + G  PN  TWEIL++GHI ++RISEALSCLKE
Sbjct  257  RIGNLLMGWYVKKDDTDKALSFFEQISNDGCIPNSNTWEILSEGHIADKRISEALSCLKE  316

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN  187
            A   A GSK+WRP P+ +S+F +LC+ ++D ES E+LI +L+Q+     + Y S I +P+
Sbjct  317  AFMVAGGSKSWRPKPSYLSAFLELCQEQNDMESAEVLIGLLRQSKFSKIKVYASIIGSPD  376

Query  186  GSNTNNE  166
             +  N E
Sbjct  377  CTIDNGE  383



>ref|XP_003520417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
Length=555

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG K+EV+R+WN YKS FP IPN  YH+II+SL++LDD+E AE +++EW+S KS YDP
Sbjct  334  GSVGKKDEVYRVWNTYKSIFPRIPNLGYHAIISSLVKLDDIEGAEKLYEEWISVKSSYDP  393

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+K   ++A  F  QI + G  PN  TWEIL++GHI ++RISEALSCLKE
Sbjct  394  RIGNLLMGWYVKKDDTDKALSFFEQISNDGCIPNSNTWEILSEGHIADKRISEALSCLKE  453

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN  187
            A   A GSK+WRP P+ +S+F +LC+ ++D ES E+LI +L+Q+     + Y S I +P+
Sbjct  454  AFMVAGGSKSWRPKPSYLSAFLELCQEQNDMESAEVLIGLLRQSKFSKIKVYASIIGSPD  513

Query  186  GSNTNNE  166
             +  N E
Sbjct  514  CTIDNGE  520



>ref|XP_003530115.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Glycine max]
 gb|KHN12244.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=546

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VG K+EV R+WN YKS FP IPN  YH+II+SL++LDD+E AE +++EW+S KS YDP
Sbjct  335  GSVGKKDEVCRVWNTYKSIFPSIPNLGYHAIISSLVKLDDIEVAEKLYEEWISVKSSYDP  394

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  YV+KG  ++A  F  Q+++ G  PN  TWEIL++GHI ++RISEA+SCLKE
Sbjct  395  RIGNLLIGWYVKKGDTDKALSFFEQMLNDGCIPNSNTWEILSEGHIADKRISEAMSCLKE  454

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN  187
            A  +A GSK+WRP P+ +S+F +LC+ +DD ES E+LI +L+Q+     + Y S I + +
Sbjct  455  AFMAAGGSKSWRPKPSYLSAFLELCQEQDDMESAEVLIGLLRQSKFNKSKVYASLIGSSD  514



>gb|AFK44508.1| unknown [Medicago truncatula]
Length=244

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 134/199 (67%), Gaps = 0/199 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+EV+R+WN YKS FP IPN  YH+II+SL+R+DD+E AE +++EW+S +   D 
Sbjct  34   GSVGNKDEVYRVWNNYKSMFPSIPNLGYHAIISSLVRMDDIEGAEKLYEEWVSVRPSDDS  93

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  Y++KG+ ++   F   + + G  PN  TWE+L++GHI E+R+SEALSCL++
Sbjct  94   RIGNLLISWYLKKGKSDKVFSFFKHMSEGGGCPNSTTWELLSEGHIAEKRVSEALSCLEK  153

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A     SK+W+P P  +++F KLC+ EDD ES ++LIE+L++ G  + E Y + I     
Sbjct  154  AFMTSDSKSWKPKPIKLAAFLKLCQDEDDMESAKVLIELLRKPGYHNDEAYAALISKDEP  213

Query  183  SNTNNEPDTWEEDSFLDNN  127
            SN     D  + ++  D++
Sbjct  214  SNRTERIDDVDSENMDDDD  232



>gb|KEH17920.1| PPR containing plant-like protein [Medicago truncatula]
Length=407

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 137/202 (68%), Gaps = 1/202 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+EV+R+WN YKS FP IPN  YH++I+S +R+DD+E AE +++EW+S +   D 
Sbjct  197  GSVGNKDEVYRVWNNYKSMFPSIPNLGYHAVISSFVRMDDIERAEKLYEEWVSVRPSDDS  256

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  Y++KG+ ++   F   + + G  PN  TWE+L++GHI E+R+SEALSCL++
Sbjct  257  RIGNLLISWYLKKGKSDKVFSFFKHMSEGGGCPNSTTWELLSEGHIAEKRVSEALSCLEK  316

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A     SK+W+P P  +++F KLC+ EDD ES E+LIE+L+++G  + E Y + I     
Sbjct  317  AFMTSDSKSWKPKPIKLAAFLKLCQDEDDMESAEVLIELLRKSGYHNDEAYAAIISKDEP  376

Query  183  SNTNNEPDTWEEDSFLDNNDDK  118
            SN     D  + ++ +D++D +
Sbjct  377  SNRTERIDDVDSEN-MDDDDSQ  397



>ref|XP_004515320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Cicer arietinum]
Length=543

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 133/206 (65%), Gaps = 5/206 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNK+EV+R+WN YKS FP IPN  YH+ I+SL+R+DD+E A  +++EW+S +   D 
Sbjct  329  GSVGNKDEVYRVWNTYKSMFPSIPNLGYHAAISSLVRMDDIEGAGKLYEEWVSVRPSDDS  388

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  Y++KG+F++   F   +   G  PN  TWE+L++ HI E+R+S+ALSCLK+
Sbjct  389  RIGNLLICWYLKKGKFDKVLSFFEHMTKGGGCPNATTWELLSECHIAEKRVSDALSCLKK  448

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A    GSK+W+P P  + +FFKLC  +D+ ES E+LIE+LK++G    E + S I     
Sbjct  449  AFMTSGSKSWKPKPIKLLAFFKLCRDQDNMESAEVLIELLKKSGYDKDEAFASLIGEDEL  508

Query  183  SNTNNEPDTWEEDSFLDN---NDDKS  115
            SN     D    D  +DN   +DD S
Sbjct  509  SNRMETVD--RTDDIVDNENMDDDDS  532



>ref|XP_009387580.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150, 
partial [Musa acuminata subsp. malaccensis]
Length=377

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 117/162 (72%), Gaps = 0/162 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G +EEV+RIWN YKS+FP I N  Y S+++SL+RL D++ AE I++EWLS+ S YDPR+
Sbjct  203  IGKREEVYRIWNWYKSSFPSILNLGYQSMLSSLIRLGDMDGAEVIYEEWLSSTSSYDPRI  262

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+L+  YV++G   +A+  L   ++ G KP P TWE LA+G+ KE+R+SEAL C+K A 
Sbjct  263  CNILMSSYVKEGLVGKAKDVLDGFLEKGGKPKPNTWEFLAEGYTKEKRLSEALLCIKAAA  322

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            S+EG   WRP P  I++  +LC+ ++D +S ++L+++L+  G
Sbjct  323  SSEGVHRWRPRPTNITNLLELCKEKNDMDSLDMLMDLLRSRG  364



>ref|XP_008794909.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=507

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YKS+FP I N  YHS+++SL+RL D + AE IF EWLS  S YDPR+
Sbjct  328  IGKKEEVYRIWNWYKSSFPSILNMGYHSMLSSLIRLGDTDGAEMIFGEWLSMTSSYDPRI  387

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +A+  L +  + G KP P TWEILA+G+IK  + SEAL C+KEA 
Sbjct  388  CNILLGSYAREGLVAKAKNVLDRFSEKGGKPRPVTWEILAEGYIKVEQTSEALLCIKEAA  447

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            S  G  NWRP P  I     LC+ ++D     +L++ L+  GC   E+Y + I
Sbjct  448  SYGGVNNWRPKPTNIEILLALCKRQNDIAGVNMLMDALRMRGCHENEEYKALI  500



>ref|XP_010933566.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Elaeis guineensis]
Length=508

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 117/173 (68%), Gaps = 0/173 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G +EEV+RIWN YKS+FP I N  Y  +++SL+RL DV+ AE I++EWLS  S YDPR+
Sbjct  329  IGKREEVYRIWNWYKSSFPRILNVGYQCMLSSLIRLGDVDGAEMIYEEWLSMTSSYDPRI  388

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +A+  L + ++ G KP P  WE LA+G+IKE +ISEALS ++EA 
Sbjct  389  CNILLGLYAREGLASKAKNALDKFLEKGGKPRPIMWETLAEGYIKEEQISEALSYMREAV  448

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            S EG  NWRP P  I +   LC+ ++D  S  +L+++L+  GC   E+Y S I
Sbjct  449  SYEGVNNWRPKPKNIENLLALCKGQNDISSINMLMDMLRMRGCHEKEEYKSLI  501



>ref|XP_007134411.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
 gb|ESW06405.1| hypothetical protein PHAVU_010G045500g [Phaseolus vulgaris]
Length=542

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 133/205 (65%), Gaps = 3/205 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPF-IPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPR  541
            V NK+EV+R+WN YK+ FP   PN  YH+IIASL++LDD+  AE ++ EW+S KS YDPR
Sbjct  327  VRNKDEVYRVWNSYKTVFPKNTPNLGYHAIIASLVKLDDIAGAEKLYQEWVSVKSSYDPR  386

Query  540  VANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA  361
            V NLLL  YV  G   +A  F  Q+ + G  PN  TWEIL++G+I ++RISEALSCLK+A
Sbjct  387  VGNLLLGWYVEAGDIHKALSFFKQMKEDGGFPNSNTWEILSEGYIADKRISEALSCLKDA  446

Query  360  -GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
               A+ S++WRP P  +S+F +LC+ + D ES E  I +LK +     + Y S I + +G
Sbjct  447  FMVADNSRSWRPKPLNLSAFLELCQEQGDMESAETFIVLLKLSKFSKHKTYASLIGS-SG  505

Query  183  SNTNNEPDTWEEDSFLDNNDDKSGD  109
               +++ DT   +  + + +D  G+
Sbjct  506  DGLSSKIDTIGRNDDIHDREDMDGE  530



>ref|XP_010919766.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150 
[Elaeis guineensis]
Length=506

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 112/171 (65%), Gaps = 1/171 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YKS+FP I N  Y  +++SL+RL DV+ AE I+ EWLS  S YDPR+
Sbjct  328  IGKKEEVYRIWNWYKSSFPSILNMGYQLMLSSLIRLGDVDGAEMIYGEWLSMTSSYDPRI  387

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +A+  L +  + G KP P TWEILA+G+IKE + SEAL C+KEA 
Sbjct  388  CNILLGSYAREGLVGKAKNVLDRFSEKGGKPKPITWEILAEGYIKEEQTSEALLCIKEAA  447

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVS  205
            S  G  NWRP P  I +   LC+  +D  S  +L++ L+  GC   E+Y S
Sbjct  448  SY-GVNNWRPNPTNIENLLALCKRHNDFASVNMLMDALRMRGCHEEEEYKS  497



>ref|XP_008786192.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Phoenix dactylifera]
Length=508

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 109/172 (63%), Gaps = 0/172 (0%)
 Frame = -3

Query  708  KEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANL  529
            K EV+RIWN YKS+FP I N  Y  +++SL+RL D + AE I++EWLS  S YDPR+ N+
Sbjct  332  KREVYRIWNWYKSSFPRILNMGYQCMLSSLIRLGDADGAEMIYEEWLSTTSSYDPRICNI  391

Query  528  LLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAE  349
            LL  Y R+G   +A+  L   ++ G KP P  WE LA+G+IKE +ISEAL  +KEA S E
Sbjct  392  LLGLYAREGLLRKAKKTLDNFLEKGGKPRPIMWETLAEGYIKEEQISEALLYMKEAASFE  451

Query  348  GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            G  NWRP P  I     LC+  +D  S  +L+++L+   C   E+Y S I T
Sbjct  452  GVNNWRPKPKNIEKLLALCKERNDISSIHMLMDMLRMRRCHEKEEYKSLIST  503



>gb|EPS66397.1| hypothetical protein M569_08380, partial [Genlisea aurea]
Length=447

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               G  +EV R+WN+YK+ FP IPN +Y+++I++LLR D+++DA  ++DEW  AK+RYDP
Sbjct  279  GSAGKSDEVRRMWNLYKATFPIIPNVAYNTVISALLRTDEIDDARKLYDEWAKAKTRYDP  338

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL LV Y R G  E+ E F  ++   G +PN  TWE++A+ HI+  R  EA+SC+ E
Sbjct  339  RIGNLFLVWYSRNGLGEKVESFFDEMSRLGCEPNGLTWEVMAEYHIRNGRPREAVSCVGE  398

Query  363  AGSAEGS-KNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCL  226
            A + E   K W P P+T+++  +LCE   D  S+E L+E+L+  G L
Sbjct  399  AVAVERRPKKWAPKPSTVAAILRLCEEGGDAASREGLVEILRSVGRL  445



>ref|XP_003636175.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula]
Length=790

 Score =   163 bits (412),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 77/200 (39%), Positives = 125/200 (63%), Gaps = 15/200 (8%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNK+EV+R+WN YKS FP IPN  YH++I+S +R+DD+E AE +++EW+S +   D R+
Sbjct  499  VGNKDEVYRVWNNYKSMFPSIPNLGYHAVISSFVRMDDIERAEKLYEEWVSVRPSDDSRI  558

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NLL+  Y++KG+ ++   F   + + G  PN  TWE+L++GHI E+R+SEALSCL++A 
Sbjct  559  GNLLISWYLKKGKSDKVFSFFKHMSEGGGCPNSTTWELLSEGHIAEKRVSEALSCLEKAF  618

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGSN  178
                SK+W+P              + +    E+LIE+L+++G  + E Y + I     SN
Sbjct  619  MTSDSKSWKP--------------KANKNCAEVLIELLRKSGYHNDEAYAAIISKDEPSN  664

Query  177  TNNEPDTWEEDSFLDNNDDK  118
                 D  + ++ +D++D +
Sbjct  665  RTERIDDVDSEN-MDDDDSQ  683



>ref|XP_004956425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Setaria italica]
Length=513

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YK+ FP I N  Y  ++++L+R+ D+E AE +++EW S  S +DP+ 
Sbjct  333  LGKKEEVYRIWNWYKATFPTIHNLGYQEVLSALVRIGDIEGAELLYEEWASKSSSFDPKT  392

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  + Q ++ G  P P TWEILA  ++K+ +ISEALSC+++A 
Sbjct  393  MNILLAWYAREGLITKAEQIVNQFVEKGGNPKPNTWEILATAYLKDNKISEALSCMEKAT  452

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            + + +  W+P P  + S     + ++DTE  + L+ VL   GC   E+Y S I T
Sbjct  453  AVKSASKWKPRPTNVESLLASFKEKNDTEGADRLVSVLTSRGCAEDEEYKSLINT  507



>ref|XP_006652599.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02150-like 
[Oryza brachyantha]
Length=511

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 110/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  331  LGKKEEVYRIWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSNFDPKT  390

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEILA  ++K+ + SEALSCL++A 
Sbjct  391  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILATAYLKDGQSSEALSCLEKAT  450

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +      WRP P  + +   + +  +DTES + L+ VL+  GC   E+Y S I T
Sbjct  451  AVVSPSKWRPRPTNVENLLAIFKERNDTESVDRLMNVLRSRGCEENEEYKSLINT  505



>ref|XP_002448264.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
 gb|EES12592.1| hypothetical protein SORBIDRAFT_06g024190 [Sorghum bicolor]
Length=515

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 110/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YK+ FP I N  Y  ++++L+R+ D+E AE +++EW S  S +DP+ 
Sbjct  335  LGKKEEVYRIWNWYKATFPMIHNLGYQELLSALVRIGDIEGAELLYEEWASKSSSFDPKT  394

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y ++G   +AE  L + ++ G  P P TWEILA  ++K+ +ISEALSC+++A 
Sbjct  395  MNILLAWYAKEGLITKAEQTLNRFVEKGGNPKPNTWEILATAYMKDDKISEALSCMEKAT  454

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            + + +  W+P P  + S     + ++D E  + L+ VL   GC   E+Y S I T
Sbjct  455  AIKSANKWKPRPTNVESLLASFKEKNDAEGADRLVSVLTSRGCAEDEEYKSLINT  509



>dbj|BAK02297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +  KEEV+RIWN YK+ F  I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  323  LQKKEEVYRIWNWYKATFKTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  382

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +A+  L + ++ G  P P TWEILA  ++K+ ++SEALSCL++A 
Sbjct  383  MNILLAWYSREGFVVKAQQTLNRFVEKGGNPKPNTWEILATAYLKDNQLSEALSCLEKAT  442

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            + + +  WRP P  + +     + ++DTES + L+ VL+  GC   E+Y S I T
Sbjct  443  AVKSASKWRPRPTNVETLLAYFKEKNDTESVDRLMSVLRSRGCAENEEYKSLIDT  497



>dbj|BAJ85010.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 111/175 (63%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +  KEEV+RIWN YK+ F  I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  323  LQKKEEVYRIWNWYKATFKTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  382

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +A+  L + ++ G  P P TWEILA  ++K+ ++SEALSCL++A 
Sbjct  383  MNILLAWYSREGFVVKAQQTLNRFVEKGGNPKPNTWEILATAYLKDNQLSEALSCLEKAT  442

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            + + +  WRP P  + +     + ++DTES + L+ VL+  GC   E+Y S I T
Sbjct  443  AVKSASKWRPRPTNVETLLAYFKEKNDTESVDRLMSVLRSRGCAENEEYKSLIDT  497



>emb|CAE04345.1| OSJNBb0038F03.9 [Oryza sativa Japonica Group]
Length=511

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 107/175 (61%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+R+WN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  331  LGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  390

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEIL   ++K+ + SEALSCL++A 
Sbjct  391  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEALSCLEKAT  450

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +      WRP P  + S     + ++D ES + L+ VL+   C   E+Y S I T
Sbjct  451  AVASPSKWRPRPTNVESLLANFKEKNDAESADRLMNVLRSRRCEENEEYKSLINT  505



>gb|EAZ31514.1| hypothetical protein OsJ_15655 [Oryza sativa Japonica Group]
Length=531

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 107/175 (61%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+R+WN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  351  LGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  410

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEIL   ++K+ + SEALSCL++A 
Sbjct  411  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEALSCLEKAT  470

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +      WRP P  + S     + ++D ES + L+ VL+   C   E+Y S I T
Sbjct  471  AVASPSKWRPRPTNVESLLANFKEKNDAESADRLMNVLRSRRCEENEEYKSLINT  525



>gb|EAY95037.1| hypothetical protein OsI_16851 [Oryza sativa Indica Group]
Length=511

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 107/175 (61%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+R+WN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  331  LGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  390

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEIL   ++K+ + SEALSCL++A 
Sbjct  391  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEALSCLEKAT  450

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +      WRP P  + S     + ++D ES + L+ VL+   C   E+Y S I T
Sbjct  451  AVASPSKWRPRPTNVESLLANFKEKNDAESADRLMNVLRSRRCEENEEYKSLINT  505



>ref|NP_001168310.1| hypothetical protein [Zea mays]
 gb|ACN27772.1| unknown [Zea mays]
 tpg|DAA36624.1| TPA: hypothetical protein ZEAMMB73_688721 [Zea mays]
Length=513

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 108/175 (62%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+RIWN YK+ FP I N  Y  ++++L+R+ D+E AE +++EW S    +DP+ 
Sbjct  333  LGKKEEVYRIWNWYKATFPMIHNLGYQELLSALIRIGDIEGAELLYEEWASKSYSFDPKT  392

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y ++G   +AE  + + ++ G  P P TWEILA  ++ + +ISEALSC+++A 
Sbjct  393  MNILLAWYAKEGLITKAEQTVNRFVEKGGNPKPNTWEILATAYMNDDKISEALSCMEKAT  452

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            + + +  W+P P  + +     + ++D E  + L+ VL   GC   E+Y S I T
Sbjct  453  AVKSASKWKPRPTNVETLLASFKEKNDAEGADRLVSVLTSRGCAEDEEYKSLIDT  507



>ref|XP_010227218.1| PREDICTED: uncharacterized protein LOC100829762 [Brachypodium 
distachyon]
Length=987

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 109/172 (63%), Gaps = 0/172 (0%)
 Frame = -3

Query  708  KEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANL  529
            KEEV+RIWN YK+ F  I N  Y  ++++L+RL D+E AE +++EW S  S +DP+  N+
Sbjct  810  KEEVYRIWNWYKATFSTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKTMNI  869

Query  528  LLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAE  349
            LL  Y R+G   +AE  L + ++ G  P P TWEILA  ++K+ ++SEALSC+++A + +
Sbjct  870  LLAWYSREGFVVKAEQTLNRFVEKGGNPKPNTWEILASAYLKDNQLSEALSCMEKAAAVK  929

Query  348  GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
             +  WRP P+ + S     +  +DT+S + L+ VL   GC   E+Y S I T
Sbjct  930  SASRWRPRPSNVESLLAYFKENNDTDSADRLMGVLTSRGCAENEEYKSLINT  981



>ref|XP_006849761.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
 gb|ERN11342.1| hypothetical protein AMTR_s00024p00251490 [Amborella trichopoda]
Length=501

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            AG+G K E++RIW +YK++F  + NSSY  +I+SL++L D+E AE+ F+EW SA   YD 
Sbjct  337  AGMGKKAEMYRIWKLYKTSFKNMTNSSYICLISSLVKLGDIEGAESCFEEWESAGLSYDV  396

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL CY RKG  ++AE F  ++   G  PNP TWEILA+G+++  ++  AL+ ++E
Sbjct  397  RVTNILLACYARKGMVKKAELFFVRMRRQGGMPNPNTWEILAEGYLQNGQLGNALAAMEE  456

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            A S+     W+P    + + FK  E++ D E+ E  + +L+
Sbjct  457  AVSSGKGVGWKPKLENVHAIFKDFEMQGDVENVEKCMSILR  497



>gb|EMT27370.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=949

 Score =   148 bits (374),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 108/172 (63%), Gaps = 0/172 (0%)
 Frame = -3

Query  708  KEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANL  529
            KEEV+RIWN YK+ F  I N  Y  ++++L+RL D+E AE +++EW S  S +DP+  N+
Sbjct  770  KEEVYRIWNWYKATFKTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKTMNI  829

Query  528  LLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAE  349
            LL  Y R+G   +AE  L + ++ G  P P TWEILA  ++K+ + +E+LSCL++A + +
Sbjct  830  LLAWYSREGFVVKAEQTLNRFVEKGGNPKPNTWEILATAYLKDNQFAESLSCLEKATAVK  889

Query  348  GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
             +  WRP P  + S     + ++DTES + L+ +L+  GC   E+Y S   T
Sbjct  890  SASKWRPRPTNVESLLAYFKEKNDTESVDRLMSLLRSRGCAENEEYKSLFDT  941



>ref|NP_001053460.2| Os04g0544400 [Oryza sativa Japonica Group]
 dbj|BAF15374.2| Os04g0544400 [Oryza sativa Japonica Group]
Length=571

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 101/163 (62%), Gaps = 0/163 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+R+WN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  331  LGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  390

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEIL   ++K+ + SEALSCL++A 
Sbjct  391  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEALSCLEKAT  450

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGC  229
            +      WRP P  + S     + ++D ES + L+ VL+   C
Sbjct  451  AVASPSKWRPRPTNVESLLANFKEKNDAESADRLMNVLRSRRC  493



>gb|KEH18912.1| PPR repeat protein [Medicago truncatula]
Length=174

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 104/162 (64%), Gaps = 0/162 (0%)
 Frame = -3

Query  612  LDDVEDAENIFDEWLSAKSRYDPRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKT  433
            +DD+E AE +++EW+S +   D R+ NLL+  Y++KG+ ++   F   + + G  PN  T
Sbjct  1    MDDIEGAEKLYEEWVSVRPSDDSRIGNLLISWYLKKGKSDKVFSFFKHMSEGGGCPNSTT  60

Query  432  WEILADGHIKERRISEALSCLKEAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLI  253
            WE+L++GHI E+R+SEALSCL++A     SK+W+P P  +++F KLC+ EDD ES ++LI
Sbjct  61   WELLSEGHIAEKRVSEALSCLEKAFMTSDSKSWKPKPIKLAAFLKLCQDEDDMESAKVLI  120

Query  252  EVLKQAGCLHPEDYVSQIPTPNGSNTNNEPDTWEEDSFLDNN  127
            E+L++ G  + E Y + I     SN     D  + ++  D++
Sbjct  121  ELLRKPGYHNDEAYAALISKDEPSNRTERIDDVDSENMDDDD  162



>gb|EEC77735.1| hypothetical protein OsI_16848 [Oryza sativa Indica Group]
Length=1300

 Score =   137 bits (346),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 97/155 (63%), Gaps = 0/155 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G KEEV+R+WN YK+ FP I N  Y  ++++L+RL D+E AE +++EW S  S +DP+ 
Sbjct  331  LGKKEEVYRVWNWYKATFPTIHNLGYQEVLSALVRLGDIEGAELLYEEWASKSSSFDPKT  390

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y R+G   +AE  L + ++ G  P P TWEIL   ++K+ + SEALSCL++A 
Sbjct  391  MNILLAWYAREGFVTKAEQTLNRFVEKGGNPKPNTWEILGTAYLKDGQSSEALSCLEKAT  450

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLI  253
            +      WRP P  + S     + ++D ES + L+
Sbjct  451  AVASPSKWRPRPTNVESLLANFKEKNDAESADRLM  485



>gb|ABR18022.1| unknown [Picea sitchensis]
Length=561

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 103/175 (59%), Gaps = 0/175 (0%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GNK+EV+RIW  ++  FP + N SY  +++SL+ + D+E AE    +W S K+  D R+
Sbjct  351  LGNKDEVYRIWQSFELAFPKMTNRSYVCLLSSLVGMGDIEGAEVFIKKWESMKTFDDSRI  410

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
               LL  Y+ KG  ++AE  L +++D G KPN KTWE LA+G+I+  +I +A+  +K + 
Sbjct  411  YYALLNAYIEKGWLQKAELLLERVVDKGGKPNAKTWETLAEGYIQNEQIHKAMEAMKRSL  470

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            S EG+  W+P    + +  K  E + D +S E   ++L+    +  E Y S + T
Sbjct  471  SIEGNSPWQPKSVNVLALLKHFEKQGDVKSAEEFFKILRGVKFVSTEIYNSLLRT  525



>ref|XP_010242929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Nelumbo nucifera]
Length=500

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 115/204 (56%), Gaps = 13/204 (6%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            AG+G K+E++RIWN YK++   I NS+Y  +++SL++LDD+E AE IF EW    + YD 
Sbjct  289  AGIGKKDELYRIWNTYKAS-EKIYNSTYICMLSSLVKLDDIEGAEKIFGEWELGGTSYDF  347

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N L+  Y +KG  E+AE  +++ I+ G KP   TW++LA G+ +  +I  A+  LK+
Sbjct  348  RVPNRLISAYCKKGLLEKAEAIISKAIEKGKKPLSSTWDLLASGYYENNQILNAVETLKK  407

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG------CLHPEDYVSQ  202
            A  A     WRP  AT++   +  + + D E    LI +L  +G      C    +Y+  
Sbjct  408  AIMAS-RPGWRPNHATLAGCLEYYKEQRDVEGARKLIRLLGNSGHFSTDVCDRLLNYIE-  465

Query  201  IPTPNGSNTNNEPDTWEEDSFLDN  130
                NG+   N  D   ED+F D+
Sbjct  466  ----NGNPDMNILDQIGEDAFGDD  485



>emb|CAN73453.1| hypothetical protein VITISV_024964 [Vitis vinifera]
Length=499

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 106/170 (62%), Gaps = 2/170 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK E +RIWN+YK+   F  N+ Y ++++SLL+LDD++ AE  F+EWLS    +D 
Sbjct  288  ATMGNKTEXYRIWNLYKTIGKFF-NTGYVAMVSSLLKLDDMDGAEKTFEEWLSGNKFFDF  346

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLL+  Y +KG  E+AE  +++ I+ G +P   TW+ LA G+ +  ++ +A+  LK+
Sbjct  347  RVPNLLIRAYCKKGLLEKAEQLVSRAIEQGEEPIAVTWDALAAGYHENNQMEKAVDTLKK  406

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPED  214
            A  A  S+ W+P P T+S+  +  + + D E  E LI +L++   +   D
Sbjct  407  ALLA-TSQGWKPNPVTLSACLEYLKGKXDVEEAENLIRLLREQSLVSAYD  455



>ref|XP_009398991.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 103/177 (58%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            AG+ +K+ V+R+WN  K+ F  + +  +  +++SL +L D+E+AE I+ EW S     D 
Sbjct  300  AGLLDKDNVYRMWNKLKATFRKMSDMEFKCMLSSLTKLGDIEEAERIYKEWESVSGTQDS  359

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N+LL  YV+    E+AE FL  I++ GVKP+  TWE+LA G++ + R+ + L CLK+
Sbjct  360  RLPNILLAFYVKNDMMEKAEKFLMHIVETGVKPSYTTWELLASGNLHKNRMDKVLDCLKK  419

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P    + + F   E   + E  E  + +L+ AG +  E Y S + T
Sbjct  420  ALSS--LEKWDPNVGLVKAVFTELEAMGNVEDAENFLVILRDAGYVTTEIYNSLLRT  474



>ref|XP_002273904.2| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, 
mitochondrial [Vitis vinifera]
Length=968

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 107/170 (63%), Gaps = 2/170 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK EV+RIWN+YK+   F  N+ Y ++++SLL+LDD++ AE  F+EWLS    +D 
Sbjct  757  ATMGNKTEVYRIWNLYKTIGKFF-NTGYVAMVSSLLKLDDMDGAEKTFEEWLSGNKFFDF  815

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLL+  Y +KG  E+AE  +++ I+ G +P   TW+ LA G+ +  ++ +A+  LK+
Sbjct  816  RVPNLLIRAYCKKGLLEKAEQLVSRAIEQGEEPIAVTWDALAAGYHENNQMEKAVDTLKK  875

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPED  214
            A  A  S+ W+P P T+S+  +  + + D E  E LI +L++   +   D
Sbjct  876  ALLA-TSQGWKPNPVTLSACLEYLKGKGDVEEAENLIRLLREQSLVSAYD  924


 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 96/164 (59%), Gaps = 4/164 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  G+K+E++R+WN+YK ++ +    +Y  +I  L +LDD+E AE IF EW    + YD 
Sbjct  276  ARTGHKQELYRVWNLYKPSYEY--PEAYSCMITCLTKLDDIEGAEKIFQEWECECTMYDF  333

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LL  Y ++  F++AE  + ++I+  + P   TW ILA G+++++++ +A+  LK+
Sbjct  334  RVLNRLLSAYCKRCLFDKAESLVNKVIEERM-PYASTWNILAKGYVEDKQMPKAVEMLKK  392

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A S  G K WRP    + +  +  E + + E  E +  + K  G
Sbjct  393  AISV-GRKGWRPNSIILDACIEYLEGQGNLEEIEEIARLCKNLG  435



>ref|XP_002520753.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF41715.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=551

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 104/175 (59%), Gaps = 2/175 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V RIWN  KS F  + ++ Y  +++SL++L+++E AEN++ EW S     DP+V
Sbjct  289  MGDKDAVHRIWNKMKSLFCKMNDAEYTCMLSSLIKLEEIEKAENLYTEWESVSGTGDPQV  348

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            AN+LL  Y+ + Q E +E F  ++++ GV P   TWE+L  GH+K +++ + L C K+A 
Sbjct  349  ANILLAAYINRNQIEDSENFYRRMVEKGVCPCYTTWELLTWGHLKTKQMEKVLDCFKKAI  408

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +    K W P    +   FK+ E + + E  E  + +L+ AG +  E Y S + T
Sbjct  409  TI--VKTWSPDKRLVREVFKILEEKGNAEGAEEFLVMLRNAGYVSTEIYNSLLRT  461



>ref|XP_010918492.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Elaeis guineensis]
Length=517

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 101/177 (57%), Gaps = 1/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A VGNK+EV R+WN  K+    + N+ Y  +I++LL+LDD+E AE I  EW      YD 
Sbjct  299  ADVGNKDEVHRVWNSCKAREK-LSNTIYMCMISALLKLDDIEGAEAILKEWEIRFDFYDF  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLL+  Y RKG   +AE  + Q I++G  P   TW+ LA G+ +E +  +A+  +K+
Sbjct  358  RVPNLLIGAYCRKGLLGKAESLVGQAIESGRTPLANTWDRLAGGYFREGQTLKAVEMMKK  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A    G   W+P PA + +  +    + D E+ E  +++L+  G L  E+Y+  + T
Sbjct  418  ALQMTGQTVWKPNPANVLASLEYFRDQKDVEAAEEFVKMLRHLGLLTKENYLCLLRT  474



>ref|XP_006838525.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
 gb|ERN01094.1| hypothetical protein AMTR_s00002p00190720 [Amborella trichopoda]
Length=390

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 2/176 (1%)
 Frame = -3

Query  666  FPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANLLLVCYVRKGQFERA  487
             PF    + +  +    ++ DVE AE  + EW + K +YDPR+ N L+  YVR G  ++A
Sbjct  196  LPFNEMMNLYMSLGEYNKVGDVEGAEEFYKEWEAIKVKYDPRITNFLMASYVRGGLLKKA  255

Query  486  EGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAEGSKNWRPWPATISS  307
            E    +    G   NP TWEILA+G+ ++R I +AL CL EA S +  + W P P  + +
Sbjct  256  EELFERASRNGGTANPSTWEILAEGYTRDREIGKALHCLNEAASVKRFRRWAPKPVNVEA  315

Query  306  FFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT--PNGSNTNNEPDTWEED  145
              K+CE   D E+ E  +E+++   CL+   Y S + T    G + N+   + E+D
Sbjct  316  VMKVCEETGDVENVEQFVELMRSLKCLNAGTYKSLVKTYAKAGKSVNDVILSMEKD  371



>ref|XP_008796719.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Phoenix dactylifera]
Length=515

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 101/168 (60%), Gaps = 4/168 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K+E+ R+WN YK+    + NS Y  +I++LL+LDD+E AE I  EW +  + YD 
Sbjct  297  ADIGSKDELHRVWNAYKAR-ERLSNSMYMCMISALLKLDDIEGAEAILKEWETRCNFYDF  355

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLL+  Y RKG   +AE  ++Q+I++G  P   TW+ LA G+ +E +  +A+  +K+
Sbjct  356  RVPNLLIGAYCRKGLLGKAESLVSQVIESGRTPFANTWDRLAGGYFREGQPLKAVEMMKK  415

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHP  220
            A    G   W+P PA + +  +    + D E+ E  +++L+   CL P
Sbjct  416  ALQLTGQTRWKPNPANVLASLEYFRDQKDVEAAEKFVKMLR---CLVP  460



>gb|KDO68752.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis]
Length=415

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 101/176 (57%), Gaps = 4/176 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G K+EV RIW    S F  + ++ Y  +I+SL++L + E AENI+DEW S     DPRV
Sbjct  197  MGYKDEVLRIWKKMMSLFAKMNDAEYTCVISSLVKLGEFEKAENIYDEWESISGTGDPRV  256

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+LL  Y+ + Q E AE F  +++  G+KP   TWE+L  G++K+ ++ + L C K+A 
Sbjct  257  PNILLAAYINRNQLEMAESFYNRLVTKGIKPCYTTWELLTWGYLKKGQMEKVLECFKKAI  316

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            GS    + W P    I++ +   E + D +  E L+  L+ AG +  E Y S + T
Sbjct  317  GSV---RKWVPDHRLITAAYNKLEEQGDIDGAEHLLVTLRNAGHVSTEIYNSLLRT  369



>ref|XP_008790994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Phoenix dactylifera]
Length=533

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 98/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + +KE V+RIWN  KS F  + +  Y  I++SL +L D+E+AE+I+ EW S     D 
Sbjct  313  ASLSDKENVYRIWNKIKSTFRKMSDVEYKCILSSLTKLGDIEEAESIYSEWESVSGTRDS  372

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL  Y++    ++AE F    +  GVKP+  TWE+LA  ++ ++RI + L CLK 
Sbjct  373  RVPNILLGYYIKNDMMDKAENFHEHTVQTGVKPSYTTWELLAWSYLSKKRIDKVLHCLKN  432

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S    + W P    I + F   E+  D E  E  + +L+  G +  E Y S + T
Sbjct  433  AFSI--LEKWEPNVGIIRAVFSKLEMMGDVEGAEQFLVMLRDVGYVTTEIYNSLLRT  487



>ref|XP_006444085.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 ref|XP_006479730.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Citrus sinensis]
 gb|ESR57325.1| hypothetical protein CICLE_v10019771mg [Citrus clementina]
 gb|KDO68751.1| hypothetical protein CISIN_1g010458mg [Citrus sinensis]
Length=510

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 101/176 (57%), Gaps = 4/176 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G K+EV RIW    S F  + ++ Y  +I+SL++L + E AENI+DEW S     DPRV
Sbjct  292  MGYKDEVLRIWKKMMSLFAKMNDAEYTCVISSLVKLGEFEKAENIYDEWESISGTGDPRV  351

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+LL  Y+ + Q E AE F  +++  G+KP   TWE+L  G++K+ ++ + L C K+A 
Sbjct  352  PNILLAAYINRNQLEMAESFYNRLVTKGIKPCYTTWELLTWGYLKKGQMEKVLECFKKAI  411

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            GS    + W P    I++ +   E + D +  E L+  L+ AG +  E Y S + T
Sbjct  412  GSV---RKWVPDHRLITAAYNKLEEQGDIDGAEHLLVTLRNAGHVSTEIYNSLLRT  464



>ref|XP_002324293.2| hypothetical protein POPTR_0018s05820g [Populus trichocarpa]
 gb|EEF02858.2| hypothetical protein POPTR_0018s05820g [Populus trichocarpa]
Length=490

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GN  EV+RIW   +  FP   N SY ++I  L+ L DV  AE  F EW S  S YD RVA
Sbjct  278  GNLLEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDVPGAEKCFREWESGCSTYDIRVA  337

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA--  361
            N+L+  Y ++G  ++AE    +    G KPN KTWEI  D ++K   I  A+ CL +A  
Sbjct  338  NVLISAYAKEGMLDKAEELKERACRRGAKPNAKTWEIFLDYYLKNEDIKVAVDCLAKAVS  397

Query  360  -GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
             G   G K W P P  + S     E + D +  E LIE+LK+A
Sbjct  398  TGRGNGQK-WVPSPVIVGSLMAHFEQQKDVDGAEGLIEILKKA  439



>ref|XP_002517926.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44444.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=504

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 108/191 (57%), Gaps = 3/191 (2%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GNK EV+RIWN YK    F  NS Y  +I+SLL+LDD++ AE IF+EW S K  +D R+ 
Sbjct  296  GNKAEVYRIWNKYKEIGRFF-NSGYICMISSLLKLDDIDGAERIFEEWDSKKVLFDIRIP  354

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGS  355
            N ++  Y RKG  E+AE ++ +I+ +G +P+  +W  LA G+    ++++A+  +++A S
Sbjct  355  NSMVNVYSRKGHLEKAETYINKIVASGEEPDATSWNHLAAGYHSSGQMTKAVETIRKAIS  414

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNGSN-  178
                  W+P   T+S+  +  + + D E+ E L+++ K+  C     Y       +  N 
Sbjct  415  VS-KPGWKPSLLTLSACLEFLKGQGDAETLEELLKIAKEHCCFSAGAYAKLSSCIDNENL  473

Query  177  TNNEPDTWEED  145
            T    D  EED
Sbjct  474  TTIALDQMEED  484



>gb|KDP24141.1| hypothetical protein JCGZ_25798 [Jatropha curcas]
Length=416

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 110/200 (55%), Gaps = 5/200 (3%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             G K+E++R+WN YKS +  +    +  +I SL +LDD+E AE I +EW S  + YD RV
Sbjct  215  TGKKDELYRVWNKYKSLYG-LRTIVFCCMIESLSKLDDIEGAEQILEEWESKCTVYDFRV  273

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N LLV Y +KG FERAE  + +    G KP   TW ILA G+ +E ++S+A+  LK A 
Sbjct  274  LNSLLVAYCKKGLFERAEAAVEKAAQ-GRKPYASTWTILATGYAQENQMSKAVEMLKRAI  332

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY--VSQIPTPNG  184
                 K W+P P  +++     EV+ D E  E +++ LK    L  + Y  + +     G
Sbjct  333  LV-SRKGWKPNPTILTACLDYLEVQGDVEEMEEIVKSLKSLEPLTRDLYHRLKRTYIAAG  391

Query  183  SNTNNEPDTWEEDSFLDNND  124
             +T +  D  ++D+F  + D
Sbjct  392  KSTTDVLDQMKKDNFPADED  411



>ref|XP_002527905.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34462.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=490

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GN  E++RIW   +  FP   N SY ++I  L+ L D+  AE  F EW S  S YD RV
Sbjct  277  IGNLHELYRIWRSLRLAFPKTSNISYLNMIQVLVNLKDLPGAEKCFREWESNCSGYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y +KG  E+AE    + I  G KPN KTWEI +D + +   I  ++ CL  A 
Sbjct  337  ANVLIKAYAKKGLLEKAEELKERAIGRGAKPNAKTWEIFSDYYFENGDIKLSVECLANAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P P  ++SF    E + D +  E  IE+LK+A
Sbjct  397  SKGRGDGQK-WIPSPEVVASFMAHFEQQKDVDGAEGFIEILKKA  439



>ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Vitis vinifera]
Length=504

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 98/176 (56%), Gaps = 1/176 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K E+ R+W   K+    + N  Y +++ SL++L ++ED E +  EW S+ + YD 
Sbjct  289  ASLGSKAEMMRLWERRKTASKKLINRDYITMLGSLVKLGELEDTEALLKEWESSGNCYDF  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LL+ + +KG  E+AE  L  I++ G  P P +W I+A G+I+++ + +A  C+KE
Sbjct  349  RVPNTLLIGFCQKGLIEKAESMLRDIVEEGKTPTPNSWSIVAAGYIEKQNMEKAFECMKE  408

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A +    +K WRP P  ISS         D E  E  +  LK    +  E Y +QI
Sbjct  409  AIAVLAENKGWRPKPKVISSILSWLGDNRDVEEVETFVSALKAVIPMDREMYHAQI  464



>gb|KCW49953.1| hypothetical protein EUGRSUZ_K03412 [Eucalyptus grandis]
Length=470

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V RIW    S FP + ++ Y  +I+S+++L D+++AE ++ EW S     DPRV
Sbjct  262  MGDKDGVHRIWKKMNSLFPKMNDAEYTCMISSVVKLGDLKEAEKLYTEWESVSKTGDPRV  321

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+LL  +V  GQ E AE F  +I   GV P   TWE+L  G++KE+++ +AL  L +A 
Sbjct  322  ANILLAAHVNDGQMEMAEKFYERIAKNGVAPCYTTWELLTWGYLKEKQMDKALYYLNKAI  381

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            GS E   NW+     I+  F+  +   + E  E L+ +L+ AG +  E Y S + T
Sbjct  382  GSVE---NWKFDRKLIAELFENLQERGNVEGAEELLVILRNAGHVSTEVYNSLLQT  434



>gb|KDP24137.1| hypothetical protein JCGZ_25794 [Jatropha curcas]
Length=475

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 106/188 (56%), Gaps = 14/188 (7%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  GNK EV+RIWN+YK N  F  N  Y  +I SL++LDD+  AE I++EW + K  +D 
Sbjct  289  AAAGNKAEVYRIWNLYKKNGGFF-NLGYQRMINSLVKLDDIAGAERIWEEWYAWKMFFDI  347

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL++  Y +KG  E+AE  + +II++G++P+  +W  +A G+ +  ++SEA+  +K+
Sbjct  348  RIPNLMIEAYCKKGLLEKAEALINKIIESGIEPDGVSWNHMAAGYYEGGQMSEAIEAIKK  407

Query  363  AGSAEGSKNWRPWPATISSF------FKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQ  202
            A S       +  P   +SF       K    + D E+ E L++++K+ GC     Y   
Sbjct  408  AIS-------QSKPGRKASFHNVEVCLKYLNGQGDVEAAEELLKMIKENGCYSAGVYDKL  460

Query  201  IPTPNGSN  178
            +   N  N
Sbjct  461  LDCVNKEN  468



>ref|XP_011077261.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Sesamum indicum]
Length=493

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 95/164 (58%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+R+W   K  F    N SY ++I  L+ L+D+  AE  F EW SA S YD R+
Sbjct  280  TGNLLEVYRVWRSLKLAFTKTANLSYLNMIQVLVNLNDLPGAEKCFREWSSACSTYDIRI  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            AN+L+  Y+R+  FE+A+    Q+   G+KPN KTWE+  D ++K+  I  A++C+ +A 
Sbjct  340  ANVLIGAYLREDSFEKAQNLKDQVRRRGIKPNAKTWELYLDYYLKKGEIKSAVNCVDKAT  399

Query  357  SA---EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
            +A   +G K W P PA I    +  E   D +  E  +++LK++
Sbjct  400  AASRGDGGK-WTPSPAVIEKLMQHFEQNKDVKGAEGFLDILKKS  442



>ref|XP_011029463.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like isoform X2 [Populus euphratica]
Length=409

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+E+ R+W + K+N     N  Y +I+ SL++L  +E+AE +  +W S+   YD 
Sbjct  195  ASLGNKDEMMRLWELAKANCKKQLNRDYITILGSLVKLGHLEEAEKLLQDWESSCQYYDF  254

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N++L+ Y RKG  E+AE  L  II+     NP +W I++ G++ ++ + +AL C+KE
Sbjct  255  RVPNVVLIGYSRKGLPEKAEAMLQDIIEKQKMKNPSSWSIISAGYMDKQNMEKALECMKE  314

Query  363  AGSAEG-SKNWRPWPATISSFF  301
            A +A+  +K WRP PA IS+  
Sbjct  315  ALAADTENKGWRPKPAMISNIL  336



>emb|CBI20322.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 98/176 (56%), Gaps = 1/176 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K E+ R+W   K+    + N  Y +++ SL++L ++ED E +  EW S+ + YD 
Sbjct  289  ASLGSKAEMMRLWERRKTASKKLINRDYITMLGSLVKLGELEDTEALLKEWESSGNCYDF  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LL+ + +KG  E+AE  L  I++ G  P P +W I+A G+I+++ + +A  C+KE
Sbjct  349  RVPNTLLIGFCQKGLIEKAESMLRDIVEEGKTPTPNSWSIVAAGYIEKQNMEKAFECMKE  408

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A +    +K WRP P  ISS         D E  E  +  LK    +  E Y +QI
Sbjct  409  AIAVLAENKGWRPKPKVISSILSWLGDNRDVEEVETFVSALKAVIPMDREMYHAQI  464



>ref|XP_011043458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011043459.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011043460.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
Length=490

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 87/163 (53%), Gaps = 4/163 (2%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GN  EV+RIW   +  FP   N SY ++I  L+ L DV  AE  F EW S    YD RVA
Sbjct  278  GNLLEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDVPGAEKCFREWESGCLTYDIRVA  337

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA--  361
            N+L+  Y ++G  ++AE    +    G KPN KTWEI  D ++K   I  A+ CL +A  
Sbjct  338  NVLISAYAKEGMLDKAEELKERAHRRGAKPNAKTWEIFLDYYLKNEDIKVAVDCLAKAVS  397

Query  360  -GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
             G   G K W P P  + S     E + D +  E LIE+LK+A
Sbjct  398  TGRGNGQK-WVPSPVIVGSLMAHFEQQKDVDGAEGLIEILKKA  439



>ref|XP_010038139.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Eucalyptus grandis]
Length=516

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V RIW    S FP + ++ Y  +I+S+++L D+++AE ++ EW S     DPRV
Sbjct  298  MGDKDGVHRIWKKMNSLFPKMNDAEYTCMISSVVKLGDLKEAEKLYTEWESVSKTGDPRV  357

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+LL  +V  GQ E AE F  +I   GV P   TWE+L  G++KE+++ +AL  L +A 
Sbjct  358  ANILLAAHVNDGQMEMAEKFYERIAKNGVAPCYTTWELLTWGYLKEKQMDKALYYLNKAI  417

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            GS E   NW+     I+  F+  +   + E  E L+ +L+ AG +  E Y S + T
Sbjct  418  GSVE---NWKFDRKLIAELFENLQERGNVEGAEELLVILRNAGHVSTEVYNSLLQT  470



>gb|KDP21467.1| hypothetical protein JCGZ_21938 [Jatropha curcas]
Length=515

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 100/177 (56%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK+ + RIWN  KS F  + ++ Y  +I+SL++L+++E AE ++ EW S     DP
Sbjct  295  TSMGNKDGLHRIWNKMKSLFRKMNDAEYICMISSLVKLEEIEKAEKLYSEWESVSGTCDP  354

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            +V+N+LL  Y+ + + E AE F  +++  G++P   TWE+L  GH+K++++   L   K+
Sbjct  355  QVSNILLAAYINRNRMEEAEKFQQRMVQKGIRPCYTTWELLTWGHLKDKQMENVLDYFKK  414

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   K W      +   FK  E   D E  E  + +L+ AG +  E Y S + T
Sbjct  415  AISS--VKKWSLDKRLVGEIFKNLEERGDVEGAEEFLVMLRNAGHVSTEIYNSLLRT  469



>ref|XP_011029462.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like isoform X1 [Populus euphratica]
Length=500

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+E+ R+W + K+N     N  Y +I+ SL++L  +E+AE +  +W S+   YD 
Sbjct  286  ASLGNKDEMMRLWELAKANCKKQLNRDYITILGSLVKLGHLEEAEKLLQDWESSCQYYDF  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N++L+ Y RKG  E+AE  L  II+     NP +W I++ G++ ++ + +AL C+KE
Sbjct  346  RVPNVVLIGYSRKGLPEKAEAMLQDIIEKQKMKNPSSWSIISAGYMDKQNMEKALECMKE  405

Query  363  AGSAEG-SKNWRPWPATISSFF  301
            A +A+  +K WRP PA IS+  
Sbjct  406  ALAADTENKGWRPKPAMISNIL  427



>ref|XP_002316903.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa]
 gb|EEE97515.2| hypothetical protein POPTR_0011s12150g [Populus trichocarpa]
Length=500

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 88/142 (62%), Gaps = 1/142 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+E+ R+W + K+N     N  Y +I+ SL++L  +E+AE +  +W S+   YD 
Sbjct  286  ASLGNKDEMMRLWELAKANCKKQLNRDYITILGSLVKLGHLEEAEKLLQDWESSCQYYDF  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N++L+ Y RKG  E+AE  L  II+     NP +W I++ G++ ++ + +A  C+KE
Sbjct  346  RVPNVVLIGYSRKGLPEKAEAMLQDIIEKQKMKNPSSWSIISAGYMDKQNMEKAFECMKE  405

Query  363  AGSAEGSKN-WRPWPATISSFF  301
            A +AE   N WRP PA IS+  
Sbjct  406  ALAAETENNGWRPKPAMISNIL  427



>ref|XP_010255941.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Nelumbo nucifera]
Length=513

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 99/177 (56%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G+KE V+RIW   KS F  + ++ Y  +IASL++L ++++AEN++ EW       D 
Sbjct  292  TSMGDKEGVYRIWKKIKSTFHKMNDAEYTCLIASLVKLGELKEAENVYAEWEVVSGTGDS  351

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  Y+ +GQ ++AE F  +++  G+ P+  TWE+ A G++K +++ + L   K+
Sbjct  352  RIPNLLLAAYINQGQMDKAEKFCERMVQKGITPSYTTWELFAWGYLKMKKMDKVLDYFKK  411

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A   E  K W P    +   F   E E +    E  + +L+ AG +  + Y S + T
Sbjct  412  A--IESVKEWDPTDRIVREVFDNLEKEGNIAGAEQFLVILRSAGYVTTQIYNSLLRT  466



>ref|NP_001176989.1| Os12g0531500 [Oryza sativa Japonica Group]
 dbj|BAH95717.1| Os12g0531500 [Oryza sativa Japonica Group]
Length=352

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 92/167 (55%), Gaps = 2/167 (1%)
 Frame = -3

Query  693  RIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANLLLVCY  514
            R+W   +  F    ++ Y  ++ SL R  D+ +AE+ + EW SA    D R+ N +L  Y
Sbjct  142  RVWRKMRETFRKFSDTEYKCMLTSLTRFGDIAEAESFYSEWESASGTRDSRIPNTILAFY  201

Query  513  VRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAEGSKNW  334
            ++ G  E+AEGFL  I+  GVKP+  TWE+   G++ + R+ + L CLK+A S    + W
Sbjct  202  IKNGMMEKAEGFLDHIVQKGVKPSYSTWELFVWGYLSDGRMDKVLECLKKALSC--LEKW  259

Query  333  RPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
             P P   ++ +   E + D E+ E L+ + ++AG +  E Y S + T
Sbjct  260  DPNPQLATAIYSQIEEKGDIEAAEKLLVMFREAGYVTTEIYNSVLRT  306



>ref|XP_002267979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Vitis vinifera]
Length=489

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 85/162 (52%), Gaps = 4/162 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GN  EV+R+W   +  FP   N SY ++I  L+ L D+  AE  F EW S  S YD RV
Sbjct  276  IGNLLEVYRVWRSLRLAFPKTANVSYLNMIQVLVNLKDLPGAEKCFREWESGCSIYDIRV  335

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN L+  Y + G  E+AE         G KPN KTWEI    H+K R + +A+ C+  A 
Sbjct  336  ANALIGAYAKDGLLEKAEELKEHARRRGAKPNAKTWEIFLAYHLKNREMKQAVDCVANAI  395

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
              G  +G K W P P  I  F +  E E D +  E  +E+LK
Sbjct  396  STGRGDGQK-WVPSPEIIGVFMQHFEQEKDVDGAEGFLEILK  436



>ref|XP_010272480.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=407

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 100/171 (58%), Gaps = 4/171 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + +G K+E++R+WN+YK +     NSSY  +I SL +LDD++ AE IF EW S  + YD 
Sbjct  193  SSMGRKDELYRVWNLYKLSGK--RNSSYCCMITSLAKLDDIKGAEMIFKEWESNCAFYDF  250

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LLV Y + G F++AE  L + +  G  P   TW ILA G+++ +++S+A+  LK+
Sbjct  251  RVLNRLLVAYCKNGLFDKAELVLQKAV-VGRTPYASTWNILAMGYVENKQMSKAVEMLKK  309

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A      + WRP  AT+ +     E + D E  E L+ + +  G L  + Y
Sbjct  310  AMLV-AREGWRPNLATLVACLDYLEEKRDVEGVEDLVRLFRATGPLSRDLY  359



>gb|EAY83341.1| hypothetical protein OsI_38557 [Oryza sativa Indica Group]
Length=444

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 97/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W   +  F    ++ Y  ++ SL R  D+ +AE+ + EW SA    D 
Sbjct  224  ASLSDRGNLDRVWRKMRETFRKFSDTEYKCMLTSLTRFGDIAEAESFYSEWESASGTRDS  283

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AEGFL  I+  GVKP+  TWE+   G++ + R+ + L CLK+
Sbjct  284  RIPNTILAFYIKNGMMEKAEGFLDHIVQKGVKPSYSTWELFVWGYLSDGRMDKVLECLKK  343

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S    + W P P   ++ +   E + D E+ E L+ + ++AG +  E Y S + T
Sbjct  344  ALSC--LEKWDPNPQLATAIYSQIEEKGDIEAAEKLLVMFREAGYVTTEIYNSVLRT  398



>ref|XP_010921943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Elaeis guineensis]
Length=521

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + + E V+R WN  KS F  + +  Y  I++SL +L D+E+AE+I+ EW       D 
Sbjct  301  ASLLDNENVYRTWNKMKSTFRKMSDVEYKCILSSLTKLGDIEEAESIYSEWEIVSGTRDS  360

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL  Y++    ++AE F   ++  GVKP+  TWE+LA G++ ++R+ + L CLK+
Sbjct  361  RVPNILLGYYIKNDMTDKAENFYEHMLQRGVKPSYTTWELLAWGYLSKKRVDKVLDCLKK  420

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P    + + F   E   D E  E  + +L+  G +  E Y S + T
Sbjct  421  AFSS--LEKWEPNVGIVRAVFTKLEEMGDVEGAEQFLVMLRDVGYVTTEIYNSLLQT  475



>gb|EAZ20702.1| hypothetical protein OsJ_36321 [Oryza sativa Japonica Group]
Length=491

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 97/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W   +  F    ++ Y  ++ SL R  D+ +AE+ + EW SA    D 
Sbjct  271  ASLSDRGNLDRVWRKMRETFRKFSDTEYKCMLTSLTRFGDIAEAESFYSEWESASGTRDS  330

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AEGFL  I+  GVKP+  TWE+   G++ + R+ + L CLK+
Sbjct  331  RIPNTILAFYIKNGMMEKAEGFLDHIVQKGVKPSYSTWELFVWGYLSDGRMDKVLECLKK  390

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S    + W P P   ++ +   E + D E+ E L+ + ++AG +  E Y S + T
Sbjct  391  ALSC--LEKWDPNPQLATAIYSQIEEKGDIEAAEKLLVMFREAGYVTTEIYNSVLRT  445



>ref|XP_009789509.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Nicotiana sylvestris]
Length=498

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 89/162 (55%), Gaps = 1/162 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNKEE+ R+W V K       N  Y +++ SL++L D+E AE +  EW S+   YD 
Sbjct  304  ANLGNKEEMLRLWGVQKIVCKKQINRDYITMLGSLVKLGDLETAEAMLKEWESSNHTYDF  363

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y + G  ++AE  L  II  G  P P +W I+A G++   ++ +A  CLKE
Sbjct  364  RVPNVLLIGYCQNGLVDKAEIMLQDIIKKGKTPIPNSWAIIAAGYLNTHKMEKAFECLKE  423

Query  363  AGSAEGSK-NWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            A +       WRP P  +S+  K    + DT  +E  +  LK
Sbjct  424  AIAVRAQNPGWRPKPHLVSTISKWLGDQHDTREQEAFLSSLK  465



>ref|XP_010682416.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Beta vulgaris subsp. vulgaris]
Length=490

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+R+W   +  FP  PN +Y ++I  L+ L D+  AE  F EW S+ + YD R+
Sbjct  277  TGNLLEVYRVWRSLRLTFPRTPNIAYLNMIQVLVNLKDIPGAEKCFSEWESSCTTYDIRI  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN L+  Y+++G  E+A+    +    G KPN +TWEI  D H+K+  I  A++C++ A 
Sbjct  337  ANSLIGYYIKEGFLEKAQELKQRAGGRGAKPNARTWEIFLDHHMKQGEIESAVNCVENAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G+K W P    ++   +L E + D +  E  +E++K+A
Sbjct  397  TTGRGDGTK-WVPKVEIVNGIMQLFEQKKDVDGAEGFMELVKKA  439



>ref|XP_010272479.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=502

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 100/171 (58%), Gaps = 4/171 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + +G K+E++R+WN+YK +     NSSY  +I SL +LDD++ AE IF EW S  + YD 
Sbjct  288  SSMGRKDELYRVWNLYKLSGK--RNSSYCCMITSLAKLDDIKGAEMIFKEWESNCAFYDF  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LLV Y + G F++AE  L + +  G  P   TW ILA G+++ +++S+A+  LK+
Sbjct  346  RVLNRLLVAYCKNGLFDKAELVLQKAV-VGRTPYASTWNILAMGYVENKQMSKAVEMLKK  404

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A      + WRP  AT+ +     E + D E  E L+ + +  G L  + Y
Sbjct  405  AMLV-AREGWRPNLATLVACLDYLEEKRDVEGVEDLVRLFRATGPLSRDLY  454



>ref|XP_009594138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nicotiana tomentosiformis]
Length=493

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGN  EV+R+W   +  FP   N SY ++I  L+ L+D+  AE  F EW S    YD RV
Sbjct  280  VGNLLEVYRVWRSLRLAFPRTANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRV  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++G  E+AE    +   +G KPN KTWEI  D +++   I  A+ C+ +A 
Sbjct  340  ANVLIGAYTKQGSLEKAEELKERARRSGAKPNAKTWEIFGDYYLQNGDIKSAVDCVDKAI  399

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P  A +  F    E   D +  E  +E+LK+A
Sbjct  400  STGRGDGGK-WVPSSAIVRKFMSHFEQNKDVDGAEHFMEILKKA  442



>gb|ABA99305.2| pentatricopeptide, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG94881.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=514

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 97/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W   +  F    ++ Y  ++ SL R  D+ +AE+ + EW SA    D 
Sbjct  294  ASLSDRGNLDRVWRKMRETFRKFSDTEYKCMLTSLTRFGDIAEAESFYSEWESASGTRDS  353

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AEGFL  I+  GVKP+  TWE+   G++ + R+ + L CLK+
Sbjct  354  RIPNTILAFYIKNGMMEKAEGFLDHIVQKGVKPSYSTWELFVWGYLSDGRMDKVLECLKK  413

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S    + W P P   ++ +   E + D E+ E L+ + ++AG +  E Y S + T
Sbjct  414  ALSC--LEKWDPNPQLATAIYSQIEEKGDIEAAEKLLVMFREAGYVTTEIYNSVLRT  468



>ref|XP_010245038.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nelumbo nucifera]
Length=489

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 88/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  E++R+W   +  FP   N SY ++I +L++L D+  AE  F EW S  S YD R+
Sbjct  276  TGNVIELYRVWRSLRLAFPKTANISYLNMIQALVKLKDLPGAEKCFKEWESGCSTYDIRI  335

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++G  E+AE    +    G KPN KTWEI  D ++K   +  A+ C+  A 
Sbjct  336  ANVLIGAYAKEGMLEKAEEVKQRSQRRGSKPNAKTWEIFMDYYLKNGEMKLAVDCVANAI  395

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P P  + S     E E D E  E  +E LK+A
Sbjct  396  STGRGDGGK-WSPSPEVVQSLMTHFEQERDVEGAEGFMETLKKA  438



>gb|KDP26635.1| hypothetical protein JCGZ_17793 [Jatropha curcas]
Length=490

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 90/164 (55%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +  FP   N SY ++I  L+ L D+  +E  F EW S+ S YD R+
Sbjct  277  IGKLLEVYRIWRSLRLAFPKTSNISYLNMIQVLVNLKDLPGSEKCFREWESSCSNYDIRI  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y + G  ERAE    +    G KPN KTWEI  D ++++  +  A+ C+  A 
Sbjct  337  VNVLIKAYAKDGLLERAEELKERACGRGAKPNAKTWEIFLDYYLEKGDVKLAVDCVANAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P P  + SF +  E + D +S E  IE+LK+A
Sbjct  397  SKGRGDGQK-WVPSPEIVMSFMEHFEQQKDVDSAEAFIEILKKA  439



>ref|XP_006350932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Solanum tuberosum]
Length=492

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGN  EV+R+W   +  FP   N SY ++I  L+ L+D+  AE  F EW S    YD R+
Sbjct  279  VGNLLEVYRVWRSLRLAFPRTANISYLNMIQVLVNLNDIPGAEKCFKEWESGCPTYDIRI  338

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++   E+AE    +   +G KPN KTWEI  D +++   I  A+ C+ +A 
Sbjct  339  ANVLIGVYTKQSSLEKAEQLKERARRSGAKPNAKTWEIFMDYYLQNGDIKSAIDCVDKAV  398

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +GSK W P  A ++ F    E   D    E  +E+LK+A
Sbjct  399  SIGRGDGSK-WFPSSAIVTKFMSHFEQNKDVAGAEHFVEILKKA  441



>gb|KEH19430.1| PPR containing plant-like protein [Medicago truncatula]
Length=409

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 99/182 (54%), Gaps = 1/182 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+ + R+W + K N     N  Y +++ SL++L D ++AE +  EW  + + YD 
Sbjct  195  ASLGNKKAMMRLWKLQKENCKKQLNREYITMLGSLVKLGDFDEAEKLLAEWEISTNSYDF  254

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y + G  E+AE  L  II+ G  P P +W I+A G++ +  + +A  C+K+
Sbjct  255  RVPNILLIGYSKNGLIEKAETMLQSIIEKGKNPIPNSWAIIAAGYVAKENMEKAFQCMKK  314

Query  363  AGSAE-GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN  187
            A S +  +K WRP    +SS         D +  E  +  LK A  ++ + Y+S I   +
Sbjct  315  AVSVQPKNKGWRPKIDVLSSILSWAINNRDIDEVEDFVNSLKNATSMNRDMYLSLIKMFD  374

Query  186  GS  181
             S
Sbjct  375  RS  376



>ref|XP_008345197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like, partial [Malus domestica]
Length=424

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 97/176 (55%), Gaps = 4/176 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G+KE V RIW   KS FP + ++ Y  +++SL++L   E+AE ++ EW S    +DP
Sbjct  204  TNIGDKEGVRRIWKKVKSLFPKMNDAEYTCMLSSLVKLKQFEEAEKLYTEWESVSGTHDP  263

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+ + Q  RAE F  +++   +KP   TWE+L  G+++++   + L   K+
Sbjct  264  RVSNILLAAYINEDQMRRAETFHNRMVQNDIKPCYSTWELLTWGYLQQKHTEKVLEYFKK  323

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A GS    K W P    I   F   + E D +  E L+  L+ AG +  E Y S I
Sbjct  324  AVGSV---KRWDPDKRLIGEVFNRLKEEGDIQGAEELLVFLRNAGHVSTEIYNSLI  376



>gb|KDO82308.1| hypothetical protein CISIN_1g011226mg [Citrus sinensis]
Length=353

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 90/164 (55%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+RIW   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RV
Sbjct  140  TGNLSEVYRIWRSLRLAFPNTANISYLNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRV  199

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++G+ E AE    +    G  PN KTWEI +D +++   +  A+ CL++A 
Sbjct  200  TNVMIGAYAKEGRLENAEELKERARRRGADPNAKTWEIFSDYYLRNGDMKLAVDCLEKAI  259

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +F +  E E D +  E  +E+LK+A
Sbjct  260  DTGRGDGGK-WVPSSETIRTFMRHFEQEKDVDGAEGFLEILKKA  302



>ref|XP_004290659.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=520

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 101/184 (55%), Gaps = 4/184 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K  V R+W   KS FP + ++ Y  +IASL++L  +E+AE ++ EW S    +DP
Sbjct  290  ANIGDKAGVQRVWKKLKSYFPKMNDAEYTCMIASLVKLKQIEEAEKLYTEWESVSGTHDP  349

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N++L  Y+ + Q + AE F ++++  GV P   TWE+L  G +K+    +AL   K+
Sbjct  350  RVSNIILAAYINRDQMDVAETFCSRMVQNGVTPCYSTWELLTWGFLKQEHTKKALEYFKK  409

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPN  187
            A GS    K W P    I+  F     E + E  E L+  L+ AG +  E Y S + T  
Sbjct  410  AVGSV---KKWDPHQRLIAEVFGRLNEEGNVEEAEELVVFLRNAGHVSAETYNSLLRTYA  466

Query  186  GSNT  175
             + T
Sbjct  467  QAGT  470



>ref|XP_009788488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Nicotiana sylvestris]
Length=493

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 88/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGN  EV+R+W+  +  FP   N SY ++I  L+ L+D+  AE  F EW S    YD RV
Sbjct  280  VGNLLEVYRVWHSLRLAFPRTANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRV  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++G  E+AE        +G KPN KTWEI  D +++   I  A+ C+ +A 
Sbjct  340  ANVLIGAYTKQGSLEKAEKLKEWARRSGAKPNAKTWEIFGDYYLQNGDIKSAVDCVDKAI  399

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P  A +  F    E   D +  E   E+LK+A
Sbjct  400  STGRGDGGK-WVPSSAIVRKFMSHFEQNKDVDGAEHFTEILKKA  442



>ref|XP_002442234.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
 gb|EES16072.1| hypothetical protein SORBIDRAFT_08g016710 [Sorghum bicolor]
Length=501

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 96/177 (54%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+WN  +  F    ++ Y  ++ SL R +D+  AE ++ EW SA    D 
Sbjct  281  ASLSDRGNLDRVWNKMRETFRKFSDTEYKCMLTSLTRFNDIAAAEGLYREWESASGTRDS  340

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AE FL QI++ GVKP+  TWE+   G++ + +  + L CLK+
Sbjct  341  RIPNTILSYYIKNGMIEKAESFLGQIVEKGVKPSYSTWELFIWGYLGDNKTDKVLECLKK  400

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P     ++ F   E   D E+ E L+ V + AG +  E Y S + T
Sbjct  401  ALSS--LEKWEPNHELATAIFSQVEKTGDIEAAEKLLVVFRDAGYVTTEMYNSVLRT  455



>ref|XP_008368855.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Malus domestica]
Length=511

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 97/174 (56%), Gaps = 4/174 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+KE V RIW   KS FP + ++ Y  +++SL++L   E+AE ++ EW S    +DPRV
Sbjct  293  IGDKEGVRRIWKKVKSLFPKMNDAEYTCMLSSLVKLKQFEEAEKLYTEWESVSGTHDPRV  352

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            +N+LL  Y+ + Q  RAE F  +++   +KP   TWE+L  G+++++   + L   K+A 
Sbjct  353  SNILLAAYINEDQMRRAETFHNRMVQNDIKPCYSTWELLTWGYLQQKHTEKVLEYFKKAV  412

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            GS    K W P    I   F   + E D +  E L+  L+ AG +  E Y S I
Sbjct  413  GSV---KRWDPDKRLIGEVFNRLKEEGDIQGAEELLVFLRNAGHVSTEIYNSLI  463



>gb|KDO82307.1| hypothetical protein CISIN_1g011226mg [Citrus sinensis]
Length=490

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 90/164 (55%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+RIW   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RV
Sbjct  277  TGNLSEVYRIWRSLRLAFPNTANISYLNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++G+ E AE    +    G  PN KTWEI +D +++   +  A+ CL++A 
Sbjct  337  TNVMIGAYAKEGRLENAEELKERARRRGADPNAKTWEIFSDYYLRNGDMKLAVDCLEKAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +F +  E E D +  E  +E+LK+A
Sbjct  397  DTGRGDGGK-WVPSSETIRTFMRHFEQEKDVDGAEGFLEILKKA  439



>emb|CDP14775.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+EV R+WN+YK     I N SY  +I+ LL+LDD++ A+ + DEWL+ K  +D 
Sbjct  324  ATMGRKDEVLRLWNLYKKPRK-IYNRSYFCVISCLLKLDDLDGADKMLDEWLANKEYFDI  382

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ +LL+  + +KG  ERAE  +++++D+G +P   TW  +A G+ K  ++   +   K+
Sbjct  383  RIPDLLVTAFCKKGHIERAESIISRLVDSGNEPTASTWSRMAQGYYKTNQMENTVEMTKK  442

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
            + +A G   W P    ++S  +  + + D +  E ++ +LK+
Sbjct  443  SIAA-GVAGWEPDLPVLASCLRYLKKKGDIDGAEEMLRLLKR  483



>ref|XP_009401682.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Musa acuminata subsp. malaccensis]
Length=546

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 110/200 (55%), Gaps = 4/200 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K E++R+WN+YKS+   +  S Y  ++ +LL+LDDVE AE I  EW S    +D R+
Sbjct  302  IGDKSEMYRVWNMYKSSDK-VATSMYMCMMGALLKLDDVEGAEAILKEWESVTYFHDFRL  360

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NLLL  Y  +G  E+AE  + + I++G+ P    W+ LA  +    +  +A+  +K+A 
Sbjct  361  PNLLLGAYCTRGLLEKAELLVNKAIESGLAPYANAWDRLASLYFDCGQNLKAVEAMKKA-  419

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY--VSQIPTPNG  184
             AEG   W+P PA++    +  + +   E  E ++++LK+ G L  E Y  +  I    G
Sbjct  420  LAEGQAPWKPNPASVMRTLEYMKEQKGVEEAEGIVKLLKRHGPLTQEIYNCLLTIYMRAG  479

Query  183  SNTNNEPDTWEEDSFLDNND  124
             +T +  +   ED F  + D
Sbjct  480  KSTTDLLEQMAEDGFRADED  499



>ref|XP_009368491.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=481

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 102/175 (58%), Gaps = 3/175 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            AG+GNK+EV+RIW +YKS   F  N+ Y  +++SL+ +DD + AE I +EW S    +D 
Sbjct  297  AGIGNKDEVYRIWGLYKSIVGFY-NNGYRCMLSSLMNMDDFDGAEKILEEWESGNQSFDI  355

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            ++ NLL+  Y  KG  E+A+ +  ++ D G K + +TW +LA G+    +++EA+  LK 
Sbjct  356  QIPNLLINAYCGKGLLEKAKSWANKLSDGG-KEDCRTWSLLATGYCTNGQMTEAVESLKT  414

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A +      W+    T+++ F+  + + D E    ++ +L++ G L P D   +I
Sbjct  415  AANMACQPGWKFHNLTVAACFEYLKEKGDVEVAHKILGLLRERGHL-PTDLCDRI  468



>ref|XP_011037317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Populus euphratica]
Length=501

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 102/160 (64%), Gaps = 2/160 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGNKE+V+R+WN+YKS    + NSSY  +I+SLL+LDDV+ AE I+ EW+S    +D R+
Sbjct  289  VGNKEQVYRVWNLYKSKGRSL-NSSYLCMISSLLKLDDVDGAERIWGEWVSIVKFFDIRI  347

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NL++  Y +KG +E+AE F+ +I+ +G+K    T + LA G+    ++ +A   +K+A 
Sbjct  348  PNLMVSTYSKKGIWEKAEAFVGKIVASGIKIEASTLDRLATGYHVGGQMLKASETIKKAI  407

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
            S      W+P   T+++  +  + + D +  E L+++LK+
Sbjct  408  SI-SQPGWKPNVYTLAACLEYLKGQGDVKKVEDLLQILKE  446



>ref|XP_006355517.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Solanum tuberosum]
Length=499

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 102/198 (52%), Gaps = 4/198 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              + NK+EVFRIW   KS F  + ++ Y  II+ LL+LD+  +A N++ EW +     D 
Sbjct  279  TNLQNKDEVFRIWKEMKSIFRKVNDTEYSCIISLLLKLDEFGEAMNLYTEWEAVSVTKDT  338

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL+L  Y+ K + E+A  F  +++  G+ P+  TWE+L  G++K++ + + L   K+
Sbjct  339  RIANLILAAYINKNEMEKAVNFHNKMMQKGISPSCTTWELLTRGYLKQKEMDKVLEVFKK  398

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
              +      W P    +   + + E + D +  E L+  L+ A  ++ E Y + + T   
Sbjct  399  --TVTSVSKWDPDAKMVREMYHVVEEQGDIQVAEQLLVTLRHAKYVNTEIYNALLRTY--  454

Query  183  SNTNNEPDTWEEDSFLDN  130
             N    P   EE    DN
Sbjct  455  VNAGKMPMIVEERMKKDN  472



>ref|XP_008451368.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Cucumis melo]
Length=531

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 101/178 (57%), Gaps = 4/178 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K EV RIW   KS+F  + +S Y  +++SL++L+++E+AE ++ EW S     D 
Sbjct  299  ANLGDKNEVHRIWKKLKSSFRKMSDSEYMCMVSSLVKLNELEEAEKLYTEWESVSGTRDT  358

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R++N++L  Y+ K Q E+AE F  ++   G+ P+  TWE+L  G++KE ++ + L   K 
Sbjct  359  RISNVMLAAYINKNQMEQAESFYNRMSLKGIVPSYTTWELLTWGYLKENQMEKVLHFFKN  418

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A GS    K W      +    K  E + + E  E L+ +L+ AG +  E Y S + T
Sbjct  419  AVGSV---KKWNADERLVKGVCKKLEEQGNIEGVEQLLVILRNAGHVDTEIYNSLLRT  473



>ref|XP_006878583.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
 gb|ERM94728.1| hypothetical protein AMTR_s00011p00250030 [Amborella trichopoda]
Length=413

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 96/175 (55%), Gaps = 3/175 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V+RIW   K  F  + +S Y  ++ SL++L D+E AEN+F EW S     D RV
Sbjct  196  LGSKD-VYRIWKKMKLTFRKLNDSEYTCMLVSLVKLGDIEGAENVFSEWESVSGTRDSRV  254

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            +N+LL  YVR    E+AE F    ++ G  P+  TWE LA G+++E++I  AL  LK A 
Sbjct  255  SNVLLSAYVRNDMSEKAEEFHKCTVERGTIPSYTTWETLAWGYLREKKIVMALDSLKNAV  314

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            S+   K W P    +  F K  E   DTE+ E  + +L+    +    Y S + T
Sbjct  315  SS--VKKWEPNRGLVREFSKTLEESGDTENAENFLLLLRDVNYVSTAIYNSVLRT  367



>ref|XP_011014138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011014139.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
 ref|XP_011014140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Populus euphratica]
Length=490

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 86/163 (53%), Gaps = 4/163 (2%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            G   EV+RIW   +  FP   N SY ++I  L+ L DV  AE  F EW S  S YD RVA
Sbjct  278  GKLLEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDVPGAEKCFREWESGCSTYDIRVA  337

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK---E  364
            N+++  Y ++G  ++AE    +    G KPN KTWEI  D ++K   +  A+ CL     
Sbjct  338  NVIISAYTKEGLVDKAEELKERARRRGAKPNCKTWEIFCDYYLKNGDVKLAVDCLANAVS  397

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
            AG   G K W P P  + S     E + D +  E LIE+LK+A
Sbjct  398  AGRGNGQK-WVPSPVILGSLMAHFEQQKDVDGAEDLIEILKKA  439



>gb|AFK47046.1| unknown [Lotus japonicus]
Length=496

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 111/198 (56%), Gaps = 3/198 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+R+WN  K N     NSSY  +++SLL+LDD + AE I  EW S    +D 
Sbjct  287  AAIGNKDEVYRLWNRIK-NLQNCWNSSYICMLSSLLKLDDFDGAEKILAEWESEHKNFDT  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL++  Y ++G  ++AE ++ +++D+G K +  +W+ +A G+  +  + +A+  +K+
Sbjct  346  RIPNLMITAYCKRGLLDKAEAYIQKLLDSGKKLDGSSWDRMAAGYHMDNDMEKAVQTMKK  405

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A  A     WRP P+T+ +     + + D ES   ++++ K+ G +    Y   +   +G
Sbjct  406  AILA-NRPGWRPSPSTLVACITYLKEKLDLESALEILKLCKEDGHIKITTYDGLVSYAHG  464

Query  183  SNTNNEP-DTWEEDSFLD  133
               + E  D  + D  +D
Sbjct  465  EIPDKEALDLMKRDYQMD  482



>gb|EPS60165.1| hypothetical protein M569_14638, partial [Genlisea aurea]
Length=505

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 87/164 (53%), Gaps = 2/164 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + N +EV R+W   KS +  + +  Y  +I SL +L  +E+AE ++ EW +     DP
Sbjct  285  ASLRNGDEVLRLWTKMKSLYRKLHDEEYRCMIDSLSKLRRLEEAERVYAEWEAVSPTKDP  344

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLLL  YV  GQ ERAE F  +  D GVKP+  TWEILA G+++   +S AL   + 
Sbjct  345  RIPNLLLAAYVNDGQIERAEEFSRRTADGGVKPSYATWEILARGYVRRGMLSRALESFRA  404

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A      + W P    +    +L E   D  + E ++  L++ G
Sbjct  405  A--VRSVRRWDPDEELVRGMLELIEDRGDVGAAEEMVAALRRGG  446



>ref|XP_004243349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Solanum lycopersicum]
Length=493

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 96/169 (57%), Gaps = 2/169 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK++V+RIWN YK       NSSYH +I  L +LDD++ AE IF EW + +  +D 
Sbjct  299  TSMGNKDDVYRIWNKYKQKVKR-HNSSYHCMIRGLEKLDDLDGAEKIFAEWETNRVHFDI  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  Y +KG  E+A   + Q+  +G  PN  +W  LA G+  +  + +A+  +K+
Sbjct  358  RIPNLLISAYCKKGHMEKAISLIGQLEASGKHPNGSSWNRLALGYCVQNDMDKAVETMKK  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
            A  A     W+P   +++S  K  + + DT+ +E L ++L+  G    E
Sbjct  418  AILA-SKPGWKPHFHSLASCVKYLQSKGDTQGEEELKDLLRVRGLCSKE  465



>ref|XP_008337472.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial [Malus domestica]
 ref|XP_008367878.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=504

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 103/172 (60%), Gaps = 5/172 (3%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYK-SNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYD  547
            A  GNKEE++R+W+ YK SN P   +  Y  +I+SL +LDD+E AE IF+EW S    YD
Sbjct  296  ASTGNKEELYRVWDTYKPSNEPV--DVPYGCMISSLAKLDDIEGAEGIFEEWESQCKIYD  353

Query  546  PRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK  367
             RV N LLV Y ++G F++AE  + + ++  + P   TW +LA G+ +++++ +A+  LK
Sbjct  354  FRVLNRLLVAYCKRGLFDKAESVVNKAVEGRI-PYASTWNVLAIGYTEKQQMPKAVEMLK  412

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            +A S  G + W P   T+++     E + D E  E +I +LK  G L  + Y
Sbjct  413  KALSV-GRRGWVPHSPTLTACLDYLEGQGDIEGIEEIIXLLKNLGPLSEDLY  463



>ref|XP_010693618.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=528

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 94/171 (55%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             G+G K  V + W   KS F  + +  Y  +IASL++L ++E AE  ++EW S  +  D 
Sbjct  308  TGLGKKTGVHKTWKNMKSLFHKLNDVEYLCMIASLVKLGELETAEKFYNEWESVSTTGDT  367

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLL+  Y++  Q ++A  F  +    G+KP+  TWE+L  G++K ++I   L C ++
Sbjct  368  RVPNLLIGAYLKTNQMDKATKFFDRFTQKGIKPSYTTWELLTFGYLKLKQIDRVLDCFEK  427

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A ++   + W P    I   +KL E ++D +  E ++ VL+  G +  E Y
Sbjct  428  AVTS--VRKWEPNLTFIKEVYKLLEEQEDIKGAEKMLSVLRNVGYVTTEIY  476



>ref|XP_010241951.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial [Nelumbo nucifera]
Length=506

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 91/166 (55%), Gaps = 3/166 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A VGNK EV R+W + K+      N  Y +++ SL++LD  E+AE + +EW S+ + YD 
Sbjct  289  ASVGNKNEVIRLWCLEKAACKRYINRDYITMLGSLMKLDAFEEAEKLLEEWESSGNCYDF  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N +LV Y +KG  E+AE  L  I   G  P P +W I+A G+  +  I + + C+K+
Sbjct  349  RVPNTVLVGYCQKGLSEKAETLLKSIETRGKTPIPNSWVIVAVGYEGKGEIEKTMECMKK  408

Query  363  AGSAE---GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
            A S     G++NWRP P  I         E D +S E  + +L+  
Sbjct  409  ALSLSLQVGNENWRPNPKVIKCILNWLGDEGDVKSAEAFVSLLRMV  454



>ref|XP_004301350.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Fragaria vesca subsp. vesca]
 ref|XP_011464631.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 87/160 (54%), Gaps = 0/160 (0%)
 Frame = -3

Query  711  NKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVAN  532
            +KE+V R+W   K     IP+++Y  I+ SL++L D+ +AE IF EW S   RYD RV+N
Sbjct  339  SKEDVLRLWGASKGVAGRIPSTNYMHIVLSLVKLGDIMEAERIFREWESNCFRYDVRVSN  398

Query  531  LLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSA  352
            +LL  Y+R G  E+AE      +D G  PN KTWEIL +G +K + +  A+  +K+  + 
Sbjct  399  VLLGAYMRNGMVEKAESLHKYALDRGGCPNYKTWEILMEGRLKNQNMDGAVEAMKQGFAM  458

Query  351  EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
                +WRP   T+ +F    E     E     I V+   G
Sbjct  459  LQDCHWRPSDDTVMAFADYFERHGKFEDANWYIRVIHNLG  498



>ref|XP_009357845.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=505

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYK-SNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYD  547
            A  GNKEE++R+W+ YK SN P   +  Y  +I++L +LDD+E AE IF+EW S    YD
Sbjct  297  ASTGNKEELYRVWDTYKPSNEPV--DVPYGCMISALAKLDDIEGAEGIFEEWESQCKIYD  354

Query  546  PRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK  367
             RV N LLV Y ++G F++AE  + +  +  + P   TW +LA G+ +++++ +A+  LK
Sbjct  355  FRVLNRLLVAYCKRGLFDKAESVVNKATEGRI-PYASTWNVLAIGYTEKQQMPKAVEMLK  413

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            +A S  G + W     T+++     E + D E  E +I +LK  G L  + Y
Sbjct  414  KALSV-GRRGWVLHSPTLTACLDYLEGQGDIEGIEEIISLLKNLGPLSEDLY  464



>ref|XP_007050629.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX94786.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=513

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 4/174 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V RIW   KS F  + ++ Y  +I+SL++L D E+AE +++EW S     D RV
Sbjct  296  MGDKDGVQRIWKKMKSCFRKMNDAEYTCMISSLVKLGDFEEAEILYNEWESVSGSADARV  355

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+LL  Y+ + + E AE F  +I+  G+ P   TWE+L  G++K +RI + L C + A 
Sbjct  356  PNILLAAYINQERMEIAEDFYERIVQKGISPCYTTWELLTWGYLKNQRIEKVLDCFERAV  415

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            GS    + W P    +   FK  E   +TE  E L+ +L+ AG +  + Y S +
Sbjct  416  GSV---RKWNPNDRLVGEVFKKLEELGNTEGVEKLLVILRNAGHVSTKVYNSLL  466



>ref|XP_007226594.1| hypothetical protein PRUPE_ppa023558mg [Prunus persica]
 gb|EMJ27793.1| hypothetical protein PRUPE_ppa023558mg [Prunus persica]
Length=407

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 86/160 (54%), Gaps = 0/160 (0%)
 Frame = -3

Query  708  KEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANL  529
            KE+V R+W   K+    IP ++Y  I+  L++L D+ +AE IF EW S   RYD R++N+
Sbjct  201  KEDVLRLWEASKAVPGRIPCTNYMHILLCLVKLGDIVEAERIFMEWESTCFRYDVRISNV  260

Query  528  LLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAE  349
            LL  Y+R G  E+AE      +  G  PN KTWEIL +G +K + I +A+  ++   S  
Sbjct  261  LLGAYMRNGMVEKAESLHLHSLQRGGYPNYKTWEILMEGWLKSQYIDKAIEAMQRGFSML  320

Query  348  GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGC  229
               +WRP   TI +F    E   + E     + V+   GC
Sbjct  321  QDCHWRPSHDTIMAFSGYFERHGNIEDANWYVRVIHDLGC  360



>gb|KEH20176.1| PPR containing plant protein [Medicago truncatula]
Length=490

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 85/164 (52%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+R+W   +  FP   N SY ++I  L+ L D+  AE  F EW S+ + YD RV
Sbjct  277  IGKVYEVYRVWRSLRLAFPKTANISYLNMIQVLVNLKDLPGAEKCFREWESSCTTYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y +    E+AE    +    G KPN KTWEI  D H++      A+ CL EA 
Sbjct  337  ANVLIGTYAKLDMLEKAEELKERARRRGAKPNAKTWEIFLDHHLRNADFKLAVDCLSEAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G   G K W P   TI    K  E E D +  E  IE+LK++
Sbjct  397  SIGRGNGEK-WVPSSETIGIMMKHYEQEKDVDGAEEFIEILKKS  439



>ref|XP_004962880.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Setaria italica]
Length=510

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 94/177 (53%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+WN  K  F    ++ Y  ++ SL R DD+ +A NI+ EW  A    D 
Sbjct  290  ANLSDRGNLDRVWNKMKQTFRKFSDTEYKCMLTSLTRFDDIAEAMNIYREWELASGTRDS  349

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AE FL+ I++  VKP+  TWE+   G++   R  + L CLK+
Sbjct  350  RIPNTILSHYIKNGMIEKAESFLSHIVEKRVKPSYSTWELFVWGYLGNNRTDKVLECLKK  409

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P     ++ F   E   D E+ E L+ + + AG +  E Y S + T
Sbjct  410  ALSS--LEKWEPNHKLATAIFSQVEKMGDIETAEKLLVMFRDAGYVTTEMYNSVLRT  464



>ref|XP_004148903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004158945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Cucumis sativus]
 gb|KGN44819.1| hypothetical protein Csa_7G390000 [Cucumis sativus]
Length=531

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 99/175 (57%), Gaps = 2/175 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K EV+RIW   KS+F  + +  Y  +I+SL++L+++E+AE ++ EW S     D RV
Sbjct  301  LGDKNEVYRIWKKLKSSFRKMSDREYMCMISSLVKLNELEEAEKLYTEWESVSGTRDTRV  360

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            +N++L  Y++K Q E+AE F  +++  G  P+  TWE+L  G++KE ++ + L   ++A 
Sbjct  361  SNVMLGAYIKKNQIEQAESFYNRMLQKGTVPSYTTWELLTWGYLKENQMEKVLHFFRKA-  419

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
                 K W      +    K  E + +    E L+ +L+ AG +  E Y S + T
Sbjct  420  -VNRVKKWNADERLVKGVCKKLEEQGNINGVEQLLLILRNAGHVDTEIYNSLLRT  473



>gb|KHG24373.1| hypothetical protein F383_30483 [Gossypium arboreum]
Length=516

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 96/173 (55%), Gaps = 2/173 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V RIW   KS F  + ++ Y  +I++L++L D E AE +++EW S     D RV
Sbjct  299  MGDKDGVQRIWKKMKSCFRKMNDTEYTCMISTLVKLGDFEKAEKLYNEWESVSGSGDARV  358

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y+   + + AE F  QI+  G+ P   TWE+L  G++K++++ + L C K+A 
Sbjct  359  PNILLAAYINGDKMDVAENFYQQIVQKGISPCYTTWELLTWGYLKKQQMEKVLDCFKQAV  418

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
             +   K W P    +   F   E   DTE  E L+ +L+ AG +  + Y S +
Sbjct  419  CS--VKKWNPNEKLVREVFNKLEDLGDTEDAEKLLVILRDAGHVSTKVYNSLL  469



>gb|EMT17732.1| hypothetical protein F775_09007 [Aegilops tauschii]
Length=510

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 96/178 (54%), Gaps = 3/178 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W+  K  F    ++ Y  ++ SL R  D+  AE ++ EW S     D 
Sbjct  289  ASLSDRGNLDRVWSKMKQTFRKFSDAEYKCMLTSLTRFGDIAAAECVYGEWESESGTKDS  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHI-KERRISEALSCLK  367
            R+ N +L  Y++ G+ E+AE FL  I+  GVKP+  TWE+   G++    R  + + CLK
Sbjct  349  RIPNTILSFYIKNGKMEKAESFLQHIVQKGVKPSYSTWELFVWGYLGNNERTDKVMECLK  408

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +A S+   + W P P  +++ F   E   D E+ E L+ VL++AG +  E Y S + T
Sbjct  409  KALSS--LEKWEPNPQLVTALFSQIEKRGDIEAAEELLVVLREAGYVTTEIYNSVLRT  464



>ref|XP_008219370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Prunus mume]
Length=508

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 85/160 (53%), Gaps = 0/160 (0%)
 Frame = -3

Query  708  KEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANL  529
            KE+V R+W   K+    IP ++Y  I+  L++L D+ +AE IF EW     RYD R++N+
Sbjct  302  KEDVLRLWEASKAVPGRIPCTNYMHILLCLVKLGDIVEAERIFTEWEFTCFRYDVRISNV  361

Query  528  LLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSAE  349
            LL  Y+R G  E+AE      +  G  PN KTWEIL +G +K + I +A+  +K   S  
Sbjct  362  LLGAYMRNGMVEKAESLHLHTLQRGGHPNYKTWEILMEGWLKSQNIDKAIEAMKRGFSML  421

Query  348  GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGC  229
               +WRP   TI +F    E   + E     + V+   GC
Sbjct  422  QDCHWRPSDDTIMAFAGYFERHGNIEDANWYVRVIHVLGC  461



>ref|XP_004508130.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Cicer arietinum]
Length=490

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 85/164 (52%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+R+W   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RV
Sbjct  277  IGKTYEVYRVWRSLRLAFPKTANISYLNMIQVLVNLKDLPGAEKCFREWESTCTTYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN L+  Y +    E+AE    +    G KPN KTWEI  D H+++  +  A+ CL EA 
Sbjct  337  ANALIGAYTKLDMLEKAEELKERARRRGAKPNAKTWEIFLDCHLRKGDLKLAVDCLTEAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G   G K W P   TI    +  E E D +  E  IE+LK++
Sbjct  397  SIGRGNGEK-WVPSSETIGIMMRHYEQEKDVDGAEEFIEILKKS  439



>ref|XP_006438303.1| hypothetical protein CICLE_v10031342mg [Citrus clementina]
 gb|ESR51543.1| hypothetical protein CICLE_v10031342mg [Citrus clementina]
Length=490

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+RIW   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RV
Sbjct  277  TGNLSEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++ + E AE    +    G  PN KTWEI +D +++   +  A+ CL++A 
Sbjct  337  TNVMIGAYAKESRLENAEELKERARRRGANPNAKTWEIFSDYYLRNGDMKLAVDCLEKAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +F +  E E D +  E  +E+LK+A
Sbjct  397  DTGRGDGGK-WVPSSETIRTFMRHFEQEKDVDGAEGFLEILKKA  439



>ref|XP_006483923.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Citrus sinensis]
Length=490

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+RIW   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RV
Sbjct  277  TGNLSEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDLPGAEKCFKEWESGCATYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++ + E AE    +    G  PN KTWEI +D +++   +  A+ CL++A 
Sbjct  337  TNVMIGAYAKESRLENAEELKERARRRGANPNAKTWEIFSDYYLRNGDMKLAVDCLEKAI  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +F +  E E D +  E  +E+LK+A
Sbjct  397  DTGRGDGGK-WVPSSETIRTFMRHFEQEKDVDGAEGFLEILKKA  439



>ref|XP_008446176.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Cucumis melo]
Length=491

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 95/183 (52%), Gaps = 5/183 (3%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+  +V+ +W   +  FP   N SY ++I +LL+L D+  AE  F EW S  S YD R+
Sbjct  278  IGDLIKVYSVWRSLRLAFPRTANISYLNMIQTLLKLKDLPGAEKCFKEWESGCSTYDIRI  337

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN L+  Y ++G  E+A     + +  G +PN KTWEI  D ++K      A  C+ +A 
Sbjct  338  ANALIGAYTKEGLLEKAMALKERALKRGARPNAKTWEIFLDYYLKNGNFKLAGDCVAKAV  397

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ-AGCLHPEDYVSQIPTP  190
              G  +G K W P P  I SF    E E D +  E  +E++K+    L  E + S I T 
Sbjct  398  SRGKGDGGK-WMPSPEIIKSFMSHFEQEKDVDGAESFLEIVKKTVDSLESEVFESLIRTY  456

Query  189  NGS  181
            + +
Sbjct  457  SAA  459



>ref|XP_004249932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Solanum lycopersicum]
Length=492

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 88/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VG   EV+R+W   +  FP   N SY ++I  L+ L+D+  AE  F EW S    YD R+
Sbjct  279  VGTLLEVYRVWRSLRLAFPRTANISYLNMIQVLVNLNDLPGAEKCFKEWESGCPTYDIRI  338

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++   E+AE    +   +G KPN KTWEI  D +++   I  A+ C+ +A 
Sbjct  339  ANVLIGAYTKQSSLEKAEQLKERARRSGAKPNAKTWEIFMDYYLQSGDIKSAIDCVDKAV  398

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +GSK W P  A ++ F    +   D    E  +E+LK+A
Sbjct  399  SIGRGDGSK-WFPSSAIVTKFMSHFKQHKDVAGAEHFVEMLKKA  441



>ref|XP_010237220.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Brachypodium distachyon]
Length=514

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 97/178 (54%), Gaps = 3/178 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W+  +  F    ++ Y  ++ SL R  D+  AE+++ EW S     D 
Sbjct  294  ASLSDRGNLDRVWSKMREIFRKFSDTEYKCMLTSLTRFGDITAAESVYSEWESESGTRDS  353

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHI-KERRISEALSCLK  367
            R+ N +L  +++ G+ E AE FL  I+  GVKP+  TWE+   G++  + RI + L CLK
Sbjct  354  RIPNTILSFHIKNGKMEMAESFLQHIMQKGVKPSYSTWELFVWGYLGNDERIDKILECLK  413

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +A S+     W P P  +++ F L E   D E+ E L+ VL+ AG +  E Y S + T
Sbjct  414  KALSS--LDKWEPNPQLVAALFSLIEKRGDIEAAEELLVVLRGAGYVTTEIYNSVLRT  469



>emb|CAN64701.1| hypothetical protein VITISV_037299 [Vitis vinifera]
Length=1111

 Score =   110 bits (275),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 57/168 (34%), Positives = 98/168 (58%), Gaps = 4/168 (2%)
 Frame = -3

Query  711  NKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVAN  532
            +K+ V RIW   KS F  + ++ Y  +I+SL++L + E+AEN++ EW S     D RV N
Sbjct  311  DKDGVHRIWKKLKSIFHKMNDAEYTCMISSLVKLGEFEEAENLYSEWTSVSPTGDSRVPN  370

Query  531  LLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-GS  355
            +LL  Y+ K + E AE F  Q+++ G+ P+  TWE+L  G++K++++ + L   ++A GS
Sbjct  371  ILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLKKKQMEKVLDYFEKAVGS  430

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
                K W P    +   +K  E + + E  E ++ +L++AG +  E Y
Sbjct  431  V---KKWNPDEKLVREVYKNLEEQGNIEGAEKVLVILRKAGHVSTEIY  475



>ref|XP_007198830.1| hypothetical protein PRUPE_ppa006648mg [Prunus persica]
 gb|EMJ00029.1| hypothetical protein PRUPE_ppa006648mg [Prunus persica]
Length=401

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 102/174 (59%), Gaps = 8/174 (5%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYK-SNFPF-IPNSSYHSIIASLLRLDDVEDAENIFDEWLS-AKSR  553
            A  G+K E++R+WN YK SN P  +P   Y  +I+SL +LDD+E AE IF+EW S     
Sbjct  196  ANTGHKGELYRVWNTYKQSNEPMDVP---YGCMISSLAKLDDIEGAERIFEEWESRCTEY  252

Query  552  YDPRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSC  373
            YD RV N LLV Y +KG F++AE  + + ++  V P   TW  LA G+ + +++ +A+  
Sbjct  253  YDFRVLNRLLVAYCKKGLFDKAESAVKKAVEGRV-PYASTWNALAIGYTESKQMPKAIET  311

Query  372  LKEAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            LK+A S +  + W P  +T+++     E + D E  E +I +LK  G L  + Y
Sbjct  312  LKKALSVD-RRGWVPDSSTLTACLDYLEGQGDFEGIEEIISLLKNLGPLSRDLY  364



>ref|XP_002527601.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF34782.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=502

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 92/161 (57%), Gaps = 1/161 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+EV R+W + K+      N  Y +++ +L++L+++E+A+ +  EW S+   YD 
Sbjct  287  ASLGIKDEVMRLWGLVKTKCKKQVNRDYITMLGALVKLEELEEADKLLQEWESSCQCYDF  346

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y ++G  E+AE  L  I+     P P +W I+A G++ ++ + +A +C+KE
Sbjct  347  RVPNVLLIGYCQQGLIEKAEAMLKDIVKKQKNPTPNSWAIIAAGYVNKQNMEKAFNCMKE  406

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVL  244
            A + +  +K WRP    ISS         D E  E  + +L
Sbjct  407  ALTVQAENKGWRPKANLISSILSWLGENGDVEDVEAFVNLL  447



>ref|XP_011037319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X2 [Populus euphratica]
Length=376

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 102/165 (62%), Gaps = 5/165 (3%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GNK+ V+R+WN YK N   I NS+Y  +I+SL+RL D++ AE I +EW+S K+ YD R+ 
Sbjct  209  GNKDGVYRVWNSYK-NTGRIFNSTYICMISSLMRLGDIDGAEWISEEWVSRKTLYDIRIP  267

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGS  355
            N ++  Y RKG +++AE ++ +I+++G++    +W+ LA G+    ++++A+  LK+A S
Sbjct  268  NTMIRAYSRKGLWKKAEEYVNKIVESGMQLEASSWDHLATGYNFGGQMAKAVETLKKAIS  327

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHP  220
                  W+P P T+ +     E + D E+ E   E+LK     HP
Sbjct  328  I-SKPGWKPNPYTLKTCLWYLESKGDEEAAE---ELLKFVSEHHP  368



>ref|XP_006381714.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ABK95769.1| unknown [Populus trichocarpa]
 gb|ERP59511.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=490

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            G   EV+RIW   +  FP   N SY ++I  L+ L DV  AE  F EW S  S YD RVA
Sbjct  278  GKLIEVYRIWRSLRLAFPKTANISYLNMIQVLVNLKDVPGAEKCFREWESGCSTYDIRVA  337

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK---E  364
            N+++  Y ++G  ++AE    +    G KPN KTWEI  D ++K   +   + C+     
Sbjct  338  NVVISAYAKEGLVDKAEELKERARRRGAKPNSKTWEIFCDYYLKNGDVKLGVDCIANAVS  397

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
            AG   G K W P P  + S     E + D +  E LIE+LK+A
Sbjct  398  AGRGNGQK-WVPSPVIVGSLMAHFEQQKDVDGAEDLIEILKKA  439



>emb|CDP14776.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 101/173 (58%), Gaps = 7/173 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K+EV RIW++YK       N  +H +I+SL+ L+D+++AE IF EW S  + YD 
Sbjct  292  ASLGDKDEVTRIWHLYKKRGNMTNNGYFH-MISSLIWLEDIDEAEKIFQEWESVNTSYDF  350

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N L+  Y +KG  +RAE F+ + I+ G K    TW+ LA G+ K+ ++ +A+  +K 
Sbjct  351  RIPNTLINAYTKKGLLQRAEEFINRAINCGRKIPASTWDYLATGYYKDNQMEKAVDAMKN  410

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKE---LLIE---VLKQAGCLH  223
            A  +    +W     T++S  +  + + D E ++   LL +   VL+Q  CLH
Sbjct  411  AIFSWKGTSWTLNRTTLTSCLEYLKEKGDAEKEKFERLLADQGIVLEQVSCLH  463



>gb|EMS62788.1| hypothetical protein TRIUR3_25805 [Triticum urartu]
Length=503

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 96/178 (54%), Gaps = 3/178 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W+  +  F    ++ Y  ++ SL R  D+  AE ++ EW S     D 
Sbjct  282  ASLSDRGNLDRVWSKMRQTFRKFSDAEYKCMLTSLTRFGDIAAAECVYGEWESESGTKDS  341

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHI-KERRISEALSCLK  367
            R+ N +L  Y++ G  E+AE FL  I+  GVKP+  TWE+   G++  + R ++ + CLK
Sbjct  342  RIPNTILSFYIKNGNMEKAESFLQYIVQKGVKPSYSTWELFVWGYLGNDERTAKVMECLK  401

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +A S+   + W P P  +++ F   E   D E+ E L+ VL+ AG +  E Y S + T
Sbjct  402  KALSS--LEKWEPNPQLVAALFSQIEKRGDIEAAEELLVVLRDAGYVTTEIYNSVLRT  457



>ref|XP_008387199.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=207

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 90/169 (53%), Gaps = 2/169 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+ V R+W +YK +   I N  Y SII S+L++ D+E AE I+DEW S     D 
Sbjct  5    AALGQKDSVMRLWELYKKHLK-IYNRGYISIITSVLKVGDIESAEKIYDEWESKNLTPDI  63

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N L+  Y +KG  ++AE  + +I+  G KP+ KTW  LA G++   +  + +  +++
Sbjct  64   RIPNFLISAYTKKGLVDKAESIINRIVLKGAKPDAKTWYYLAKGYLNHDQAEKTVESMRK  123

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
            A S      W P    +++  +  + + D E  E  I  L +  C  PE
Sbjct  124  ALSVVEGSRWTPDRDVVAACMEYMKQKADVEGAEEFIRQLVEK-CSFPE  171



>ref|XP_009757638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02370, 
mitochondrial-like [Nicotiana sylvestris]
Length=413

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 92/186 (49%), Gaps = 0/186 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            +G+ N  EV+RIWN  KS+F    NSSY  ++ SL +L+D++D +  + EW S  S YD 
Sbjct  201  SGISNLHEVYRIWNSLKSHFSITTNSSYLVMLQSLGKLNDIDDLKKCYKEWESCCSSYDM  260

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+AN ++  Y+R      AE      +     P    WE+     ++  +I+ A+ C++ 
Sbjct  261  RLANSVIGAYLRHDLLHDAEEVFRHALKRSQGPFFLAWEMFMAFFLRNHQINLAMKCMEA  320

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTPNG  184
            A S      W+P    I+ FF+    E D +  E   + LK+  CL  + Y S + T   
Sbjct  321  AASRVKKNEWQPKYEMINKFFEYFVEERDVDGAEEFYKYLKKLNCLSSDVYSSLLRTYIA  380

Query  183  SNTNNE  166
            +N   E
Sbjct  381  ANRTAE  386



>ref|XP_002307578.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE94574.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=513

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 97/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + +K+ + R WN  KS F  + ++ Y+ +I+SL++L +   AEN+++EW S  +  D 
Sbjct  291  ANMKDKDGLHRTWNKMKSVFNKMNDAEYNCMISSLVKLGEFGGAENLYNEWESVSATRDS  350

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N++L  Y+ + Q E AE F  +++  G+ P   TWE+L  GH+K  ++ + L   K+
Sbjct  351  RVSNIVLASYINRNQMEDAENFCQRMVQKGITPCYTTWELLTCGHLKTEQMEKVLENFKK  410

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A  +   + W P    I   FK  E   D E  E L+ +L+ AG +    Y S + T
Sbjct  411  ALCS--VRKWTPDKRLIGDIFKNLEERGDIEGAEKLLVILRDAGHVSTMIYNSLLRT  465



>ref|XP_009595568.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=502

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 87/162 (54%), Gaps = 1/162 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNKEE+ R+W V K       N  Y +++ SL++L D+E AE +  EW S+   YD 
Sbjct  304  ANLGNKEEMLRLWGVQKIVCKKQINRDYITMLGSLVKLGDLETAEAVLKEWESSNHTYDF  363

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+L++ Y +    ++AE  L  II  G  P P +W I+A G++    + +A  C+KE
Sbjct  364  RVPNVLVIGYCQNDLVDKAEIMLQDIIKKGKTPIPNSWAIIAAGYLNSDEMEKAFECMKE  423

Query  363  AGSAEGSK-NWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            A +       WRP P  +SS  K    + DT  +E  +  LK
Sbjct  424  AIAVRAQNPGWRPKPHLVSSVSKWLGDQQDTREQEAFLSSLK  465



>gb|KDP27040.1| hypothetical protein JCGZ_20975 [Jatropha curcas]
Length=506

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 93/176 (53%), Gaps = 1/176 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+E+ R+W + K+      N  Y +++ SL++L + E+AE +  EW S+   YD 
Sbjct  289  ASLGNKDEIIRLWGLSKAKCQKQFNRDYITMLGSLVKLGEFEEAEKLLQEWESSCETYDS  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y +KG  E+AE  L  I        P +W I+A+G++ ++ + +A  C+KE
Sbjct  349  RVPNVLLIGYCQKGLIEKAEAMLRDIGKRQKTVTPNSWSIMAEGYVNKQNMEKAFQCMKE  408

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A   A  +K WRP P  IS          D E  E  +  L+     + E Y + I
Sbjct  409  AVNVASENKGWRPKPNLISVILSWLGDNGDVEEVEAFVSSLETVVQKNREMYRTLI  464



>ref|XP_006664068.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Oryza brachyantha]
Length=510

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 96/177 (54%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W+  +  F    ++ Y  ++ SL R  D+ +AE+++ EW S     D 
Sbjct  290  ASLSDRGNLDRLWSKMRQLFRKFSDTEYKCMLTSLTRFGDIAEAESVYSEWESTSGTCDS  349

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N +L  Y++ G  E+AE FL  I+  GVKP+  TWE+   G++   R+   L CLK+
Sbjct  350  RIPNTILSFYIKNGMMEKAESFLNHIVQKGVKPSYSTWELFVWGYLSNDRMDNVLECLKK  409

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P P   ++ +   E + D E+ E L+ + ++AG +  E Y S + T
Sbjct  410  ALSS--LEKWDPNPQLATAIYSRIEEKADIEAAEKLLVMFREAGYVTTEMYNSVLRT  464



>ref|XP_010662166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X2 [Vitis vinifera]
Length=470

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 99/172 (58%), Gaps = 4/172 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              + +K+ V RIW   KS F  + ++ Y  +I+SL++L + E+AEN++ EW S     D 
Sbjct  248  TNMQDKDGVHRIWKKLKSIFHKMNDAEYTCMISSLVKLGEFEEAENLYSEWTSVSPTGDS  307

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL  Y+ K + E AE F  Q+++ G+ P+  TWE+L  G++K++++ + L   ++
Sbjct  308  RVPNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLKKKQMEKVLDYFEK  367

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A GS    K W P    +   +K  E + + E  E ++ +L++AG +  E Y
Sbjct  368  AVGSV---KKWNPDEKLVREVYKNLEEQGNIEGAEKVLVILRKAGHVSTEIY  416



>ref|XP_011032725.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
 ref|XP_011032726.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Populus euphratica]
Length=513

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 97/177 (55%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + +K+ + R WN  KS F  + ++ Y+ +I+SL++L +   AEN+++EW S  +  D 
Sbjct  291  ANMKDKDGLHRTWNKMKSVFNKMNDAEYNCMISSLVKLGEFGGAENLYNEWESVSATRDS  350

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N++L  Y+ + Q E AE F  +++  G+ P   TWE+L  GH+K  ++ + L   K+
Sbjct  351  RVSNIVLASYINRNQMEDAENFCQRMVQKGITPCYTTWELLTCGHLKTEQMEKVLENFKK  410

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A  +   + W P    I   FK  E   D E  E L+ +L+ AG +    Y S + T
Sbjct  411  ALCS--VRKWTPDKRLIGDIFKNLEERADIEGAEKLLVILRDAGHVSTMIYNSLLRT  465



>ref|XP_007211848.1| hypothetical protein PRUPE_ppa004720mg [Prunus persica]
 gb|EMJ13047.1| hypothetical protein PRUPE_ppa004720mg [Prunus persica]
Length=494

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 95/172 (55%), Gaps = 1/172 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+++ R+W++ K+      N  Y +++ SL++L ++E+ + + DEW  +   YD 
Sbjct  285  ASLGCKDDMMRLWSLEKTKCKKQINRDYITMLGSLVKLGELEETKKLLDEWELSCLSYDF  344

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y +KG  E+AE  L  I+  G  P P +W ILA G++ ++++ +A  C+ E
Sbjct  345  RVPNILLIGYCQKGLVEQAEDTLRDIVKKGKTPTPNSWAILAAGYVDKQKMQKAFECMTE  404

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A +    +  WRP P  +SS         D E  E  + ++K    ++ E Y
Sbjct  405  ALNLRARNTGWRPKPGVVSSVLSWIGDNGDIEQVEAFVSLMKTVITVNREMY  456



>emb|CDP17058.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 88/177 (50%), Gaps = 0/177 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A   N  EV RIW   +S+ P + N SY +++ +L +L+DV   +N F EW S  S YD 
Sbjct  295  ARTANIGEVHRIWKSLRSSLPTVTNLSYLTLLQALNKLNDVHGLQNCFQEWESTCSSYDI  354

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ANL +  Y+R    E AE      +     P     E+L   ++K R I  AL C++ 
Sbjct  355  RLANLAIGAYLRHDMAEDAESVFHSALKRSSGPFFVAREMLMMYYLKNRNIRLALQCMEA  414

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S      W+P   +I  F  +CE E D +S E   + LK+  CL+   Y S + T
Sbjct  415  AISELDGSEWQPKSDSICKFLTVCEEEKDVDSAEEFCKYLKKVNCLNHRGYKSLLQT  471



>ref|XP_004514343.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cicer arietinum]
Length=494

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 94/176 (53%), Gaps = 1/176 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK  + R+W + K N     N  Y +++  L+++ D+++ E +  EW  + + YD 
Sbjct  282  ASLGNKRAMMRLWKLQKVNCKKQLNREYITMLGCLVKIGDLDETEKLLLEWELSGNFYDF  341

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y ++G  E+AE  L  +ID    P P +W I+A G++ +  + +A  C+KE
Sbjct  342  RVPNILLIGYSKRGLVEKAETMLRSMIDKQKNPTPNSWAIIAAGYVAKENMEKAFQCMKE  401

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A + E  +K WRP    ISS         D +  E  +  LK    ++ + Y+S I
Sbjct  402  AMAVEAQNKGWRPKSNLISSILSWATNNRDLDEVEDFVNSLKTVISMNRDMYLSLI  457



>ref|XP_008338901.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g27460 [Malus domestica]
Length=509

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 89/164 (54%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + +KE+V R+W   K+    IP ++Y  I+  L++L D  +AE IF EW S    YD 
Sbjct  298  ASLNSKEDVLRLWKASKAVAGRIPCTNYMQILLCLVKLGDTVEAERIFMEWESNCFSYDI  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  E+AE      ++ G +PN KTWEIL +G +K + + +A+  +K+
Sbjct  358  RVSNVLLGAYMRNGMTEKAEALHLHTLERGGQPNYKTWEILMEGRLKSQNMDKAVEAMKK  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
                    +WRP   T+ +F    E   + E     I V++  G
Sbjct  418  GFCMLQDCHWRPSEETVMAFADYFEKHGNIEYANWYIRVIRSFG  461



>ref|XP_011037318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like isoform X1 [Populus euphratica]
Length=469

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 102/165 (62%), Gaps = 5/165 (3%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GNK+ V+R+WN YK N   I NS+Y  +I+SL+RL D++ AE I +EW+S K+ YD R+ 
Sbjct  302  GNKDGVYRVWNSYK-NTGRIFNSTYICMISSLMRLGDIDGAEWISEEWVSRKTLYDIRIP  360

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGS  355
            N ++  Y RKG +++AE ++ +I+++G++    +W+ LA G+    ++++A+  LK+A S
Sbjct  361  NTMIRAYSRKGLWKKAEEYVNKIVESGMQLEASSWDHLATGYNFGGQMAKAVETLKKAIS  420

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHP  220
                  W+P P T+ +     E + D E+ E   E+LK     HP
Sbjct  421  I-SKPGWKPNPYTLKTCLWYLESKGDEEAAE---ELLKFVSEHHP  461



>ref|XP_010266573.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
isoform X2 [Nelumbo nucifera]
Length=516

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 96/175 (55%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + + NKEEV R+W   KS    I  ++Y  I+  L+++  +E+AE +F  W S   +YD 
Sbjct  305  SALNNKEEVLRLWEASKSVAGKITCANYMCILLCLVKVGGIEEAEKVFRVWESQCVKYDI  364

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  ++AE      +  G  PN KTWEIL +G +K + + +A+  +K+
Sbjct  365  RVSNVLLGAYMRNGWMDKAESLHLHTLKKGGYPNYKTWEILMEGWLKSQEMDKAVEAMKK  424

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
              +     +WRP P  I S  +      D E+ +  ++V++Q G +  + Y S +
Sbjct  425  GFAMLKHCDWRPSPKIIMSISEYFVRHGDFENAKKYVKVIRQLGLMSLQLYKSLL  479



>ref|XP_010098672.1| hypothetical protein L484_026048 [Morus notabilis]
 gb|EXB75575.1| hypothetical protein L484_026048 [Morus notabilis]
Length=268

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 88/151 (58%), Gaps = 0/151 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NK+EV R+W   K+    I  ++Y  +++ L++L D+ +AE +F EW +++ +YD 
Sbjct  56   ASLKNKDEVLRLWEASKAVDGRITCANYMCVLSCLVKLSDLVEAERVFREWEASRGKYDV  115

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVR G  ++AE      ++ G  PN KTWEIL +G +K + + +A+  +K+
Sbjct  116  RVSNVLLGAYVRNGLMDKAESLHLHTMEQGGCPNYKTWEILMEGWVKSQEMEKAVDAMKK  175

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTE  271
            A S     +WRP    + +     E + D E
Sbjct  176  AFSMLRDCHWRPSDGIVLAIADYFEKKGDVE  206



>ref|XP_008339193.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g28020 [Malus domestica]
Length=900

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 97/177 (55%), Gaps = 3/177 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A VGNK EV RIW +YK    F  NS Y  +I+SL++LDD+E AE I +EW      +D 
Sbjct  223  AAVGNKHEVDRIWELYKDVVGFY-NSGYRCMISSLVKLDDIEGAEKIVEEWECGNKLFDI  281

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            +  NLL+  Y +KG  E+A  + A+    G K + +TW ILA G+    +++EA+  LK 
Sbjct  282  QTPNLLINAYCKKGLLEKARSY-AEKFSEGGKEDCRTWGILATGYHMNGQMAEAVETLKT  340

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S      W+   +T+S+ F     + D E+   L+ + ++ G L P D   +I +
Sbjct  341  AASLACRPGWKFDRSTVSACFDYLREKGDVEAAHELLRLFREMGHL-PTDLFDKIGS  396


 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 102/175 (58%), Gaps = 3/175 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+RIW +YKS   F  N+ Y  +++SL+++DD + AE I +EW S    +D 
Sbjct  716  AAIGNKDEVYRIWGLYKSIVGFY-NNGYRCMLSSLMKMDDFDGAEKILEEWESGNQSFDI  774

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            ++ NLL+  Y  KG  E+A+ +  ++ D G K + +TW +LA G+    +++EA+  LK 
Sbjct  775  QIPNLLINAYCGKGLLEKAKSWANKLSDGG-KEDCRTWSLLATGYCTNGQMAEAVESLKT  833

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
            A +      W+    T+++ F+  + + D E    ++ +L++ G L P D   ++
Sbjct  834  AANMACQPGWKFHNLTLAACFEYLKEKGDVEVAHKILGLLRERGHL-PTDLCDRV  887



>ref|XP_004240342.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial [Solanum lycopersicum]
Length=520

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 95/175 (54%), Gaps = 2/175 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            + +K+EVFRIW   KS F  + ++ Y  II+SLL+LD+  +A N++ EW +     D R+
Sbjct  302  LQSKDEVFRIWKEMKSLFRKVNDTEYSCIISSLLKLDEFGEAMNLYTEWEAGSVTKDTRI  361

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            ANL+L  Y+ + + E A  F  ++   G+ P+  TWE+L  G++K++ + + L   K+  
Sbjct  362  ANLILAAYINRSEMENAVDFHNRMAQKGITPSCTTWELLTRGYLKQKEMDKVLEFFKK--  419

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            +      W P    +   F + E + D +  E L+  L+ A  ++ E Y + + T
Sbjct  420  TVTSVSKWNPDAKMVRKMFHVVEEQGDIQMAEQLLVTLRHAKFVNTEIYNALLRT  474



>ref|XP_009778648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Nicotiana sylvestris]
Length=510

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 95/161 (59%), Gaps = 3/161 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NK+ V R+W    +    +  ++Y  I++SL++L D+ +AE IF EW S    YD 
Sbjct  299  ASLNNKDGVLRVWEASNAVNSQMTCANYMCILSSLVKLGDMREAERIFAEWESQCRTYDI  358

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  E+AE    + ++ G +PN KTWEIL +G I+ +++ +A+  LK 
Sbjct  359  RVSNILLGGYMRNGSVEKAESLHYRTLEKGGRPNSKTWEILVEGWIRSQQMDKAIDALKS  418

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
              +A    +WRP P+ + +   + E  ++T + E  +E LK
Sbjct  419  GLAALKHYDWRPSPSIVVA---IAEYFEETRNFENAMEFLK  456



>gb|AES60905.2| PPR containing plant protein [Medicago truncatula]
Length=512

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 95/171 (56%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GN +EV RIW   K+ F  + +  Y  +I+SL++L D    EN++ EW S     D 
Sbjct  292  ANMGNVDEVNRIWGKMKACFCKMSDDEYVCMISSLVKLGDFAGVENLYKEWESVSGTNDV  351

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+NLLL  YV +GQ E AE F  Q+++ GV  +  +WE+L  G++K++ + + L    +
Sbjct  352  RVSNLLLTSYVDQGQMEMAEIFCNQLVEKGVCLSYSSWELLTRGYLKKKDVKKFLHYFGK  411

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S+   K W P P  +   F + + +   E  E L+ +L+ AG ++   Y
Sbjct  412  AISS--VKQWIPDPRLVQEAFTVIQEQAHIEGAEQLLVILRNAGHVNTNIY  460



>gb|KJB50098.1| hypothetical protein B456_008G153900 [Gossypium raimondii]
Length=507

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 100/171 (58%), Gaps = 4/171 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G K++V+RIW +Y  N     NS Y  +I+SL++LDD++ AE I  EW S  S YD R+
Sbjct  296  LGRKDDVYRIWRLY-GNLGKFFNSGYLCMISSLVKLDDLDGAERILAEWESGYSYYDARI  354

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEI--LADGHIKERRISEALSCLKE  364
             N+++  Y R+G  ++AE +   +I+ GV   P  + +  LA G+  + ++S+A+  +K 
Sbjct  355  PNVMISAYCRRGFIKKAEAYTVSLIERGVIKEPDAFILNSLATGYQMDGQMSKAVETMK-  413

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A     S  W+P   T+++  K  E ED+ E+ + L+++L+  G L  + Y
Sbjct  414  AAILSSSSGWKPNLCTLAACLKFLEGEDNLEAAKELLQLLQVRGHLSNDVY  464



>ref|XP_010266564.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
isoform X1 [Nelumbo nucifera]
Length=560

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 96/175 (55%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + + NKEEV R+W   KS    I  ++Y  I+  L+++  +E+AE +F  W S   +YD 
Sbjct  349  SALNNKEEVLRLWEASKSVAGKITCANYMCILLCLVKVGGIEEAEKVFRVWESQCVKYDI  408

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  ++AE      +  G  PN KTWEIL +G +K + + +A+  +K+
Sbjct  409  RVSNVLLGAYMRNGWMDKAESLHLHTLKKGGYPNYKTWEILMEGWLKSQEMDKAVEAMKK  468

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
              +     +WRP P  I S  +      D E+ +  ++V++Q G +  + Y S +
Sbjct  469  GFAMLKHCDWRPSPKIIMSISEYFVRHGDFENAKKYVKVIRQLGLMSLQLYKSLL  523



>ref|XP_010662164.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 ref|XP_010662165.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial isoform X1 [Vitis vinifera]
 emb|CBI26594.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 99/170 (58%), Gaps = 4/170 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            + +K+ V RIW   KS F  + ++ Y  +I+SL++L + E+AEN++ EW S     D RV
Sbjct  309  MQDKDGVHRIWKKLKSIFHKMNDAEYTCMISSLVKLGEFEEAENLYSEWTSVSPTGDSRV  368

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+LL  Y+ K + E AE F  Q+++ G+ P+  TWE+L  G++K++++ + L   ++A 
Sbjct  369  PNILLAAYINKNEMEMAEKFYNQMVERGITPSYTTWELLTWGYLKKKQMEKVLDYFEKAV  428

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            GS    K W P    +   +K  E + + E  E ++ +L++AG +  E Y
Sbjct  429  GSV---KKWNPDEKLVREVYKNLEEQGNIEGAEKVLVILRKAGHVSTEIY  475



>gb|EPS60636.1| hypothetical protein M569_14165, partial [Genlisea aurea]
Length=485

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 90/160 (56%), Gaps = 5/160 (3%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  +V+R+W   K  FP   N SY ++I  L++L+D+  AEN F EW S  S  D R+
Sbjct  280  TGNLLQVYRVWRSLKLAFPNTANISYLNMIQVLVKLNDIPGAENCFKEWSSNCSTRDVRI  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
            AN+L+  Y+R+G FE+AE      +  G KPN KTWE   D ++ +  +  A+  + +A 
Sbjct  340  ANVLIGAYLREGLFEKAEK-----LRKGAKPNAKTWEHYLDYYLNKGDVGSAVDSMDKAA  394

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
            ++ G   + P P+ +    ++ E + D +  E  I+V+K+
Sbjct  395  TSAGGGKFVPSPSVVKRVMQIFEEKKDVDGAERFIKVVKK  434



>ref|XP_006348243.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like isoform X1 [Solanum tuberosum]
Length=507

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 86/160 (54%), Gaps = 1/160 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GNKEE+ R+W V+K       N  Y +++ SL++L ++E AE +  EW S+   YD RV
Sbjct  311  LGNKEEMLRLWGVHKVVCKKQINRDYITMLGSLVKLGELETAETVLKEWESSCRTYDFRV  370

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL+ Y +    ++AE  L  I+  G  P P +W I+A G++    + +A  C+KEA 
Sbjct  371  PNILLIGYCQSDLVDKAETMLQDIVKKGQTPIPNSWAIIAAGYLNMNNMEKAFECMKEAI  430

Query  357  SAEGSK-NWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            +  G    WRP P  +SS  K    + D    E  +  LK
Sbjct  431  AVRGQNPAWRPKPHLVSSISKWLGDQQDAREVEAFLSSLK  470



>ref|XP_007044736.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
 gb|EOY00568.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma 
cacao]
Length=491

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 88/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            VGN  EV+RIW   + +F    N S+ ++I  L+ L D+  AE  F EW S  S YD R+
Sbjct  278  VGNLLEVYRIWRSLRLSFHKTANVSFLNMIQVLVNLKDLPGAEKCFREWESGCSTYDIRI  337

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN L+  Y ++G  E+A+    +    GVKPN KTWEI  D ++K   I  A+ C+  A 
Sbjct  338  ANALIGAYAKEGLLEKAQELKERARKRGVKPNAKTWEIFLDYYLKNGDIKLAVDCVANAI  397

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +     E E D +  E  +E+LK+A
Sbjct  398  STGRGDGGK-WVPSSKTIGTVMWHFEQEKDVDGAEGFLEILKKA  440



>gb|KFK40762.1| hypothetical protein AALP_AA2G037700 [Arabis alpina]
Length=494

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L++L+DV  AE +F EW +  S YD R+
Sbjct  280  LGKLTEVYRIWRSLRLAIPKTTNVAYLNMIQVLVKLNDVPGAEALFKEWQANCSTYDIRI  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++G  E+A+    +    G KPN KTWEI  D ++K    ++AL C+ +A 
Sbjct  340  VNVMIGAYAKEGLIEKAKELREKAPRRGGKPNAKTWEIFMDYYVKSGNSTQALECISKAV  399

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +     E + D    E L+E+LK+ 
Sbjct  400  TIGKGDGGK-WLPSQETIRTLMSQFEKKKDVNGAENLVEILKKG  442



>ref|XP_006392119.1| hypothetical protein EUTSA_v10023426mg [Eutrema salsugineum]
 gb|ESQ29405.1| hypothetical protein EUTSA_v10023426mg [Eutrema salsugineum]
Length=491

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L+ L D+  AE +F EW +  S YD RV
Sbjct  277  LGKLTEVYRIWRSLRLAIPKTTNVAYLNMIQVLVNLKDLPGAETLFKEWQANCSTYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y ++G  E+A+    +    G KPN KTWEI  D ++K    ++AL C+ EA 
Sbjct  337  VNVLIGAYTKEGLIEKAKELKEKAPRRGGKPNAKTWEIFMDYYVKSGDTAQALKCISEAV  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +     E + D    E L+E+LK+ 
Sbjct  397  SIGKGDGGK-WLPSQETIRTLMSQFEEKKDVNGAENLVEILKKG  439



>ref|XP_003590654.1| WD repeat-containing protein [Medicago truncatula]
Length=562

 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 95/171 (56%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GN +EV RIW   K+ F  + +  Y  +I+SL++L D    EN++ EW S     D 
Sbjct  292  ANMGNVDEVNRIWGKMKACFCKMSDDEYVCMISSLVKLGDFAGVENLYKEWESVSGTNDV  351

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+NLLL  YV +GQ E AE F  Q+++ GV  +  +WE+L  G++K++ + + L    +
Sbjct  352  RVSNLLLTSYVDQGQMEMAEIFCNQLVEKGVCLSYSSWELLTRGYLKKKDVKKFLHYFGK  411

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S+   K W P P  +   F + + +   E  E L+ +L+ AG ++   Y
Sbjct  412  AISS--VKQWIPDPRLVQEAFTVIQEQAHIEGAEQLLVILRNAGHVNTNIY  460



>ref|XP_009593035.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Nicotiana tomentosiformis]
Length=510

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NK+ V R+W   K+    +  ++Y  I++SL++L D+ +AE IF EW S    YD 
Sbjct  299  ASLNNKDGVLRVWEASKAVNSQMTCANYMCILSSLVKLGDMREAERIFAEWESQCRTYDI  358

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL  Y+R G  E+AE    + ++ G  PN KTWEIL +G I+ +++ +A+  LK 
Sbjct  359  RVCNILLGGYMRNGSVEKAESLHYRTLEKGGCPNSKTWEILVEGWIRSQQMVKAIDALKS  418

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
              +A    +WRP P+ + +   + E  ++T + E  +E LK
Sbjct  419  GLAALKRYDWRPSPSIVVA---IAEYFEETRNFENAMEFLK  456



>ref|XP_002283946.2| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Vitis vinifera]
Length=502

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 91/164 (55%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NKEEV R+W   K     I +++Y  I+  L++L D+ +AE IF EW S   +YD 
Sbjct  291  ASLSNKEEVLRLWEASKKVGGRITSTNYMCILLCLVKLGDIAEAERIFREWESKCWKYDI  350

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  ++AE      ++ G  PN KTWEIL +G +K + + +A++ +K+
Sbjct  351  RVSNVLLGAYMRTGSMDKAESLHLHTLERGGCPNYKTWEILMEGWMKSQNMDKAINAMKK  410

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
              S     +WRP    +++  +  E   +       ++V+ Q G
Sbjct  411  GFSMLKHCDWRPNHGLVTAIARYLEEHGNVNDLNQYVKVIHQLG  454



>ref|XP_004244223.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Solanum lycopersicum]
Length=508

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 1/160 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GNKEE+ R+W V+K       N  Y +++ SL++L ++E AE +  EW S+   YD RV
Sbjct  312  LGNKEEMLRLWGVHKVVCKKQINRDYITMLGSLVKLGELETAETVLKEWESSCHTYDFRV  371

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL+ Y +    ++AE  L  II  G  P P +W I+A G++    + +A  C+K+A 
Sbjct  372  PNILLIGYCQNDLVDKAETMLHDIIKKGQTPIPNSWAIIAAGYLNMNNMEKAFECMKKAI  431

Query  357  SAEGSK-NWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            +  G    WRP P  +SS  K    + D+   E  +  LK
Sbjct  432  AVRGQNPAWRPKPHLVSSISKWLGDQQDSREVEAFLSSLK  471



>ref|XP_008221878.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g60770 [Prunus mume]
Length=482

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 87/164 (53%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+R+W   +  FP   N SY ++I  L+ L+D+  AE  F EW S  S YD RV
Sbjct  269  TGNLREVYRVWRSLRLAFPKTANISYLNMIQVLVNLNDLPGAEKCFREWESRCSTYDIRV  328

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++G  E+A+    Q    G KPN KTWEI  D +++      A+ C+  A 
Sbjct  329  ANVLIGAYAKEGMLEKAKELKEQARRRGAKPNAKTWEIFLDYYLETGEYQLAVDCVANAT  388

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P    + +  +  E E D +  E  +E+LK++
Sbjct  389  SIGRGDGGK-WSPSRKIVKTLMEHFEQEKDVDGAEGFLEILKKS  431



>gb|EMT03168.1| hypothetical protein F775_14546 [Aegilops tauschii]
Length=413

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 94/162 (58%), Gaps = 0/162 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+ + V R+W   K     IP ++Y + I  L+++ D + AE IF  W +   R+D 
Sbjct  194  AALGDSDGVMRLWEASKCVPGRIPAANYMTAILCLIKVGDFDRAEWIFGSWEAECRRHDV  253

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVR G  E+AE     +++ G +PN KTWEIL +G ++ R++ +A++ +K+
Sbjct  254  RVSNVLLGAYVRNGWIEKAEKLHLHMLEKGARPNYKTWEILMEGFVQSRQMDKAVNAMKK  313

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
            A S   S +WRP    + +     E + +T+     I++L++
Sbjct  314  ALSLMKSCHWRPPLKLVEAIAAFFEEQGNTDDASRYIKLLQK  355



>ref|XP_004137021.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=334

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 101/178 (57%), Gaps = 8/178 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+R+WN+Y +N     NS Y  II+SL++LDD++ AE I  EW S  + +D 
Sbjct  131  AAIGNKDEVYRVWNLY-TNLQKRFNSGYLCIISSLMKLDDIDGAERILKEWESGDTSFDF  189

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N+++  Y  KG  ++AE ++ ++I+ G +P   TW++LA G+      ++    LK+
Sbjct  190  RIPNMMINSYCTKGFVDKAEAYINRLIETGKEPEANTWDLLASGYHSNGLTNKVAETLKK  249

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG------CLHPEDYV  208
            A S     +W+P    +++  +  +  ++ +  E +I +L +        C   EDY+
Sbjct  250  AISV-SPPHWKPKYHILAACLEYLKTNENVDLAEEIIGLLCKRDIFPLNICKRLEDYI  306



>ref|XP_006376504.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP54301.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=441

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 101/165 (61%), Gaps = 5/165 (3%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVA  535
            GNK+ V+R+WN YK N   I NS+Y  +I SL+RL D++ AE I +EW+S K+ YD R+ 
Sbjct  263  GNKDGVYRVWNSYK-NTGRIFNSTYICMINSLMRLGDIDGAEWISEEWVSRKTLYDIRIP  321

Query  534  NLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGS  355
            N ++  Y RKG +++AE ++ +I+++G++    +W+ LA G+    ++++A+  LK+A S
Sbjct  322  NTMIRAYSRKGLWKKAEEYVNKIVESGMQLEASSWDHLATGYHFGGQMAKAVETLKKAIS  381

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHP  220
                  W+P P T+ +     E + D E+ E   E+LK     HP
Sbjct  382  I-SKPGWKPNPYTLKTCLWYLESKGDEEAAE---ELLKFVSEHHP  422



>ref|XP_011037316.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Populus euphratica]
Length=459

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 94/157 (60%), Gaps = 6/157 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEW-LSAKSRYD  547
            A  GNK+E++RIWN+YK +   + ++SY  +I SL +LDD+E AE IF+EW     + YD
Sbjct  301  AKTGNKDELYRIWNLYKPSSESM-DTSYCCMIDSLTKLDDIEGAEKIFEEWEFQCTTTYD  359

Query  546  PRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK  367
             RV N LLV Y  +G FE+AE  + + +  G  P   TW ++A G+++  RI +A+  LK
Sbjct  360  FRVLNGLLVAYCSRGLFEKAEAAIEKAVQ-GRTPYASTWHVMAKGYMEHDRIPKAIEMLK  418

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDT-ESKEL  259
             A +    ++W+P P  +++  +  E + D  E KE 
Sbjct  419  RAVNV--GRDWKPDPILVNACLEYLEGQGDAGEMKEF  453



>ref|XP_010520653.1| PREDICTED: uncharacterized protein LOC104799713 [Tarenaya hassleriana]
Length=1018

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 103/192 (54%), Gaps = 8/192 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  G +++V R+W +Y      + N  Y S I+SLLRLDD+E AE +FDEW       D 
Sbjct  326  AKAGKRDDVLRVWKIYNKK-KRVLNKGYISFISSLLRLDDIESAEQVFDEWKVKGLSLDI  384

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK-  367
            R+ NLL+  Y +K   E+A+  + +II  GVKPN +TW  LA  +++E R  EA+  +K 
Sbjct  385  RIPNLLIKHYCKKDLLEKAKAVIEEIISKGVKPNEQTWLYLASCYLEEGRSQEAVEAMKK  444

Query  366  ---EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIP  196
               EA S + S+ W  +   + +  K  + E + +  E  +++L+Q G   P   VSQ  
Sbjct  445  SLREATSIDISE-WTHYNDVLEACLKFLKEEGNIKEAEEFVQLLEQQGNASP--VVSQRF  501

Query  195  TPNGSNTNNEPD  160
                +  N +P+
Sbjct  502  LQYVTGENPKPE  513


 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 74/124 (60%), Gaps = 1/124 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  G K++V RIW VYK N   +  S Y SII SLLR DD+E AE + +EW S K   D 
Sbjct  818  AKAGYKDDVMRIWGVYKKN-ERVLKSGYVSIIPSLLRFDDIEGAEKVLEEWKSEKFSSDI  876

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N L+  + RKG  E+AE  + ++I  GVK N  TW  +A+G+++  +  EA+  +K+
Sbjct  877  RVPNYLIGYHSRKGFMEKAEAIIEEMISRGVKLNVWTWYYMANGYLQVGKSQEAVEAVKK  936

Query  363  AGSA  352
               A
Sbjct  937  TMKA  940



>ref|XP_006376506.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|ERP54303.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=501

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 103/171 (60%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              VGNKE+V+R+WN+YK+    + NSSY  +I SLL+LDDV+ AE I++EW+S    +D 
Sbjct  287  TAVGNKEQVYRVWNLYKTKGRSL-NSSYLCMINSLLKLDDVDGAERIWEEWVSIVKFFDI  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N+++  Y +KG +E+AE F+ +I+ +G+K    T + LA G+    ++ +A   +K+
Sbjct  346  RIPNVMVSAYSKKGLWEKAEAFVGKIVASGIKIEASTLDRLATGYHVRGQMLKASETIKK  405

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S      W+P   T+++  +  +  +D +  E  +++LK+   L    Y
Sbjct  406  AISI-SQPGWKPNVYTLAACLEYLKGREDVKKIEDPLKILKEHCHLSSVSY  455



>ref|XP_006357486.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Solanum tuberosum]
Length=498

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 95/169 (56%), Gaps = 2/169 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +G K++V+RIWN Y        NSSYH +I  L +LDD++ AE IF EW + +  +D 
Sbjct  304  TSMGKKDDVYRIWNKYNKKVKH-HNSSYHCMIRGLEKLDDLDGAEKIFAEWETNRVHFDI  362

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NLL+  Y +KG  E+A   + Q+ ++G  PN  +W  LA G+  +  + +A+  +K+
Sbjct  363  RIPNLLISAYCKKGHMEKAISIIEQLEESGKHPNGSSWNRLALGYCVQNDMEKAVETMKK  422

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
            A  A     W+P   +++S  K  + + DT+ +E L ++L+  G    E
Sbjct  423  AILA-SKPGWKPHFHSLASCVKYLQSKGDTQGEEELKDLLRVRGLCSKE  470



>ref|XP_010474556.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like, 
partial [Camelina sativa]
Length=253

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 85/163 (52%), Gaps = 4/163 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L+ L D+  AE +F EW +  S YD R+
Sbjct  39   LGKLTEVYRIWRSLRLAIPKTSNVAYLNMIQVLVNLKDLPGAETLFKEWQANCSTYDIRI  98

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y + G  E+A     +    G K N KTWEI  D ++K    ++AL C+ +A 
Sbjct  99   VNVLIGAYAKDGLIEKARELKEKAPRRGSKANAKTWEIFMDYYVKRGDTAQALECMSKAV  158

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
              G  +G K W P   TI +   L E + D    E L+E+LK+
Sbjct  159  SIGRGDGGK-WVPSQETIRTLMSLFEQKKDVNGAENLVEILKK  200



>ref|XP_009103962.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Brassica rapa]
Length=492

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 87/164 (53%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L+ L DV  AE +F EW +  + YD RV
Sbjct  277  LGKLSEVYRIWRSLRLAIPKTSNVAYLNMIQVLVNLKDVTGAETLFKEWQANCTTYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+++  Y ++G  E+A+    +    G KPN KTWEI  D ++K    ++AL C+ +A 
Sbjct  337  VNVMIGAYAKEGLIEKAKELKEKAPRRGGKPNAKTWEIFMDYYVKSGDTAQALECISKAV  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P    IS+     EV+ D    E L+E+ K+ 
Sbjct  397  SIGKGDGGK-WLPSQEAISTLMSQFEVKKDVNGAENLLEIFKKG  439



>gb|KDO74080.1| hypothetical protein CISIN_1g011236mg [Citrus sinensis]
Length=490

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 91/162 (56%), Gaps = 1/162 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+E+ + W + K       N  Y +++ SL+++ ++E+AE + +EW  +   YD 
Sbjct  290  ASLGNKDEMMKFWGLQKIKCKKQLNRDYITMLGSLVKIGELEEAEKMLEEWELSCYCYDF  349

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N++L+ Y +KG  E+A+  L +I+  G  P P +W I+A G+  +  + +A  C+KE
Sbjct  350  RVPNIILLGYSQKGMIEKADAVLKEIVKKGKTPTPNSWSIIAAGYADKNNMEKAFECMKE  409

Query  363  AGSA-EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            A +  E +K WRP P+ +SS         D E  E  +  LK
Sbjct  410  ALAVHEENKFWRPKPSLVSSILDWLGDNRDVEEVEAFVSSLK  451



>dbj|BAK02972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=510

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 94/172 (55%), Gaps = 3/172 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + ++  + R+W+  +  F    ++ Y  ++ SL R  D+  AE ++ EW S     D 
Sbjct  289  ASLSDRGNLDRVWSKMRQTFRKFSDAEYKCMLTSLTRFGDIAAAEFVYGEWESQSGTKDS  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHI-KERRISEALSCLK  367
            R+ N +L  Y++ G+ E+AE FL  I+  GVKP+  TWE+   G++  + R  + + CLK
Sbjct  349  RIPNTILSFYIKNGEMEKAESFLQYIVQKGVKPSYSTWELFVWGYLGNDERTDKVMECLK  408

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            +A S+   + W P P  +++ F   E + D E+ E L+ VL+ AG +  E Y
Sbjct  409  KALSS--LEKWEPNPQLVAALFSQIEKKGDIEAAEELLVVLRGAGYVTTEIY  458



>gb|KHN03794.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=414

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 94/171 (55%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK++V RIW   K++F  + ++ Y  +I+SLL+L D   AE+++ EW S     D 
Sbjct  194  TNMGNKDDVNRIWEKMKASFRKMNDNEYICMISSLLKLGDFAGAEDLYREWESVSGTNDV  253

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+ + Q E AE F  QI+  GV P   TWE+   G++K + + + L    +
Sbjct  254  RVSNILLGSYINQDQMEMAEDFCNQIVQKGVIPCYTTWELFTWGYLKRKDVEKFLDYFSK  313

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S+     W P    +   FK+ E +  T+  E L+ +L+ AG ++   Y
Sbjct  314  AISS--VTKWSPDQRLVQEAFKIIEEQAHTKGAEQLLVILRNAGHVNTNIY  362



>gb|EYU46589.1| hypothetical protein MIMGU_mgv1a004554mg [Erythranthe guttata]
Length=521

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (54%), Gaps = 2/177 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              + NK E+ RIW   KS +  + ++ Y  +I+ LL+L +V++AE +++EW S     D 
Sbjct  302  TAMENKNEIRRIWKKMKSTYRKMSDAEYTCMISCLLKLKEVDEAEKLYNEWESISPTKDT  361

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV NLLL  Y+     ++AE F  ++++  + P   TWE+L  G++K+R +   L C K+
Sbjct  362  RVPNLLLSSYISNNGMDKAEAFYNRMVENDLVPGYTTWELLTWGYLKQRDLDRVLDCFKK  421

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S+   + W P    +   F L E   + E  E L+ +L+  G ++ E Y   I T
Sbjct  422  AISS--VRKWDPDEKLVHEVFTLVEELGNVEVAEELVVILRGVGYVNTETYKYLIRT  476



>ref|XP_007149856.1| hypothetical protein PHAVU_005G104300g [Phaseolus vulgaris]
 gb|ESW21850.1| hypothetical protein PHAVU_005G104300g [Phaseolus vulgaris]
Length=494

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+R+WN+  S   F  NSSY S++ SL++LDD++ AE IF+EW S  + +D 
Sbjct  287  AVIGNKDEVYRLWNICTSLKSFC-NSSYISMLNSLVKLDDIDGAEKIFEEWESKYANFDY  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL++  Y ++GQF++AE F+ +++D G   + + W+ +A G+  +  + +A+  +K+
Sbjct  346  RIPNLMICAYCKRGQFDKAEAFIKRLLDGGKPLDGRAWDKMACGYHADNDMVKAVEAMKK  405

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVL  244
            A S   +   +P P T+ +  K  + + D    +L +E+L
Sbjct  406  AVSRNLAGR-KPDPITLIACVKYLKEKGDL---DLALEIL  441



>emb|CDP03624.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 93/174 (53%), Gaps = 4/174 (2%)
 Frame = -3

Query  711  NKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVAN  532
            +K+EV+ IW   KS F  + +S Y  +IASL++L ++  AE ++ EW S     D R+ N
Sbjct  299  HKDEVYWIWKKMKSMFHKLNDSEYMCMIASLVKLHELCKAEKLYMEWSSISPTGDSRIPN  358

Query  531  LLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-GS  355
            +LL  Y+  G  E AE F  Q+++ G+ P+  TWE+L  G++K +++   L C  +A GS
Sbjct  359  ILLAAYINDGHMEMAEKFYKQMVEKGMTPSYTTWELLTWGYLKLKKVERVLDCFNKAIGS  418

Query  354  AEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
                K W P    +     + E   + E  E L+  L+ AG L+   Y S + T
Sbjct  419  V---KKWEPDVKMVKEVSGMLEASGNIEGAEKLLVTLRHAGHLNTGIYNSLLRT  469



>gb|KDP24136.1| hypothetical protein JCGZ_25793 [Jatropha curcas]
Length=457

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 99/171 (58%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               GNK EV RIWN+YK N  F  N  Y  +I+SL++LDD+  AE I+ EW   K  +D 
Sbjct  277  TAAGNKAEVNRIWNLYKKNGGFF-NLGYLCMISSLVKLDDMAGAERIYAEWDVGKIFFDI  335

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL++  Y RKG +E+AEG + +I++ G++P+   W+ +A G+ +  +I++A+  +K+
Sbjct  336  RIPNLMIKAYCRKGLWEKAEGLINKIVENGMEPDGTLWDHMAAGYYEGGQITKAVETIKK  395

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S    +   P    +    +  + + + E+ E L++++K+  C     Y
Sbjct  396  AISQSKPRK-EPSLYNLQVCLEYLKSQGNVEAAEELLKMIKENCCYSAGAY  445



>emb|CBI21839.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 96/164 (59%), Gaps = 4/164 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  G+K+E++R+WN+YK ++ +    +Y  +I  L +LDD+E AE IF EW    + YD 
Sbjct  276  ARTGHKQELYRVWNLYKPSYEY--PEAYSCMITCLTKLDDIEGAEKIFQEWECECTMYDF  333

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LL  Y ++  F++AE  + ++I+  + P   TW ILA G+++++++ +A+  LK+
Sbjct  334  RVLNRLLSAYCKRCLFDKAESLVNKVIEERM-PYASTWNILAKGYVEDKQMPKAVEMLKK  392

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A S  G K WRP    + +  +  E + + E  E +  + K  G
Sbjct  393  AISV-GRKGWRPNSIILDACIEYLEGQGNLEEIEEIARLCKNLG  435



>ref|XP_009373544.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Pyrus x bretschneideri]
Length=509

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (54%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + +KE+V R+W   K+    IP ++Y  I+  L++L D+ +AE I  EW S    YD 
Sbjct  298  ASLNSKEDVLRLWKASKAVAGRIPCTNYMQILLCLVKLGDIVEAERILMEWESNCFSYDI  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  E+AE      +  G +PN KTWEIL +G +K + + +A+  +K+
Sbjct  358  RVSNVLLGAYMRNGMTEKAEALHLHTLGRGGQPNYKTWEILMEGRLKSQNMDKAVEAMKK  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
                    +WRP   T+ +F    E   + E     I V++  G
Sbjct  418  GFCMLQDCHWRPSEETVMAFADYFEKHGNIEDANWYIRVIRSFG  461



>ref|XP_009627474.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=506

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 102/170 (60%), Gaps = 3/170 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K++++R+W+ YK    +  NSSYH +I+ L +L D++ AE IF EW + +  +D 
Sbjct  310  ASMGKKDDLYRVWDKYKRRAKY-NNSSYHCMISGLEKLGDLDGAEKIFAEWEANRVHFDM  368

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            ++ NLL+  Y +KG  E+A   + +++++G +PN  TW  LA G+  +  + +A+  +K+
Sbjct  369  KIPNLLITAYCKKGHMEKAISIIDELLESGKQPNGSTWNRLALGYCVQNEMEKAVETMKK  428

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPED  214
            A  A     W+P   +++S  K  + + DT+ +  L ++L+  G L PE+
Sbjct  429  AILA-SRPGWKPHFHSLASCVKYLQSKGDTQREGELKDLLRVRG-LFPEE  476



>ref|XP_004243348.2| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Solanum lycopersicum]
 ref|XP_010323735.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Solanum lycopersicum]
Length=323

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 94/167 (56%), Gaps = 2/167 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +GNK++V RIWN YK       NSSYH +I  L +LDD++ AE IF EW + +  +D R+
Sbjct  131  MGNKDDVHRIWNKYKQKVKR-HNSSYHCMIRGLEKLDDLDGAEEIFAEWETNRVHFDIRI  189

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             NLL+  Y +KG  E+A   + Q+ ++G   N  TW  LA G+  +  + +A+  +K+A 
Sbjct  190  PNLLISAYCKKGHMEKAISIIEQLEESGKYANGSTWNRLALGYCVQNDMDKAVDTMKKAI  249

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
             A     W+P   +++   K  + + DT+ +E L ++L+  G    E
Sbjct  250  LA-SQPGWKPHFQSLAFCVKYLQSKGDTQGEEELKDLLRVRGLCSKE  295



>gb|KJB23095.1| hypothetical protein B456_004G080600 [Gossypium raimondii]
Length=515

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 96/173 (55%), Gaps = 2/173 (1%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K+ V +IW   KS F  + ++ Y  +I+SL++L D E+AE +++EW S     D RV
Sbjct  298  MGDKDGVQQIWKKMKSCFRKMNDAEYTCMISSLVKLGDFEEAEKLYNEWESVSGSGDARV  357

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N+LL  Y+   + + AE F  QI   G+ P   TWE+L  G+++++++ + L C K+A 
Sbjct  358  PNILLATYINGDKMDVAENFYQQIAQKGISPCYTTWELLTWGYLRKQQMEKVLDCFKQAV  417

Query  357  SAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
             +   K W P    +   F   E   DTE  E L+ +L+ AG +  + Y S +
Sbjct  418  CS--VKKWNPNEKLVREVFNKLEDLGDTEDAEKLLVILRDAGHVSTKVYNSLL  468



>ref|XP_008229146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Prunus mume]
Length=506

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 102/174 (59%), Gaps = 8/174 (5%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYK-SNFPF-IPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSR-  553
            A  G+K E++R+WN YK SN P  +P   Y  +I+SL +LDD+E AE IF+EW S  +  
Sbjct  297  ANTGHKGELYRVWNTYKQSNEPMDVP---YGCMISSLAKLDDIEGAERIFEEWESQCTEY  353

Query  552  YDPRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSC  373
            YD RV N LLV Y +KG F++AE  + +  +  + P   TW  LA G+ + +++ +A+  
Sbjct  354  YDFRVLNRLLVAYCKKGLFDKAESAVKKAAEGRI-PYASTWNALAMGYTESKQMPKAIET  412

Query  372  LKEAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            LK+A S +  + W P  +T+++     E + D E  E +I +LK  G L  + Y
Sbjct  413  LKKALSVD-RQGWVPDSSTLTACLNYLEGQGDFEGIEEIISLLKNLGPLSRDLY  465



>ref|XP_007144631.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
 gb|ESW16625.1| hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris]
Length=511

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 96/171 (56%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK++V RIW   K++F  + ++ Y  II+S+++L D+  AE+++ EW S     D 
Sbjct  291  TNMGNKDDVNRIWKKMKASFRKMNDNEYICIISSMVKLGDIAGAEDLYREWESVSGTNDV  350

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+ + Q E AE F  QI+  GV P   TWE+   G++K + + + L    +
Sbjct  351  RVSNILLASYINQDQMELAESFCNQIVQKGVIPCYTTWELFTWGYLKRKDVEKFLDYFSK  410

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S+     WR     +   FK+ E +  T+  + L+ +L+ AG ++ + Y
Sbjct  411  AISSVN--KWRLDQRLVQEAFKIIEKQAHTQGADQLLVILRNAGHVNTDIY  459



>ref|XP_010455119.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like 
isoform X1 [Camelina sativa]
 ref|XP_010455120.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like 
isoform X2 [Camelina sativa]
Length=515

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 91/164 (55%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + +GNKE V R+W   KS    I  ++Y  +++SL+++ D+E+AE +F EW +    YD 
Sbjct  315  SSLGNKEGVVRLWEASKSVCGRISCANYICVLSSLVKIGDLEEAERVFSEWEAQCFNYDV  374

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVRKG   +AE    ++++ G  PN KTWEIL +G +K + + +A+  +  
Sbjct  375  RVSNVLLGAYVRKGDIRKAESLHNRVLERGGNPNYKTWEILMEGWVKCQHMDKAIEAMHR  434

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A       +WRP    + +  +  E E+  E     +  L + G
Sbjct  435  AFELMKGCHWRPSQNIVLAIAEYFEKEEKIEEATAYVRALHRLG  478



>ref|XP_010553613.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Tarenaya hassleriana]
Length=490

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+R+W   +  FP   N +Y + I  L+ L D+  AE +F EW S  S YD RV
Sbjct  277  LGKVTEVYRVWRSLRLAFPKTTNVAYLNTIQVLVNLKDLPGAETLFKEWQSNCSIYDIRV  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y R G   +A+    +    G K N KTWEI  D ++K   I++A+ C+ +A 
Sbjct  337  VNVLIGAYARDGLVVKAKEMKDKAHRRGAKANAKTWEIFMDYYMKNGEIAQAVECISKAV  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +GSK W P   TI +     E E D +  E  +E+LK+ 
Sbjct  397  SIGRGDGSK-WLPSQETIGTLMGHFEQEKDVDGAESFVEILKKG  439



>ref|XP_006366127.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Solanum tuberosum]
Length=524

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 95/173 (55%), Gaps = 2/173 (1%)
 Frame = -3

Query  711  NKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVAN  532
            +K+EVFRIW   KS F  + ++ Y  II+SLL+LD+  +A N++ EW +     D R+AN
Sbjct  308  SKDEVFRIWKEMKSLFRKVNDTEYSCIISSLLKLDEFGEAMNLYTEWEAGSVTKDTRIAN  367

Query  531  LLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAGSA  352
            L+L  Y+ + + E A  F  ++ + G+ P+  TW++L  G++K++ + + +   K+  + 
Sbjct  368  LILAAYINRSEMENAVDFHNRMAEKGITPSCTTWKLLTQGYLKQKEMDKVVEFFKK--TV  425

Query  351  EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
                 W P    +   F + E + D +  E L+  L+ A  ++ E Y + + T
Sbjct  426  TSVSKWDPDAKMVQEMFHVVEEQGDIQMAEQLLVTLRHAKYVNTEIYNALLRT  478



>ref|XP_004155523.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=201

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 100/178 (56%), Gaps = 8/178 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+R+WN+Y +N     NS Y  II+SL++LDD++ AE I  EW S  + +D 
Sbjct  5    AAIGNKDEVYRVWNLY-TNLQKRFNSGYLCIISSLMKLDDIDGAERILKEWESGDTSFDF  63

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            ++ N+++  Y  KG  ++AE +++++I+ G +P    W+ LA G+      ++A   LK+
Sbjct  64   KIPNMMINSYCTKGFVDKAEAYISRLIENGKEPRAYAWDRLASGYHSNGLTNKAAETLKK  123

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG------CLHPEDYV  208
            A S    + W+P    +++  +  +   + E  E +I +L +        C   EDY+
Sbjct  124  AISVSPPR-WKPNYDILAACLEYLKTNGNVELAEEIIGLLCKRDIFPLNICKRLEDYI  180



>ref|XP_004509657.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
isoform X1 [Cicer arietinum]
Length=490

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 82/159 (52%), Gaps = 4/159 (3%)
 Frame = -3

Query  702  EVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRVANLLL  523
            EV+R+W   +  FP   N SY ++I  L+ L D+  AE  F EW S  + YD RVAN L+
Sbjct  282  EVYRVWRSLRLAFPKTANISYLNMIQVLVNLKDLPGAEKCFREWESTCNTYDIRVANALI  341

Query  522  VCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA---GSA  352
              Y +    E+AE    +    G KPN KTWEI  D H+++     A+ CL EA   G  
Sbjct  342  EAYAKLDMLEKAEELKERARRRGAKPNAKTWEIFLDCHLRKGDFKLAVDCLTEAISIGRG  401

Query  351  EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
             G K W P   TI    +  E E D +  E  IE+LK++
Sbjct  402  NGEK-WVPSSETIGIMMRHYEQEKDVDGAEEFIEILKKS  439



>gb|KGN43608.1| hypothetical protein Csa_7G047430 [Cucumis sativus]
Length=407

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 95/177 (54%), Gaps = 8/177 (5%)
 Frame = -3

Query  714  GNKEEVFRIWNVYKSNFPFIPNSS--YHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPR  541
            G+K EV+R+WN +K   P    +   Y  +I SL +LDD+E AE IF EW S  + YD R
Sbjct  200  GHKNEVYRVWNTFK---PLTKETCVPYALMITSLAKLDDIEGAERIFQEWESKCTVYDFR  256

Query  540  VANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA  361
            V N LLV Y RKG  ++AE  + Q +     P   TW ILA G+ +   +S+A+  LK+A
Sbjct  257  VLNRLLVAYCRKGLLDKAESVVNQAV-VERTPFRSTWSILATGYAEYGHMSKAVEMLKKA  315

Query  360  GSAEGSKNWRPWPATI-SSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
                G +NW+P    I  +     E + D E+ + ++ + K +G +  E Y   + T
Sbjct  316  ILV-GRQNWKPKQGDILEACLDYLEKQGDAETMDEIVRLCKSSGTVMKEMYYRLLRT  371



>gb|KDP20961.1| hypothetical protein JCGZ_21432 [Jatropha curcas]
Length=408

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 99/172 (58%), Gaps = 1/172 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK E+ R+W++ K+      N  + +++ SL+++ ++E+AE +  EW S+ + YD 
Sbjct  196  ATLGNKAEILRLWDLEKTACNRHINRDFITMLESLVKIGELEEAEKVLKEWESSGNFYDI  255

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N++++ Y +KG +E+AE  L ++I+ G    P +W I+A G++++  +++A  C+K 
Sbjct  256  RIPNVMVIAYSQKGLYEKAEALLEELIEKGKATTPNSWAIIAAGYLEKGNMAKAFECMKA  315

Query  363  AGSAE-GSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S    +K W+P P  +         E  TE  E  ++ L  A  ++ + Y
Sbjct  316  ALSLRVENKGWKPNPRVVKQILSWLGDEGCTEDVEAFVDSLSTAIPMNRQIY  367



>ref|XP_008366628.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Malus domestica]
Length=501

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 89/169 (53%), Gaps = 2/169 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+ V R+W +YK +   I N  Y SII S+L++ D+E AE I+DEW S     D 
Sbjct  299  AALGZKDSVMRLWELYKKHLK-IYNRGYISIITSVLKVGDIESAEKIYDEWESKNLTPDI  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N L+  Y +KG  ++AE  + +I+  G KP+ KTW  LA G++   +  + +  +++
Sbjct  358  RIPNFLISAYTKKGLVDKAESIINRIVLKGXKPDAKTWYYLAKGYLNHDQXEKTVESMRK  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
            A S      W P    +++     + + D E  E  I  L +  C  PE
Sbjct  418  ALSVVEGSRWTPDRDVVAACMXYMKQKADVEGXEEFIRXLXEK-CSFPE  465



>ref|XP_008226646.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Prunus mume]
Length=494

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 95/172 (55%), Gaps = 1/172 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+++ R+W++ K+      N  Y +++ SL++L ++E+ + + +EW  +   YD 
Sbjct  285  ASLGCKDDMMRLWSLEKTKCKKQINRDYITMLGSLVKLGELEETKKLLEEWELSCLSYDF  344

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y ++G  E+AE  L  I+  G  P P +W ILA G++ ++++ +A  C+ E
Sbjct  345  RVPNILLIGYCQRGLVEQAEDTLRDIVKKGKTPTPNSWAILAAGYVDKQKMQKAFECMTE  404

Query  363  AGSAEG-SKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A +    +  WRP P  +SS         D E  E  + ++K    ++ E Y
Sbjct  405  ALNLRARNTGWRPKPGVVSSVLSWIGDNGDIEQVEAFVSLMKTVITVNREMY  456



>gb|KDP24140.1| hypothetical protein JCGZ_25797 [Jatropha curcas]
Length=494

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 98/163 (60%), Gaps = 2/163 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A  G K EV+RIWN+YK N  F  N  Y  +I+SLL+LDD+  AE I+ EW   K  +D 
Sbjct  278  AAAGKKAEVYRIWNLYKKNGVF-SNVGYVCMISSLLKLDDMAGAERIWGEWDVGKLLFDI  336

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ NL++  Y  KG +E+AE  + +I+++ ++PN  +W+ +A G+ +  ++++A+  +K+
Sbjct  337  RIPNLMIKAYCSKGLWEKAEALINKIVESRMEPNGASWDHMATGYFENGQMTKAVEAIKK  396

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
            A S       +P    +    K  + + D E+ E L++++K++
Sbjct  397  AISLSKPGK-KPCLYRVEVCLKYLKGQGDMEAVEELLKMIKES  438



>ref|XP_006451898.1| hypothetical protein CICLE_v10007647mg [Citrus clementina]
 gb|ESR65138.1| hypothetical protein CICLE_v10007647mg [Citrus clementina]
Length=681

 Score =   105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 91/162 (56%), Gaps = 1/162 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NK+E+ + W + K       N  Y +I+ SL+++ ++E+AE + +EW S+   YD 
Sbjct  290  ASLRNKDEMMKFWGLQKIKCKKQLNRDYITILGSLVKIGELEEAEKMLEEWESSCYCYDF  349

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N++L+ Y +KG  E+A+  L +I+  G  P P +W I+A G+  +  + +A  C+KE
Sbjct  350  RVPNIILLGYSQKGMIEKADAVLKEIVKKGKTPTPNSWSIIAAGYADKNNMEKAFECMKE  409

Query  363  AGSA-EGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
            A +  E +K WRP P+ +SS         D E  E  +  LK
Sbjct  410  ALAVHEENKFWRPKPSLVSSILDWLGDNRDVEEVEAFVSSLK  451



>dbj|BAK01353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 94/162 (58%), Gaps = 0/162 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+ + V R+W   K     IP+++Y S I  L+++ D++ AE IF  W     ++D 
Sbjct  299  AALGDSDGVMRLWEASKCVPGRIPSANYMSAILCLIKVGDIDRAEWIFGSWEVECRKHDV  358

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVR G  E+AE     +++ G +PN KTWEIL +G ++ R++ +A++ +K+
Sbjct  359  RVSNVLLGAYVRNGWIEKAEKLHLHMLEKGGRPNYKTWEILMEGFVQSRQMDKAVNAMKK  418

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQ  238
            A S     +WRP    + +     E + +T+     I+VL++
Sbjct  419  ALSLMKGCHWRPPLRLVEAIATFFEEQGNTDDANRYIKVLQK  460



>ref|XP_007222350.1| hypothetical protein PRUPE_ppa004842mg [Prunus persica]
 gb|EMJ23549.1| hypothetical protein PRUPE_ppa004842mg [Prunus persica]
Length=489

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 86/164 (52%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV R+W   +  FP   N SY ++I  L+ L+D+  AE  F EW S  S YD RV
Sbjct  276  TGNLREVHRVWRSLRLAFPKTANISYLNMIQVLVNLNDLPGAEKCFREWESRCSTYDIRV  335

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            AN+L+  Y ++G  E+A+    Q    G KPN KTWEI  D +++      A+ C+  A 
Sbjct  336  ANVLIGAYAKEGMLEKAKELKEQARRRGAKPNAKTWEIFLDYYLETGEYQLAVDCVANAT  395

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P    + +  +  E E D +  E  +E+LK++
Sbjct  396  SIGRGDGGK-WSPSRKIVKTLMEHFEQEKDVDGAEGFLEILKKS  438



>gb|EYU39860.1| hypothetical protein MIMGU_mgv1a005194mg [Erythranthe guttata]
Length=493

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (54%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
             GN  EV+R+W   K  FP   N SY ++I  L+ L+D+  AE  F EW+S    YD R+
Sbjct  280  TGNLIEVYRVWRSLKLAFPKTANLSYLNMIQVLVNLNDIPGAEKCFREWVSGCPVYDIRI  339

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLK---  367
            AN L+  Y+++G  ++A+    Q+   G++ N KTWE+  D ++K+     A+ C+    
Sbjct  340  ANALIGAYLKEGSLDKAQKLKDQVRRRGIQANAKTWELYLDYYLKKGEFKFAVKCVANAI  399

Query  366  EAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
             AG  +G K W P  A + +  +  E   D    E  +EVLK++
Sbjct  400  TAGRGDGGK-WVPPTAVVKTLMQYFEENKDVLGAESFVEVLKKS  442



>ref|XP_009379667.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Pyrus x bretschneideri]
Length=502

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 94/170 (55%), Gaps = 4/170 (2%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K+ V R+W +YK +   I N  Y S+I S+L++ D+E AE I+DEW S     D 
Sbjct  300  AALGQKDSVMRLWELYKKDLK-IYNRGYISVITSVLKIGDIESAEKIYDEWESKNLTPDI  358

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N L+  Y +KG  ++AE  + +I+  G KP+ KTW  LA G++   +  + +  +++
Sbjct  359  RIPNFLISAYTKKGLVDKAESIVNRIVLKGAKPDAKTWYYLAKGYLNHDQTEKTVESMRK  418

Query  363  A-GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPE  217
            A    EGS+ W P    +++  +  + + D E  E  I +L +  C  PE
Sbjct  419  ALAVVEGSR-WTPDRDVVAACMEYMKQKADVEGAEEFIRLLGEK-CSFPE  466



>ref|XP_011098322.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Sesamum indicum]
Length=512

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 85/143 (59%), Gaps = 1/143 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K+E+ R+W + K       N  Y +++ SL++L ++E AE +  EW S+   YD 
Sbjct  300  AHLGDKDEMMRVWGLQKIVSKKQINRDYITLLGSLVKLGELEKAEAVLKEWDSSCCTYDF  359

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            +V N+LL+ Y +KG  +++E  L  I++ G KP P +W I+A G++ +  + +A  C+KE
Sbjct  360  KVPNILLIGYCQKGLVQKSETMLRNIVERGKKPTPNSWAIIAAGYLDQNDLEKAFQCMKE  419

Query  363  AGSA-EGSKNWRPWPATISSFFK  298
            A +  E +K W P P  I+   +
Sbjct  420  ALAVKENNKKWMPKPGQITKILQ  442



>ref|XP_010105079.1| hypothetical protein L484_012430 [Morus notabilis]
 gb|EXC03817.1| hypothetical protein L484_012430 [Morus notabilis]
Length=519

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 102/203 (50%), Gaps = 10/203 (5%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLS--AKSRY  550
            A +G K+EV R+W +YK     + N  Y SII SLL+L D+E AE IF+EW S  +KS+Y
Sbjct  300  AAIGKKQEVLRLWELYKMKQQ-VYNGGYISIITSLLKLGDIESAEKIFEEWGSRQSKSKY  358

Query  549  DPRVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCL  370
            D R+ N L+    RKG  E+AE  +AQ+   G KPN KTW  L  G+   ++  +A+  +
Sbjct  359  DIRIPNFLIGACCRKGLLEKAEALVAQVKVEGGKPNVKTWSHLTTGYCVRKQTHKAVESI  418

Query  369  KEAGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPTP  190
            KE  S      W+     ++        + D E  E +I +LK       +D+VS     
Sbjct  419  KEEISV-AEPWWKLSKDNVAVCLDYLIGKGDVEQAEEIIRLLKD------KDFVSMDGHE  471

Query  189  NGSNTNNEPDTWEEDSFLDNNDD  121
               N   E ++  ++    N  D
Sbjct  472  RLLNKIKEKESISQEMLYMNGYD  494



>ref|XP_004514446.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cicer arietinum]
Length=521

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 94/152 (62%), Gaps = 2/152 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G K++V+RIWN+ K N     NS Y S++ +L +L+D+E AE I +EW S K+ +D 
Sbjct  282  AAIGKKDDVYRIWNICK-NLNGSHNSVYISMLTALSKLNDIEGAERILEEWESGKTCFDI  340

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ ++++  Y +KG  E+AE F+  ++  G K + + W+ LA G+ K   + +A+  +K+
Sbjct  341  RIPSVMVSAYCKKGMLEKAEAFIGGLLKRGNKLDGRIWDRLARGYYKCNDMDKAVDAMKK  400

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTES  268
            A   E  + W+P+P T ++  +  + ++D ES
Sbjct  401  A-VLESPQGWKPYPFTFAACIEHMKDKNDLES  431



>ref|XP_010494007.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460 
[Camelina sativa]
Length=492

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 93/164 (57%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + +GNKE V R+W   KS    I  ++Y  +++SL+++ D+E+AE++F EW +    YD 
Sbjct  292  SSLGNKEGVVRLWEASKSVGDRISCANYICVLSSLVKIGDLEEAESVFSEWEAQCFNYDV  351

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVRKG   +AE   +++++ G  PN KTWEIL +G +K + + +A+  +  
Sbjct  352  RVSNVLLGAYVRKGDILKAESLHSRVLERGGNPNYKTWEILMEGWVKCQHMEKAIDAMHR  411

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A       +WRP    + +  +  E E+  E     +  L + G
Sbjct  412  AFELMKGCHWRPSQNIVMAIAEYFEKEEKIEEATAYVRDLHRLG  455



>ref|XP_004155477.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, 
mitochondrial-like [Cucumis sativus]
Length=493

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 101/178 (57%), Gaps = 8/178 (4%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK+EV+R+WN+Y +N     NS Y  II+SL++LDD++ AE I  EW S  + +D 
Sbjct  290  AAIGNKDEVYRVWNLY-TNLRKRFNSGYLCIISSLMKLDDIDGAERILKEWESGDTSFDF  348

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+ N+++  Y  KG  ++AE ++ ++I+ G +P   TW++LA G+      ++    LK+
Sbjct  349  RIPNMMINSYCMKGFVDKAEAYINRLIETGKEPEANTWDLLASGYHSNGLTNKVAETLKK  408

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG------CLHPEDYV  208
            A S     +W+P    +++  +  +  ++ +  E +I +L +        C   EDY+
Sbjct  409  AISV-SPPHWKPKYHILAACLEYLKTNENVDLAEEIIGLLCKRDIFPLNICKRLEDYI  465



>ref|XP_006354566.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like 
isoform X1 [Solanum tuberosum]
Length=487

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 96/175 (55%), Gaps = 0/175 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + NK+ V R+W+  K+    I  ++Y  I++SL++L D+ +AE  F EW S    YD 
Sbjct  298  ASLKNKDGVHRVWDASKAVNSPITCANYMCILSSLVKLGDMREAERTFVEWESQCRTYDI  357

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+R G  E+AE    + ++ G  PN KTWEIL +G I+ +++ +A+  LK 
Sbjct  358  RVSNILLGGYMRNGSVEKAESLHYRTLEKGGCPNSKTWEILVEGWIRSQQMDKAIDALKS  417

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQI  199
              +A     WRP P+ + +  +  E   + E     +  L+  G  + + Y S +
Sbjct  418  GLAALKHYEWRPSPSIVVAISEYFEETRNFEKAMEFLTTLRHFGPANLQVYKSLL  472



>ref|XP_008452263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial-like [Cucumis melo]
Length=487

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 95/156 (61%), Gaps = 3/156 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+K EV R+W + K     + N  Y +++ SL++LD +E+AEN+  EW S+    D RV
Sbjct  300  LGHKNEVMRLWALQKKAKKQL-NRDYITMLGSLVKLDLLEEAENLVMEWESSCQCNDFRV  358

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEAG  358
             N++L+ Y + G  E+AE  L  II  G+ P+P +W I+A G+++++ + +A  C+KEA 
Sbjct  359  PNVVLIGYSQNGLIEKAEKMLRNIIVNGMIPSPNSWGIIASGYLEKQNLEKAFECMKEAL  418

Query  357  SAEG-SKNWRPWPATISSFFK-LCEVEDDTESKELL  256
            + +G +K WRP P  +SS  + L E     E KE +
Sbjct  419  AVKGQNKVWRPKPNVLSSILRWLSENRRYEEMKEFM  454



>ref|XP_008455539.1| PREDICTED: uncharacterized protein LOC103495690 [Cucumis melo]
Length=1067

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 96/178 (54%), Gaps = 8/178 (4%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSS--YHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
             G+K EV+R+WN +K   P    +   Y  +I SL +LDD+E AE IF EW S  + YD 
Sbjct  303  TGHKNEVYRVWNTFK---PLTRQTRVPYALMITSLAKLDDIEGAERIFQEWESKCTVYDF  359

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N LLV Y RKG  ++AE  + Q +  G  P   TW +LA G+ +   +S+A+  LK+
Sbjct  360  RVLNRLLVAYCRKGLLDKAEWVVNQAV-VGRTPFASTWSLLATGYAEYGHMSKAVEMLKK  418

Query  363  AGSAEGSKNWRPWPATI-SSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A    G +NW+P    I  +     E + D E+ E ++ + K +G +  E Y   + T
Sbjct  419  AMLV-GRQNWKPKRRDILEACLDYLEKQGDAETMEEIVRLCKSSGTVAKEMYYRLLRT  475


 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 97/178 (54%), Gaps = 8/178 (4%)
 Frame = -3

Query  723   AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
               +GNK+EV+R+WN+Y SN     NS Y  +I SL++LDD++ AE I  EW S  + +D 
Sbjct  864   GAIGNKDEVYRVWNLY-SNLEKRFNSGYLCMINSLMKLDDIDGAERILKEWESGDTCFDF  922

Query  543   RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
             R+ N+++  Y  KG  ++AE +++++I+ G +P    W+ L  G+      ++A   +K+
Sbjct  923   RIPNMMINSYCTKGFMDKAEAYISRLIENGKEPRAFAWDRLVSGYHSNGLTNKAAETMKK  982

Query  363   AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG------CLHPEDYV  208
             A S    + W+P    +++  +  +   + E  E +I +L +        C   EDY+
Sbjct  983   AISVSPPR-WKPNNHIVAACLEYLKTNGNVELAEEIIGLLCKGDIFPSNICNRLEDYI  1039



>ref|XP_010473256.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770 
[Camelina sativa]
Length=491

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 85/164 (52%), Gaps = 4/164 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L+ L D+  AE +F EW +  S YD R+
Sbjct  277  LGKLTEVYRIWRSLRLAIPKTSNVAYLNMIQVLVNLKDLPGAETLFKEWQANCSTYDIRI  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y + G  E+A     +    G K N KTWEI  D ++K    ++AL C+ +A 
Sbjct  337  VNVLIGAYAKDGLIEKARELKEKAPRRGSKANAKTWEIFMDYYVKRGDTAQALECMSKAV  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQA  235
              G  +G K W P   TI +   L E + D    E L+E+LK+ 
Sbjct  397  SIGRGDGGK-WVPSQETIRTLMSLFEQKKDVNGAENLVEILKKV  439



>ref|XP_003536907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02820, 
mitochondrial-like [Glycine max]
Length=516

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 94/171 (55%), Gaps = 2/171 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GNK++V RIW   K++F  + ++ Y  +I+SLL+L D   AE+++ EW S     D 
Sbjct  296  TNMGNKDDVNRIWEKMKASFRKMNDNEYICMISSLLKLGDFAGAEDLYREWESVSGTNDV  355

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  Y+ + Q E AE F  QI+  GV P   TWE+   G++K + + + L    +
Sbjct  356  RVSNILLGSYINQDQMEMAEDFCNQIVQKGVIPCYTTWELFTWGYLKRKDVEKFLDYFSK  415

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDY  211
            A S+     W P    +   FK+ E +  T+  E L+ +L+ AG ++   Y
Sbjct  416  AISS--VTKWSPDQRLVQEAFKIIEEQAHTKGAEQLLVILRNAGHVNTNIY  464



>gb|AGN52922.1| hypothetical protein, partial [Silene latifolia]
Length=271

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
              +GN+ EV+R+WN+YKS FP IPN  YHS+I+SL+R  D+E AE +++EWL  KS +DP
Sbjct  186  GSLGNRGEVYRVWNIYKSVFPNIPNWGYHSVISSLVRPGDIEGAEKLYEEWLPVKSSFDP  245

Query  543  RVANLLLVCYVRKGQFERAEGFLAQI  466
            ++ NLL+  YV++  FE+ +GF   +
Sbjct  246  KIGNLLMGWYVKEEPFEKVKGFFDHM  271



>ref|XP_010421607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like 
[Camelina sativa]
Length=495

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 91/164 (55%), Gaps = 0/164 (0%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            + +GNKE V R+W   KS    I  ++Y  +++SL+++ D+E+AE +F EW +    YD 
Sbjct  295  SSLGNKEGVVRLWEASKSICGKISCANYICVLSSLVKIGDLEEAERVFSEWEAQCFNYDV  354

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV+N+LL  YVRKG   +AE    ++++ G  PN KTWEIL +G +K + + +A+  +  
Sbjct  355  RVSNVLLGAYVRKGDIRKAESLHNRVLERGGNPNYKTWEILMEGWVKCQHMEKAIDAMHR  414

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAG  232
            A       +WRP    + +  +  E E+  E     +  L + G
Sbjct  415  AFELMKGCHWRPSQNIVLAIAEYFEKEEKIEEATAYVRDLHRLG  458



>ref|XP_010249903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g60770-like 
[Nelumbo nucifera]
Length=500

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 96/179 (54%), Gaps = 2/179 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A + N E V R+W   KS FP + N+SY  ++ +L  +   + A   F EW S  S YD 
Sbjct  286  ARMSNLEGVNRVWQSLKSAFPKVTNASYLVMLKALCTMGYRDTANECFKEWESVCSTYDI  345

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            R+AN+L+  Y+ +   + AE      +  G KPN +T E+  + H+ ++++  AL  LK 
Sbjct  346  RLANILIDSYLSQFMIKEAELLCESAVQKGAKPNFRTLEMFMNYHLMKQQMDLALDYLKT  405

Query  363  AGS-AEGSKN-WRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            A S A+  +N W+P   T+S F K  E ++D    E L + LK+  CL+ E Y S + T
Sbjct  406  AASKAKVERNKWQPSQETVSVFLKYFESKNDVGGAEELCDSLKKLRCLNSEAYSSLLRT  464



>ref|XP_008383747.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, 
mitochondrial isoform X2 [Malus domestica]
Length=449

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 100/207 (48%), Gaps = 3/207 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +GNK EV R+W V KS      N  Y  ++ SL+RL ++++AE + +EW  + + YD 
Sbjct  230  ASMGNKGEVLRLWGVEKSACKRCINRDYMGMLVSLVRLGELDEAEKVMEEWELSGNCYDF  289

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV   L++ Y  KG +ERAE  L  +++ G     ++WEI+A G+       +   C+K 
Sbjct  290  RVPQTLIIGYTVKGLYERAEALLEDLMEKGKTTTARSWEIVAAGYANRGETEKVFECMKA  349

Query  363  AGSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIP--TP  190
            A      K W+P    +++       E   E  E  +  L+    ++   Y + +     
Sbjct  350  ALCLSSEKRWKPNLGVVTTVLSWLGDEGSAEDTEAFVGALRNVILVNKHMYRALLKAYVR  409

Query  189  NGSNTNNEPDTWEEDSFLDNNDDKSGD  109
             G   ++  D  E D  +D +D+++ D
Sbjct  410  EGKEVSSVTDRMEADE-IDVDDEEAED  435



>ref|NP_176276.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|O22714.1|PPR86_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g60770 
[Arabidopsis thaliana]
 gb|AAB71963.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AAO22693.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42395.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33730.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=491

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 87/162 (54%), Gaps = 4/162 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G   EV+RIW   +   P   N +Y ++I  L++L+D+  AE +F EW +  S YD R+
Sbjct  277  LGKLTEVYRIWRSLRLAIPKTSNVAYLNMIQVLVKLNDLPGAETLFKEWQANCSTYDIRI  336

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
             N+L+  Y ++G  ++A     +    G K N KTWEI  D ++K   ++ AL C+ +A 
Sbjct  337  VNVLIGAYAQEGLIQKANELKEKAPRRGGKLNAKTWEIFMDYYVKSGDMARALECMSKAV  396

Query  360  --GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLK  241
              G  +G K W P P T+ +     E + D    E L+E+LK
Sbjct  397  SIGKGDGGK-WLPSPETVRALMSYFEQKKDVNGAENLLEILK  437



>ref|XP_007198989.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
 gb|EMJ00188.1| hypothetical protein PRUPE_ppa004422mg [Prunus persica]
Length=511

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 97/176 (55%), Gaps = 4/176 (2%)
 Frame = -3

Query  717  VGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDPRV  538
            +G+++ V+RIW   KS F  + ++ Y  +++SL++L + E+AE ++ EW S    +D RV
Sbjct  293  IGDEDGVWRIWKKMKSCFRKMNDAEYTCMLSSLVKLKEFEEAEKLYTEWESVSETHDARV  352

Query  537  ANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKEA-  361
            +N+LL  Y+ K Q E AE F  +++  G+ P   TWE+L  G +K++   + L   K+A 
Sbjct  353  SNILLAAYINKDQMEMAETFHNRMVQNGITPCYSTWELLTWGFLKQKHTEKVLDNFKKAV  412

Query  360  GSAEGSKNWRPWPATISSFFKLCEVEDDTESKELLIEVLKQAGCLHPEDYVSQIPT  193
            GS    K W P    I   F   + E + +  E L+  L+ AG +  E Y S + T
Sbjct  413  GSV---KRWDPDKRLIGEVFNRLKEEGNIKGAEELLLFLRNAGHVSTEIYNSVLRT  465



>gb|EYU26391.1| hypothetical protein MIMGU_mgv1a004262mg [Erythranthe guttata]
Length=536

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = -3

Query  723  AGVGNKEEVFRIWNVYKSNFPFIPNSSYHSIIASLLRLDDVEDAENIFDEWLSAKSRYDP  544
            A +G+K E+ R+W + K       N  Y +I+ SL+++++ E AE +  EW S    YD 
Sbjct  322  AHIGDKNEMMRLWALQKVVCKKQINRDYITILGSLVKIEEFETAEEVLAEWDSCCHTYDF  381

Query  543  RVANLLLVCYVRKGQFERAEGFLAQIIDAGVKPNPKTWEILADGHIKERRISEALSCLKE  364
            RV N+LL+ Y +KG+ E++E  L  I++ G KP P +W I+A G++    + +A  C+KE
Sbjct  382  RVPNVLLIGYCQKGRVEKSELMLRNIVERGKKPIPNSWSIVASGYVDNGNMEKAFECMKE  441

Query  363  AGSAEGSK-NWRPWPATISSFF  301
            A + +G K  W P P  ++   
Sbjct  442  ALAVKGDKLKWMPKPGLVTRLL  463



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440