BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF007A13

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                  198   9e-57   Nicotiana tomentosiformis
ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                  195   8e-56   Solanum tuberosum [potatoes]
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                  195   9e-56   Solanum lycopersicum
ref|XP_007034626.1|  Eukaryotic aspartyl protease family protein,...    171   1e-46   
emb|CDO98999.1|  unnamed protein product                                171   2e-46   Coffea canephora [robusta coffee]
ref|XP_002517162.1|  basic 7S globulin 2 precursor small subunit,...    169   4e-46   Ricinus communis
ref|XP_011090791.1|  PREDICTED: basic 7S globulin                       165   2e-44   Sesamum indicum [beniseed]
emb|CBI32364.3|  unnamed protein product                                164   4e-44   Vitis vinifera
ref|XP_002272235.1|  PREDICTED: basic 7S globulin                       164   7e-44   Vitis vinifera
gb|KEH36785.1|  eukaryotic aspartyl protease family protein             164   7e-44   Medicago truncatula
ref|XP_010242827.1|  PREDICTED: basic 7S globulin-like                  164   8e-44   Nelumbo nucifera [Indian lotus]
emb|CAN80378.1|  hypothetical protein VITISV_038701                     164   9e-44   Vitis vinifera
ref|XP_002280508.1|  PREDICTED: basic 7S globulin                       162   3e-43   Vitis vinifera
emb|CAN68736.1|  hypothetical protein VITISV_030193                     161   7e-43   Vitis vinifera
ref|XP_002284868.1|  PREDICTED: basic 7S globulin-like                  161   8e-43   Vitis vinifera
ref|XP_010255899.1|  PREDICTED: basic 7S globulin-like                  161   1e-42   Nelumbo nucifera [Indian lotus]
gb|KDP40108.1|  hypothetical protein JCGZ_02106                         160   2e-42   Jatropha curcas
emb|CDP03612.1|  unnamed protein product                                155   2e-42   Coffea canephora [robusta coffee]
gb|KDP21480.1|  hypothetical protein JCGZ_21951                         160   3e-42   Jatropha curcas
ref|XP_004486144.1|  PREDICTED: basic 7S globulin-like                  159   5e-42   Cicer arietinum [garbanzo]
gb|KJB61114.1|  hypothetical protein B456_009G341600                    157   1e-41   Gossypium raimondii
ref|XP_011082548.1|  PREDICTED: basic 7S globulin-like                  158   1e-41   Sesamum indicum [beniseed]
emb|CAN61502.1|  hypothetical protein VITISV_011733                     157   2e-41   Vitis vinifera
ref|XP_011026191.1|  PREDICTED: basic 7S globulin-like                  157   5e-41   Populus euphratica
ref|XP_007154122.1|  hypothetical protein PHAVU_003G092200g             156   9e-41   Phaseolus vulgaris [French bean]
gb|ACU24232.1|  unknown                                                 155   1e-40   Glycine max [soybeans]
gb|EYU38145.1|  hypothetical protein MIMGU_mgv1a006647mg                155   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_003542884.1|  PREDICTED: basic 7S globulin                       155   1e-40   Glycine max [soybeans]
ref|XP_002302122.1|  hypothetical protein POPTR_0002s05580g             155   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006489581.1|  PREDICTED: basic 7S globulin-like                  154   3e-40   
emb|CDP10858.1|  unnamed protein product                                154   3e-40   Coffea canephora [robusta coffee]
gb|KDO74788.1|  hypothetical protein CISIN_1g036132mg                   154   3e-40   Citrus sinensis [apfelsine]
ref|XP_009411762.1|  PREDICTED: basic 7S globulin-like                  154   5e-40   
ref|XP_007154121.1|  hypothetical protein PHAVU_003G092100g             153   5e-40   Phaseolus vulgaris [French bean]
ref|XP_003546133.1|  PREDICTED: basic 7S globulin                       153   7e-40   Glycine max [soybeans]
gb|KDP40112.1|  hypothetical protein JCGZ_02110                         153   8e-40   Jatropha curcas
ref|XP_011014389.1|  PREDICTED: basic 7S globulin-like                  153   9e-40   Populus euphratica
ref|NP_001239980.1|  uncharacterized protein LOC100806719 precursor     152   1e-39   Glycine max [soybeans]
gb|KHN03053.1|  Basic 7S globulin                                       152   1e-39   Glycine soja [wild soybean]
ref|XP_009342158.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    152   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_003590665.1|  Xyloglucan-specific endoglucanase inhibitor ...    152   2e-39   Medicago truncatula
ref|XP_011020124.1|  PREDICTED: basic 7S globulin-like                  151   3e-39   Populus euphratica
ref|XP_006419808.1|  hypothetical protein CICLE_v10006987mg             152   3e-39   Citrus clementina [clementine]
gb|AFK46427.1|  unknown                                                 151   3e-39   Medicago truncatula
ref|XP_002308984.2|  hypothetical protein POPTR_0006s06820g             151   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010035593.1|  PREDICTED: basic 7S globulin-like                  150   8e-39   Eucalyptus grandis [rose gum]
ref|XP_008810759.1|  PREDICTED: basic 7S globulin-like                  150   8e-39   
ref|XP_002517165.1|  basic 7S globulin 2 precursor small subunit,...    150   1e-38   Ricinus communis
ref|XP_006489295.1|  PREDICTED: basic 7S globulin-like                  150   1e-38   Citrus sinensis [apfelsine]
ref|XP_006419833.1|  hypothetical protein CICLE_v10006689mg             150   1e-38   Citrus clementina [clementine]
ref|XP_006489297.1|  PREDICTED: basic 7S globulin-like                  149   2e-38   
ref|XP_007224886.1|  hypothetical protein PRUPE_ppa022337mg             149   2e-38   
ref|XP_006489296.1|  PREDICTED: basic 7S globulin-like                  149   2e-38   Citrus sinensis [apfelsine]
ref|XP_003518926.1|  PREDICTED: basic 7S globulin                       149   3e-38   Glycine max [soybeans]
ref|XP_010255900.1|  PREDICTED: basic 7S globulin 2-like                149   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_003590668.1|  Basic 7S globulin                                  149   3e-38   Medicago truncatula
gb|KFK42682.1|  hypothetical protein AALP_AA1G026200                    149   3e-38   Arabis alpina [alpine rockcress]
ref|XP_008340919.1|  PREDICTED: basic 7S globulin                       148   4e-38   
ref|XP_006419831.1|  hypothetical protein CICLE_v10006962mg             149   4e-38   Citrus clementina [clementine]
ref|XP_004298169.1|  PREDICTED: basic 7S globulin-like                  148   5e-38   Fragaria vesca subsp. vesca
ref|XP_010278291.1|  PREDICTED: basic 7S globulin-like                  149   5e-38   Nelumbo nucifera [Indian lotus]
gb|KHN03449.1|  Basic 7S globulin                                       148   5e-38   Glycine soja [wild soybean]
ref|XP_003550008.2|  PREDICTED: basic 7S globulin 2-like                148   6e-38   
ref|XP_008222987.1|  PREDICTED: basic 7S globulin-like                  148   6e-38   Prunus mume [ume]
ref|XP_006419811.1|  hypothetical protein CICLE_v10004995mg             147   9e-38   
emb|CDX86682.1|  BnaC08g00210D                                          147   9e-38   
ref|XP_006419809.1|  hypothetical protein CICLE_v10004993mg             147   9e-38   Citrus clementina [clementine]
emb|CDY15456.1|  BnaA08g27400D                                          147   9e-38   Brassica napus [oilseed rape]
gb|KJB46995.1|  hypothetical protein B456_008G005100                    147   1e-37   Gossypium raimondii
ref|XP_006419829.1|  hypothetical protein CICLE_v100071811mg            145   2e-37   
ref|XP_008222998.1|  PREDICTED: basic 7S globulin 2                     146   2e-37   Prunus mume [ume]
ref|XP_011015097.1|  PREDICTED: basic 7S globulin-like isoform X2       147   2e-37   Populus euphratica
gb|KFK42681.1|  hypothetical protein AALP_AA1G026100                    147   2e-37   Arabis alpina [alpine rockcress]
ref|XP_011011197.1|  PREDICTED: basic 7S globulin-like isoform X2       146   2e-37   Populus euphratica
ref|XP_011011196.1|  PREDICTED: basic 7S globulin-like isoform X1       147   2e-37   Populus euphratica
ref|XP_011015096.1|  PREDICTED: basic 7S globulin-like isoform X1       146   2e-37   Populus euphratica
ref|XP_007147764.1|  hypothetical protein PHAVU_006G153200g             145   5e-37   Phaseolus vulgaris [French bean]
ref|XP_002277699.1|  PREDICTED: basic 7S globulin-like                  145   5e-37   Vitis vinifera
ref|XP_008235257.1|  PREDICTED: basic 7S globulin 2-like                146   5e-37   Prunus mume [ume]
ref|XP_002311834.1|  hypothetical protein POPTR_0008s20730g             145   5e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007201544.1|  hypothetical protein PRUPE_ppa017430mg             145   6e-37   
ref|XP_010938774.1|  PREDICTED: basic 7S globulin-like                  145   8e-37   Elaeis guineensis
gb|KDO74795.1|  hypothetical protein CISIN_1g037976mg                   145   8e-37   Citrus sinensis [apfelsine]
ref|XP_006489309.1|  PREDICTED: basic 7S globulin-like                  145   8e-37   Citrus sinensis [apfelsine]
ref|XP_010522713.1|  PREDICTED: basic 7S globulin-like                  145   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_007034630.1|  Eukaryotic aspartyl protease family protein ...    144   1e-36   
ref|XP_006418255.1|  hypothetical protein EUTSA_v10007672mg             144   1e-36   Eutrema salsugineum [saltwater cress]
gb|KJB23117.1|  hypothetical protein B456_004G081800                    144   1e-36   Gossypium raimondii
ref|XP_008438716.1|  PREDICTED: basic 7S globulin-like isoform X1       144   2e-36   
ref|XP_006495483.1|  PREDICTED: basic 7S globulin-like                  137   2e-36   
ref|NP_001241217.1|  uncharacterized protein LOC100818868 precursor     144   2e-36   Glycine max [soybeans]
gb|EMS47745.1|  Basic 7S globulin                                       141   3e-36   Triticum urartu
ref|XP_006387875.1|  hypothetical protein POPTR_0509s00200g             143   4e-36   
ref|XP_007034629.1|  Eukaryotic aspartyl protease family protein ...    143   4e-36   
gb|KEH36784.1|  xyloglucanase-specific endoglucanase inhibitor pr...    143   5e-36   Medicago truncatula
ref|XP_004134152.1|  PREDICTED: basic 7S globulin-like                  142   6e-36   Cucumis sativus [cucumbers]
gb|KCW49915.1|  hypothetical protein EUGRSUZ_K03382                     142   6e-36   Eucalyptus grandis [rose gum]
ref|XP_008390829.1|  PREDICTED: basic 7S globulin-like                  142   7e-36   Malus domestica [apple tree]
ref|XP_008458562.1|  PREDICTED: basic 7S globulin-like                  142   8e-36   Cucumis melo [Oriental melon]
ref|XP_010111673.1|  Basic 7S globulin                                  142   9e-36   Morus notabilis
ref|XP_010038107.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    142   9e-36   
ref|NP_563679.1|  aspartyl protease-like protein                        142   9e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74796.1|  hypothetical protein CISIN_1g038219mg                   142   9e-36   Citrus sinensis [apfelsine]
ref|XP_006419827.1|  hypothetical protein CICLE_v10005000mg             142   1e-35   Citrus clementina [clementine]
ref|XP_006380060.1|  hypothetical protein POPTR_0008s20740g             142   1e-35   
ref|XP_007034627.1|  Eukaryotic aspartyl protease family protein,...    142   1e-35   
ref|XP_006489306.1|  PREDICTED: basic 7S globulin-like                  141   1e-35   Citrus sinensis [apfelsine]
gb|KDO74801.1|  hypothetical protein CISIN_1g040581mg                   141   1e-35   Citrus sinensis [apfelsine]
ref|XP_010255898.1|  PREDICTED: basic 7S globulin-like                  141   2e-35   
ref|XP_004290668.1|  PREDICTED: basic 7S globulin 2-like                141   2e-35   Fragaria vesca subsp. vesca
ref|XP_009111159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    141   2e-35   Brassica rapa
gb|KCW49914.1|  hypothetical protein EUGRSUZ_K03381                     141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_006419821.1|  hypothetical protein CICLE_v10005127mg             140   2e-35   Citrus clementina [clementine]
ref|XP_006304586.1|  hypothetical protein CARUB_v10011636mg             141   2e-35   Capsella rubella
ref|XP_010038106.1|  PREDICTED: basic 7S globulin 2-like                141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_002889446.1|  EDGP precursor                                     141   2e-35   
ref|XP_010556788.1|  PREDICTED: basic 7S globulin-like                  140   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_010278299.1|  PREDICTED: basic 7S globulin-like                  140   4e-35   Nelumbo nucifera [Indian lotus]
ref|NP_171821.1|  aspartyl protease-like protein                        140   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517164.1|  basic 7S globulin 2 precursor small subunit,...    140   4e-35   Ricinus communis
gb|KJB25917.1|  hypothetical protein B456_004G215700                    140   4e-35   Gossypium raimondii
ref|XP_010522709.1|  PREDICTED: basic 7S globulin-like                  140   6e-35   
gb|KDO35982.1|  hypothetical protein CISIN_1g037784mg                   136   6e-35   Citrus sinensis [apfelsine]
ref|XP_010481702.1|  PREDICTED: basic 7S globulin-like                  140   6e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006419823.1|  hypothetical protein CICLE_v10005035mg             139   8e-35   Citrus clementina [clementine]
ref|XP_004151001.1|  PREDICTED: basic 7S globulin-like                  139   8e-35   Cucumis sativus [cucumbers]
ref|XP_003637703.1|  Basic 7S globulin                                  139   1e-34   
gb|AFK34779.1|  unknown                                                 139   1e-34   Medicago truncatula
ref|XP_004134154.1|  PREDICTED: basic 7S globulin-like                  139   1e-34   Cucumis sativus [cucumbers]
gb|AAX81588.1|  nectarin IV                                             139   1e-34   Nicotiana langsdorffii x Nicotiana sanderae
pdb|3VLB|A  Chain A, Crystal Structure Of Xeg-edgp                      138   2e-34   Aspergillus aculeatus
dbj|BAA03413.1|  EDGP precursor                                         139   2e-34   Daucus carota [carrots]
pdb|3VLA|A  Chain A, Crystal Structure Of Edgp                          138   2e-34   Daucus carota [carrots]
ref|XP_006296506.1|  hypothetical protein CARUB_v10025694mg             139   2e-34   Capsella rubella
gb|AAT85209.1|  unknown protein                                         135   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006419825.1|  hypothetical protein CICLE_v10007108mg             138   2e-34   
gb|AAM61574.1|  EDGP precursor                                          138   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495218.1|  PREDICTED: basic 7S globulin 2-like                138   3e-34   Cicer arietinum [garbanzo]
ref|XP_007034624.1|  Eukaryotic aspartyl protease family protein,...    137   4e-34   
emb|CDO98879.1|  unnamed protein product                                137   4e-34   Coffea canephora [robusta coffee]
gb|AIL30493.1|  xyloglucan-specific fungal endoglucanase inhibito...    137   5e-34   Nicotiana tabacum [American tobacco]
ref|XP_011099700.1|  PREDICTED: basic 7S globulin-like                  137   5e-34   
ref|XP_009611839.1|  PREDICTED: basic 7S globulin-like                  137   5e-34   Nicotiana tomentosiformis
ref|XP_006489308.1|  PREDICTED: basic 7S globulin-like                  137   5e-34   Citrus sinensis [apfelsine]
ref|XP_004236054.1|  PREDICTED: basic 7S globulin-like                  137   5e-34   Solanum lycopersicum
dbj|BAJ94733.1|  predicted protein                                      137   5e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002877156.1|  hypothetical protein ARALYDRAFT_484681             137   6e-34   
ref|XP_010457326.1|  PREDICTED: basic 7S globulin-like                  137   6e-34   
gb|AAP84703.1|  putative xyloglucanase inhibitor                        137   6e-34   Solanum tuberosum [potatoes]
ref|XP_008438718.1|  PREDICTED: basic 7S globulin-like                  137   7e-34   Cucumis melo [Oriental melon]
ref|XP_010474940.1|  PREDICTED: basic 7S globulin-like                  137   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004170412.1|  PREDICTED: basic 7S globulin-like                  136   8e-34   
ref|XP_008438715.1|  PREDICTED: basic 7S globulin-like                  137   8e-34   Cucumis melo [Oriental melon]
ref|XP_010678844.1|  PREDICTED: basic 7S globulin 2-like                137   8e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007144622.1|  hypothetical protein PHAVU_007G170900g             137   8e-34   Phaseolus vulgaris [French bean]
gb|KCW58886.1|  hypothetical protein EUGRSUZ_H01512                     135   9e-34   Eucalyptus grandis [rose gum]
ref|XP_007034628.1|  Eukaryotic aspartyl protease family protein,...    136   9e-34   
gb|ACM68432.1|  xyloglucanase-specific endoglucanase inhibitor pr...    136   1e-33   Petunia x hybrida [garden petunia]
ref|XP_009773897.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Nicotiana sylvestris
ref|XP_010475063.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010483190.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009118711.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Brassica rapa
ref|XP_010457449.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004170542.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    136   1e-33   
ref|XP_004134153.1|  PREDICTED: basic 7S globulin-like                  136   1e-33   Cucumis sativus [cucumbers]
ref|NP_001234746.1|  xyloglucan-specific fungal endoglucanase inh...    136   1e-33   
dbj|BAK57511.1|  extracellular dermal glycoprotein                      136   1e-33   Nicotiana benthamiana
emb|CDY32500.1|  BnaA09g50960D                                          136   1e-33   Brassica napus [oilseed rape]
ref|XP_004486304.1|  PREDICTED: basic 7S globulin 2-like                135   2e-33   Cicer arietinum [garbanzo]
ref|XP_009364261.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    135   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_006345120.1|  PREDICTED: basic 7S globulin-like                  135   2e-33   Solanum tuberosum [potatoes]
ref|XP_010026234.1|  PREDICTED: basic 7S globulin-like                  135   3e-33   Eucalyptus grandis [rose gum]
gb|KDO74797.1|  hypothetical protein CISIN_1g044303mg                   135   3e-33   Citrus sinensis [apfelsine]
gb|ACM68431.1|  xyloglucan-specific endoglucanase inhibitor protein     135   3e-33   Capsicum annuum
ref|XP_009356759.1|  PREDICTED: basic 7S globulin                       135   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009757289.1|  PREDICTED: basic 7S globulin-like                  135   4e-33   Nicotiana sylvestris
ref|NP_001055496.1|  Os05g0402900                                       135   4e-33   
gb|EEE63670.1|  hypothetical protein OsJ_18488                          134   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008355568.1|  PREDICTED: basic 7S globulin-like                  134   5e-33   Malus domestica [apple tree]
gb|KCW84282.1|  hypothetical protein EUGRSUZ_B01133                     134   5e-33   Eucalyptus grandis [rose gum]
ref|XP_007222421.1|  hypothetical protein PRUPE_ppa006071mg             134   5e-33   
gb|KDP40110.1|  hypothetical protein JCGZ_02108                         134   5e-33   Jatropha curcas
ref|XP_006489307.1|  PREDICTED: basic 7S globulin-like                  134   6e-33   Citrus sinensis [apfelsine]
ref|XP_010045852.1|  PREDICTED: basic 7S globulin-like                  134   6e-33   Eucalyptus grandis [rose gum]
ref|XP_006345119.1|  PREDICTED: basic 7S globulin-like                  134   8e-33   Solanum tuberosum [potatoes]
gb|EAY97992.1|  hypothetical protein OsI_19909                          134   8e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004495219.1|  PREDICTED: basic 7S globulin-like                  134   9e-33   Cicer arietinum [garbanzo]
ref|NP_001234249.1|  xyloglucan-specific fungal endoglucanase inh...    133   1e-32   
gb|ACJ85243.1|  unknown                                                 129   1e-32   Medicago truncatula
gb|KJB70565.1|  hypothetical protein B456_011G080800                    133   2e-32   Gossypium raimondii
ref|XP_008222995.1|  PREDICTED: basic 7S globulin-like                  133   2e-32   Prunus mume [ume]
ref|XP_009595035.1|  PREDICTED: basic 7S globulin-like                  132   3e-32   Nicotiana tomentosiformis
ref|XP_007050654.1|  Eukaryotic aspartyl protease family protein,...    132   3e-32   
ref|XP_004229432.1|  PREDICTED: basic 7S globulin-like                  132   3e-32   Solanum lycopersicum
ref|XP_011079830.1|  PREDICTED: basic 7S globulin-like                  132   3e-32   Sesamum indicum [beniseed]
ref|XP_004508379.1|  PREDICTED: basic 7S globulin-like                  132   4e-32   Cicer arietinum [garbanzo]
ref|XP_007162407.1|  hypothetical protein PHAVU_001G149500g             132   4e-32   Phaseolus vulgaris [French bean]
gb|KDO74789.1|  hypothetical protein CISIN_1g014679mg                   132   4e-32   Citrus sinensis [apfelsine]
ref|XP_002517167.1|  basic 7S globulin 2 precursor small subunit,...    132   4e-32   Ricinus communis
ref|XP_002272199.2|  PREDICTED: basic 7S globulin 2-like                132   5e-32   Vitis vinifera
ref|XP_007224945.1|  hypothetical protein PRUPE_ppa021451mg             132   5e-32   Prunus persica
gb|ADD71505.1|  xyloglucanase inhibitor 3                               132   5e-32   Humulus lupulus [common hop]
ref|XP_008649625.1|  PREDICTED: basic 7S globulin-like                  131   6e-32   Zea mays [maize]
ref|XP_006366973.1|  PREDICTED: basic 7S globulin-like                  130   6e-32   
ref|XP_006654378.1|  PREDICTED: basic 7S globulin-like                  131   7e-32   Oryza brachyantha
gb|KCW58887.1|  hypothetical protein EUGRSUZ_H01513                     131   7e-32   Eucalyptus grandis [rose gum]
ref|XP_010024401.1|  PREDICTED: basic 7S globulin 2-like                131   8e-32   Eucalyptus grandis [rose gum]
gb|EEE63672.1|  hypothetical protein OsJ_18490                          131   8e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174419.1|  Os05g0403000                                       131   8e-32   
ref|XP_009773278.1|  PREDICTED: basic 7S globulin-like                  131   8e-32   Nicotiana sylvestris
ref|XP_010026235.1|  PREDICTED: basic 7S globulin-like                  131   8e-32   Eucalyptus grandis [rose gum]
gb|AAT85211.1|  hypothetical protein                                    130   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006419826.1|  hypothetical protein CICLE_v10006501mg             130   1e-31   
gb|KCW58889.1|  hypothetical protein EUGRSUZ_H015141                    126   1e-31   Eucalyptus grandis [rose gum]
gb|ADG23123.1|  xyloglucan specific endoglucanase inhibitor             130   1e-31   Solanum melongena [aubergine]
ref|XP_004247154.1|  PREDICTED: basic 7S globulin-like                  130   1e-31   Solanum lycopersicum
gb|KCW45638.1|  hypothetical protein EUGRSUZ_L005902                    126   1e-31   Eucalyptus grandis [rose gum]
ref|XP_009597883.1|  PREDICTED: basic 7S globulin-like                  130   1e-31   Nicotiana tomentosiformis
gb|EPS72958.1|  hypothetical protein M569_01796                         130   2e-31   Genlisea aurea
ref|XP_006349243.1|  PREDICTED: basic 7S globulin-like                  130   2e-31   
ref|NP_001274964.1|  xyloglucan-specific endoglucanase inhibitor ...    130   2e-31   Solanum tuberosum [potatoes]
ref|XP_006850763.1|  hypothetical protein AMTR_s00025p00079140          130   2e-31   Amborella trichopoda
ref|XP_009625778.1|  PREDICTED: basic 7S globulin-like                  129   3e-31   Nicotiana tomentosiformis
ref|XP_006472113.1|  PREDICTED: basic 7S globulin-like                  127   3e-31   
emb|CDY15455.1|  BnaA08g27390D                                          129   5e-31   Brassica napus [oilseed rape]
ref|XP_009342159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    129   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_004229434.1|  PREDICTED: basic 7S globulin-like                  129   5e-31   Solanum lycopersicum
ref|XP_004962140.1|  PREDICTED: basic 7S globulin-like                  129   6e-31   Setaria italica
ref|XP_006489313.1|  PREDICTED: basic 7S globulin-like                  129   6e-31   Citrus sinensis [apfelsine]
gb|AES60912.2|  xyloglucanase-specific endoglucanase inhibitor pr...    129   6e-31   Medicago truncatula
ref|XP_006419832.1|  hypothetical protein CICLE_v10005038mg             129   6e-31   Citrus clementina [clementine]
ref|XP_003590661.1|  Basic 7S globulin                                  129   6e-31   
ref|XP_009111160.1|  PREDICTED: basic 7S globulin-like                  128   8e-31   Brassica rapa
gb|KDP40111.1|  hypothetical protein JCGZ_02109                         126   9e-31   Jatropha curcas
gb|KDP25943.1|  hypothetical protein JCGZ_22848                         128   9e-31   Jatropha curcas
ref|XP_006419822.1|  hypothetical protein CICLE_v10007187mg             128   1e-30   Citrus clementina [clementine]
gb|KDO74800.1|  hypothetical protein CISIN_1g036447mg                   127   1e-30   Citrus sinensis [apfelsine]
ref|XP_009591595.1|  PREDICTED: basic 7S globulin-like                  128   1e-30   
gb|KCW84281.1|  hypothetical protein EUGRSUZ_B01132                     126   1e-30   Eucalyptus grandis [rose gum]
ref|XP_006433276.1|  hypothetical protein CICLE_v10003944mg             127   1e-30   
gb|KDP21481.1|  hypothetical protein JCGZ_21952                         127   1e-30   Jatropha curcas
ref|XP_003520561.1|  PREDICTED: basic 7S globulin-like                  127   2e-30   Glycine max [soybeans]
ref|XP_010026985.1|  PREDICTED: basic 7S globulin-like                  127   2e-30   
gb|EYU41534.1|  hypothetical protein MIMGU_mgv1a008121mg                127   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_006489578.1|  PREDICTED: basic 7S globulin-like                  127   2e-30   Citrus sinensis [apfelsine]
ref|XP_009787261.1|  PREDICTED: basic 7S globulin-like                  127   2e-30   Nicotiana sylvestris
gb|KCW60840.1|  hypothetical protein EUGRSUZ_H03578                     126   3e-30   Eucalyptus grandis [rose gum]
ref|XP_006371344.1|  hypothetical protein POPTR_0019s09280g             126   4e-30   
ref|XP_006371346.1|  hypothetical protein POPTR_0019s09300g             126   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011005003.1|  PREDICTED: basic 7S globulin-like                  123   8e-30   Populus euphratica
ref|XP_006349245.1|  PREDICTED: basic 7S globulin-like                  125   1e-29   Solanum tuberosum [potatoes]
ref|XP_010035585.1|  PREDICTED: basic 7S globulin                       125   1e-29   Eucalyptus grandis [rose gum]
ref|XP_003591797.1|  Xyloglucan-specific endoglucanase inhibitor ...    125   1e-29   Medicago truncatula
ref|XP_010999511.1|  PREDICTED: basic 7S globulin-like                  125   1e-29   Populus euphratica
ref|XP_010026236.1|  PREDICTED: basic 7S globulin-like                  125   1e-29   Eucalyptus grandis [rose gum]
gb|EYU20615.1|  hypothetical protein MIMGU_mgv1a006692mg                125   1e-29   Erythranthe guttata [common monkey flower]
gb|KJB45207.1|  hypothetical protein B456_007G295400                    124   2e-29   Gossypium raimondii
gb|KCW60850.1|  hypothetical protein EUGRSUZ_H03588                     124   2e-29   Eucalyptus grandis [rose gum]
ref|XP_011082639.1|  PREDICTED: basic 7S globulin 2-like                124   2e-29   
gb|ABR17052.1|  unknown                                                 124   2e-29   Picea sitchensis
gb|KJB26454.1|  hypothetical protein B456_004G242400                    124   2e-29   Gossypium raimondii
ref|XP_007030900.1|  Eukaryotic aspartyl protease family protein,...    124   3e-29   Theobroma cacao [chocolate]
ref|XP_009596039.1|  PREDICTED: basic 7S globulin-like                  123   4e-29   Nicotiana tomentosiformis
ref|XP_011462765.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    123   5e-29   Fragaria vesca subsp. vesca
ref|XP_006371348.1|  hypothetical protein POPTR_0019s09320g             123   5e-29   
ref|XP_006388043.1|  hypothetical protein POPTR_0382s00210g             123   5e-29   
ref|XP_010256207.1|  PREDICTED: basic 7S globulin 2-like                123   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006388012.1|  hypothetical protein POPTR_0397s00200g             123   6e-29   
gb|ADD71504.1|  xyloglucanase inhibitor 2                               123   6e-29   Humulus lupulus [common hop]
ref|XP_002517163.1|  basic 7S globulin 2 precursor small subunit,...    123   6e-29   
gb|KHN37574.1|  Basic 7S globulin 2                                     122   9e-29   Glycine soja [wild soybean]
ref|XP_006371347.1|  hypothetical protein POPTR_0019s09310g             122   9e-29   
gb|EYU20620.1|  hypothetical protein MIMGU_mgv1a006733mg                122   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_010325564.1|  PREDICTED: basic 7S globulin-like                  122   1e-28   Solanum lycopersicum
gb|AHG54973.1|  xyloglucan-specific endoglucanase inhibitor 10          122   1e-28   Solanum tuberosum [potatoes]
gb|EEE63673.1|  hypothetical protein OsJ_18491                          122   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20619.1|  hypothetical protein MIMGU_mgv1a026442mg                122   2e-28   Erythranthe guttata [common monkey flower]
gb|KEH36782.1|  xyloglucanase-specific endoglucanase inhibitor pr...    121   2e-28   Medicago truncatula
ref|XP_002513220.1|  conserved hypothetical protein                     117   2e-28   
ref|XP_006369525.1|  hypothetical protein POPTR_0001s24740g             121   2e-28   
ref|NP_001055497.1|  Os05g0403300                                       121   3e-28   
ref|XP_004229433.1|  PREDICTED: basic 7S globulin-like                  121   3e-28   
ref|XP_010039912.1|  PREDICTED: basic 7S globulin-like                  121   4e-28   
ref|XP_006349244.1|  PREDICTED: basic 7S globulin-like                  120   4e-28   
gb|EPS73324.1|  hypothetical protein M569_01438                         120   5e-28   
ref|XP_009769391.1|  PREDICTED: basic 7S globulin-like                  120   5e-28   
ref|XP_010999512.1|  PREDICTED: basic 7S globulin-like                  120   6e-28   
ref|XP_006371343.1|  hypothetical protein POPTR_0019s09270g             120   6e-28   
ref|XP_006850764.1|  hypothetical protein AMTR_s00025p00079520          120   6e-28   
ref|XP_004495384.1|  PREDICTED: basic 7S globulin-like                  120   6e-28   
ref|XP_006654379.1|  PREDICTED: basic 7S globulin-like                  120   8e-28   
gb|EYU20618.1|  hypothetical protein MIMGU_mgv1a018279mg                119   9e-28   
gb|KDP40109.1|  hypothetical protein JCGZ_02107                         119   1e-27   
gb|EYU20616.1|  hypothetical protein MIMGU_mgv1a026206mg                119   2e-27   
gb|ADD71503.1|  xyloglucanase inhibitor 1                               119   2e-27   
ref|XP_003568479.1|  PREDICTED: basic 7S globulin-like                  119   2e-27   
ref|XP_010524801.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    119   2e-27   
gb|KEH36786.1|  extracellular dermal glycoprotein                       119   2e-27   
ref|XP_002517166.1|  ATP binding protein, putative                      117   2e-27   
gb|ADK87883.1|  AtV9-like protein                                       113   3e-27   
emb|CAN68737.1|  hypothetical protein VITISV_030194                     118   3e-27   
gb|ADK87894.1|  AtV9-like protein                                       113   3e-27   
ref|XP_010659830.1|  PREDICTED: basic 7S globulin-like                  118   3e-27   
gb|EYU46598.1|  hypothetical protein MIMGU_mgv1a019870mg                117   4e-27   
ref|XP_004229563.2|  PREDICTED: basic 7S globulin-like                  117   4e-27   
gb|KEH36787.1|  extracellular dermal glycoprotein                       118   4e-27   
ref|XP_010045855.1|  PREDICTED: basic 7S globulin-like                  117   4e-27   
gb|AFK42891.1|  unknown                                                 117   4e-27   
gb|KCW84284.1|  hypothetical protein EUGRSUZ_B01136                     117   4e-27   
ref|XP_010026986.1|  PREDICTED: basic 7S globulin-like                  114   4e-27   
ref|XP_007143872.1|  hypothetical protein PHAVU_007G109000g             117   5e-27   
ref|XP_010420702.1|  PREDICTED: basic 7S globulin 2-like                117   5e-27   
emb|CBI26188.3|  unnamed protein product                                117   5e-27   
gb|KFK26154.1|  hypothetical protein AALP_AA8G210500                    117   6e-27   
gb|AFK42416.1|  unknown                                                 117   6e-27   
gb|ADK87876.1|  AtV9-like protein                                       112   8e-27   
gb|ADK87882.1|  AtV9-like protein                                       112   8e-27   
ref|XP_011091047.1|  PREDICTED: basic 7S globulin 2-like                117   8e-27   
ref|XP_011091050.1|  PREDICTED: basic 7S globulin 2-like                117   9e-27   
ref|XP_002439768.1|  hypothetical protein SORBIDRAFT_09g019770          117   9e-27   
emb|CDX70865.1|  BnaC03g09490D                                          116   1e-26   
ref|XP_006349246.1|  PREDICTED: basic 7S globulin-like                  116   2e-26   
ref|XP_006352883.1|  PREDICTED: basic 7S globulin-like isoform X1       115   2e-26   
gb|KDP23539.1|  hypothetical protein JCGZ_23372                         112   2e-26   
ref|XP_011011027.1|  PREDICTED: basic 7S globulin-like                  116   2e-26   
ref|XP_004231264.1|  PREDICTED: basic 7S globulin-like                  115   2e-26   
gb|KHN30567.1|  Basic 7S globulin                                       115   2e-26   
ref|XP_003536212.1|  PREDICTED: basic 7S globulin-like                  115   2e-26   
gb|ADK87879.1|  AtV9-like protein                                       110   4e-26   
gb|ADK87896.1|  AtV9-like protein                                       110   4e-26   
gb|ADK87880.1|  AtV9-like protein                                       110   4e-26   
ref|XP_006349258.1|  PREDICTED: basic 7S globulin-like                  114   5e-26   
gb|EYU41535.1|  hypothetical protein MIMGU_mgv1a007318mg                114   6e-26   
ref|XP_011091049.1|  PREDICTED: basic 7S globulin 2-like                114   6e-26   
ref|XP_009786807.1|  PREDICTED: basic 7S globulin-like                  114   6e-26   
gb|EYU41536.1|  hypothetical protein MIMGU_mgv1a024772mg                114   7e-26   
ref|XP_010690125.1|  PREDICTED: basic 7S globulin-like                  114   7e-26   
ref|XP_010454178.1|  PREDICTED: basic 7S globulin 2-like                114   8e-26   
ref|XP_011091048.1|  PREDICTED: basic 7S globulin-like                  114   9e-26   
gb|EYU41533.1|  hypothetical protein MIMGU_mgv1a011412mg                112   1e-25   
gb|AFF60302.1|  xyloglucanase-specific endoglucanase inhibitor          113   1e-25   
ref|XP_011090790.1|  PREDICTED: basic 7S globulin-like                  113   2e-25   
ref|XP_002871863.1|  pepsin A                                           112   2e-25   
ref|XP_008363982.1|  PREDICTED: basic 7S globulin-like                  113   2e-25   
ref|XP_009613161.1|  PREDICTED: basic 7S globulin-like                  113   2e-25   
gb|KJB26455.1|  hypothetical protein B456_004G242500                    112   3e-25   
ref|XP_010454177.1|  PREDICTED: basic 7S globulin 2-like                112   3e-25   
ref|XP_006361904.1|  PREDICTED: basic 7S globulin-like                  112   3e-25   
ref|XP_004486143.1|  PREDICTED: basic 7S globulin-like                  112   3e-25   
ref|XP_006844967.1|  hypothetical protein AMTR_s00058p00179910          112   4e-25   
ref|XP_006349239.1|  PREDICTED: basic 7S globulin-like                  112   4e-25   
ref|XP_010026990.1|  PREDICTED: basic 7S globulin-like                  110   4e-25   
ref|XP_010677554.1|  PREDICTED: basic 7S globulin-like                  112   5e-25   
gb|AER26945.1|  xyloglucan-specific endoglucanase inhibitor 9           112   5e-25   
ref|XP_010693887.1|  PREDICTED: basic 7S globulin-like                  111   5e-25   
ref|XP_006388014.1|  hypothetical protein POPTR_0397s00220g             112   5e-25   
emb|CDP03610.1|  unnamed protein product                                111   8e-25   
ref|XP_002517175.1|  pepsin A, putative                                 111   8e-25   
ref|XP_010667343.1|  PREDICTED: basic 7S globulin-like                  111   8e-25   
ref|XP_006382966.1|  hypothetical protein POPTR_0005s09840g             111   9e-25   
ref|XP_002529699.1|  basic 7S globulin 2 precursor small subunit,...    110   1e-24   
emb|CDP19874.1|  unnamed protein product                                110   1e-24   
ref|XP_009126299.1|  PREDICTED: basic 7S globulin 2-like                110   1e-24   
ref|XP_010694712.1|  PREDICTED: basic 7S globulin-like                  110   1e-24   
ref|XP_007147760.1|  hypothetical protein PHAVU_006G152800g             110   2e-24   
ref|NP_197413.1|  aspartyl protease family protein                      110   2e-24   
emb|CAC10209.1|  putative extracellular dermal glycoprotein             110   2e-24   
ref|XP_003556387.1|  PREDICTED: basic 7S globulin                       110   2e-24   
ref|XP_007147763.1|  hypothetical protein PHAVU_006G153100g             110   2e-24   
ref|XP_009615960.1|  PREDICTED: basic 7S globulin-like                  110   2e-24   
ref|XP_010492957.1|  PREDICTED: basic 7S globulin 2-like                110   2e-24   
gb|KCW60844.1|  hypothetical protein EUGRSUZ_H03581                     109   2e-24   
ref|XP_010492960.1|  PREDICTED: basic 7S globulin 2-like                109   2e-24   
ref|XP_010024400.1|  PREDICTED: basic 7S globulin 2-like                109   3e-24   
ref|XP_010322603.1|  PREDICTED: basic 7S globulin-like isoform X2       109   3e-24   
gb|KCW85154.1|  hypothetical protein EUGRSUZ_B01995                     109   3e-24   
gb|AGT17598.1|  xyloglucan-specific endoglucanase inhibitor 11          109   3e-24   
gb|KDO38562.1|  hypothetical protein CISIN_1g040428mg                   108   3e-24   
emb|CDX88901.1|  BnaA03g07480D                                          109   3e-24   
ref|XP_010322595.1|  PREDICTED: basic 7S globulin-like isoform X1       109   3e-24   
ref|XP_010046260.1|  PREDICTED: basic 7S globulin-like                  109   4e-24   
ref|XP_004229431.1|  PREDICTED: basic 7S globulin-like                  109   4e-24   
gb|KEH36777.1|  extracellular dermal glycoprotein                       108   5e-24   
ref|XP_004246189.2|  PREDICTED: basic 7S globulin-like                  108   5e-24   
emb|CDY13979.1|  BnaC09g38470D                                          108   5e-24   
ref|XP_002517173.1|  pepsin A, putative                                 108   7e-24   
ref|XP_006654380.1|  PREDICTED: basic 7S globulin-like                  108   7e-24   
ref|XP_006352950.1|  PREDICTED: basic 7S globulin-like                  108   9e-24   
gb|KEH36779.1|  extracellular dermal glycoprotein                       108   9e-24   
ref|XP_004246190.2|  PREDICTED: basic 7S globulin-like                  108   1e-23   
emb|CDX92553.1|  BnaA10g15920D                                          107   1e-23   
ref|XP_009120915.1|  PREDICTED: basic 7S globulin 2                     107   1e-23   
ref|XP_010086743.1|  Basic 7S globulin                                  107   2e-23   
gb|KDP40115.1|  hypothetical protein JCGZ_02113                         107   2e-23   
dbj|BAE99306.1|  conglutin gamma - like protein                         107   2e-23   
gb|KHN37577.1|  Basic 7S globulin                                       107   3e-23   
ref|XP_003542883.1|  PREDICTED: basic 7S globulin-like                  107   3e-23   
ref|XP_002517174.1|  conserved hypothetical protein                     107   3e-23   
gb|KEH36780.1|  extracellular dermal glycoprotein                       106   5e-23   
ref|XP_006400469.1|  hypothetical protein EUTSA_v10013774mg             105   5e-23   
ref|XP_007034625.1|  Eukaryotic aspartyl protease family protein,...    100   5e-23   
ref|XP_006844968.1|  hypothetical protein AMTR_s00058p00180190          106   5e-23   
emb|CDY47198.1|  BnaAnng08680D                                          105   5e-23   
ref|XP_007147762.1|  hypothetical protein PHAVU_006G153000g             105   8e-23   
ref|XP_010424178.1|  PREDICTED: basic 7S globulin-like                  103   8e-23   
gb|AEG74550.1|  xyloglucan specific endoglucanase inhibitor             105   9e-23   
ref|XP_009373976.1|  PREDICTED: basic 7S globulin-like                  105   9e-23   
emb|CDY59021.1|  BnaCnng34100D                                          105   1e-22   
ref|XP_009349976.1|  PREDICTED: basic 7S globulin-like                  105   1e-22   
gb|AED02502.1|  xyloglucan-specific endoglucanase inhibitor             105   1e-22   
gb|KEH36774.1|  eukaryotic aspartyl protease family protein             105   1e-22   
ref|XP_006289450.1|  hypothetical protein CARUB_v10002965mg             104   1e-22   
ref|XP_004229430.1|  PREDICTED: basic 7S globulin-like                  104   2e-22   
ref|XP_009760543.1|  PREDICTED: basic 7S globulin-like                  104   2e-22   
ref|XP_009133965.1|  PREDICTED: basic 7S globulin-like                  104   2e-22   
ref|NP_001274881.1|  xyloglucan-specific endoglucanase inhibitor 8      104   2e-22   
ref|XP_006349240.1|  PREDICTED: basic 7S globulin-like                  104   2e-22   
emb|CDY37437.1|  BnaC08g45750D                                        99.4    2e-22   
gb|KCW60847.1|  hypothetical protein EUGRSUZ_H03585                     104   2e-22   
emb|CDX83218.1|  BnaA03g22880D                                          103   3e-22   
gb|KHN37576.1|  Basic 7S globulin 2                                     103   3e-22   
ref|XP_006850766.1|  hypothetical protein AMTR_s00025p00080690          103   3e-22   
ref|XP_010420700.1|  PREDICTED: basic 7S globulin 2-like                103   5e-22   
gb|KDP40113.1|  hypothetical protein JCGZ_02111                         103   6e-22   
dbj|BAF00627.1|  dermal glycoprotein - like                             102   7e-22   
ref|XP_002873929.1|  hypothetical protein ARALYDRAFT_909934             102   7e-22   
ref|NP_197412.1|  Eukaryotic aspartyl protease family protein           102   7e-22   
ref|XP_010420701.1|  PREDICTED: basic 7S globulin 2-like                102   7e-22   
gb|AFH67006.1|  xyloglucan-specific endo-beta-1,4-glucanase inhib...    102   8e-22   
ref|XP_010492959.1|  PREDICTED: basic 7S globulin 2-like                102   9e-22   
ref|XP_008366845.1|  PREDICTED: basic 7S globulin-like                  102   1e-21   
ref|XP_006349257.1|  PREDICTED: basic 7S globulin-like                  102   2e-21   
gb|KHN22268.1|  Basic 7S globulin 2                                     102   2e-21   
ref|NP_001274908.1|  xyloglucan-specific endoglucanase inhibitor ...    102   2e-21   
gb|KDP40116.1|  hypothetical protein JCGZ_02114                         103   2e-21   
gb|ADX66725.1|  xyloglucan-specific endoglucanase inhibitor prote...    101   2e-21   
ref|XP_002517171.1|  basic 7S globulin 2 precursor small subunit,...    102   2e-21   
ref|XP_003527698.1|  PREDICTED: basic 7S globulin 2                     101   2e-21   
ref|XP_006289574.1|  hypothetical protein CARUB_v10003127mg             101   2e-21   
ref|XP_004148901.1|  PREDICTED: basic 7S globulin 2-like                101   2e-21   
ref|XP_004170870.1|  PREDICTED: basic 7S globulin 2-like                101   2e-21   
ref|XP_009414183.1|  PREDICTED: basic 7S globulin 2-like                100   5e-21   
gb|KCW58885.1|  hypothetical protein EUGRSUZ_H01511                     100   5e-21   
gb|KCW45650.1|  hypothetical protein EUGRSUZ_L006051                  98.2    6e-21   
ref|XP_011091045.1|  PREDICTED: basic 7S globulin 2                     100   6e-21   
gb|EMT02113.1|  Basic 7S globulin                                     95.1    6e-21   
ref|XP_010039919.1|  PREDICTED: basic 7S globulin-like                97.8    7e-21   
ref|XP_010492954.1|  PREDICTED: basic 7S globulin-like                99.8    7e-21   
ref|XP_010497267.1|  PREDICTED: uncharacterized protein LOC104774336  97.8    8e-21   
emb|CDO99000.1|  unnamed protein product                              99.8    8e-21   
ref|XP_010026233.1|  PREDICTED: basic 7S globulin-like                99.8    9e-21   
ref|XP_009597882.1|  PREDICTED: basic 7S globulin-like                  100   9e-21   
ref|XP_010045849.1|  PREDICTED: basic 7S globulin 2-like              99.4    1e-20   
ref|XP_010492950.1|  PREDICTED: basic 7S globulin-like                99.0    1e-20   
ref|XP_004229564.1|  PREDICTED: basic 7S globulin-like                99.4    1e-20   
ref|XP_010041968.1|  PREDICTED: basic 7S globulin-like                99.4    1e-20   
ref|NP_197411.1|  Eukaryotic aspartyl protease family protein         98.6    2e-20   
ref|XP_010420698.1|  PREDICTED: uncharacterized protein LOC104706...  99.0    2e-20   
gb|ABK28703.1|  unknown                                               98.6    2e-20   
ref|XP_010039917.1|  PREDICTED: basic 7S globulin 2-like              99.0    2e-20   
ref|XP_002873931.1|  hypothetical protein ARALYDRAFT_351013           98.6    2e-20   
dbj|BAD33624.1|  putative dermal glycoprotein precursor, extracel...  99.0    2e-20   
ref|XP_010456587.1|  PREDICTED: uncharacterized protein LOC104738046  98.2    3e-20   
ref|XP_002873930.1|  hypothetical protein ARALYDRAFT_488794           97.8    3e-20   
ref|NP_199654.1|  aspartyl protease family protein                    98.2    3e-20   
ref|XP_009790669.1|  PREDICTED: basic 7S globulin-like                95.5    3e-20   
ref|XP_010492952.1|  PREDICTED: aspartic proteinase nepenthesin-1...  97.8    4e-20   
gb|EYU22657.1|  hypothetical protein MIMGU_mgv1a022346mg              98.2    4e-20   
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                     97.4    4e-20   
ref|XP_004229562.1|  PREDICTED: basic 7S globulin-like                97.8    4e-20   
ref|XP_010524799.1|  PREDICTED: basic 7S globulin-like                97.8    5e-20   
ref|XP_007034631.1|  Basic 7S globulin precursor, putative            97.8    8e-20   
ref|XP_006400466.1|  hypothetical protein EUTSA_v10013672mg           96.7    9e-20   
gb|KFK26153.1|  hypothetical protein AALP_AA8G210400                  96.7    9e-20   
ref|XP_010492951.1|  PREDICTED: basic 7S globulin-like                96.3    1e-19   
ref|XP_009625013.1|  PREDICTED: basic 7S globulin-like                96.7    1e-19   
gb|EEC84612.1|  hypothetical protein OsI_31447                        98.2    1e-19   
ref|XP_006400467.1|  hypothetical protein EUTSA_v10013760mg           95.9    1e-19   
emb|CDY47196.1|  BnaAnng08660D                                        96.3    1e-19   
ref|XP_008451375.1|  PREDICTED: basic 7S globulin 2                   97.1    1e-19   
ref|XP_010492955.1|  PREDICTED: basic 7S globulin-like                95.9    1e-19   
emb|CDY13970.1|  BnaC09g38560D                                        95.9    2e-19   
gb|KCW84248.1|  hypothetical protein EUGRSUZ_B01106                   95.9    2e-19   
ref|XP_009126298.1|  PREDICTED: basic 7S globulin 2-like              95.5    2e-19   
ref|XP_006432971.1|  hypothetical protein CICLE_v10003177mg           92.8    2e-19   
ref|XP_010045844.1|  PREDICTED: basic 7S globulin-like                95.9    2e-19   
emb|CDY47197.1|  BnaAnng08670D                                        95.1    2e-19   
gb|KEH16271.1|  basic 7S globulin 2 small subunit, putative           95.1    2e-19   
ref|XP_011078750.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  95.5    3e-19   
emb|CDY13967.1|  BnaC09g38590D                                        92.4    3e-19   
emb|CDY13962.1|  BnaC09g38640D                                        95.1    4e-19   
ref|XP_009126297.1|  PREDICTED: basic 7S globulin-like                94.7    4e-19   
ref|XP_010420697.1|  PREDICTED: basic 7S globulin-like                94.7    4e-19   
emb|CDX92556.1|  BnaA10g15950D                                        94.7    4e-19   
emb|CDX92555.1|  BnaA10g15940D                                        94.0    5e-19   
emb|CDY02588.1|  BnaC02g08470D                                        94.4    5e-19   
ref|XP_010045848.1|  PREDICTED: basic 7S globulin 2-like              92.8    9e-19   
gb|KCW84275.1|  hypothetical protein EUGRSUZ_B01126                   92.4    1e-18   
ref|XP_006395184.1|  hypothetical protein EUTSA_v10004331mg           93.6    1e-18   
ref|XP_008246503.1|  PREDICTED: basic 7S globulin-like                93.6    1e-18   



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 130/171 (76%), Gaps = 13/171 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +KL LNTSL  +D+ V GGT+IST+ P+TT+K++IY  F+++Y + A SM L++V+ +AP
Sbjct  248  KKLSLNTSLFAMDEGV-GGTKISTIPPFTTMKSSIYKSFIEAYEKFAISMELNKVEAIAP  306

Query  562  FEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE+CFS        VG +VP  + VLQSEMVKWR+   NSMVKV D VMCLGFL+GG+ Q
Sbjct  307  FELCFSTKGIDVTKVGPNVPTTDLVLQSEMVKWRIYGRNSMVKVSDEVMCLGFLNGGVNQ  366

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSMERDSA  266
             AS+VIGGYQLEDNLLEFNLGTSMLGFTS   MA TSCS F   S+ +DSA
Sbjct  367  KASIVIGGYQLEDNLLEFNLGTSMLGFTSSLSMAETSCSDFMFHSVSKDSA  417



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 121/156 (78%), Gaps = 7/156 (4%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
             KL LNTSLL +D E  GGT+IST+ P+TT+KT+IY  F++SY     SMGL++V+P+AP
Sbjct  250  NKLSLNTSLLTMDGEGHGGTKISTISPFTTMKTSIYKTFVESYERFGFSMGLTKVEPIAP  309

Query  562  FEVCFSGV--GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVV  398
            F +CFS    G +VP ++ VLQSEMVKWR+   NSMVKV D VMCLGFLDGG+ Q AS+V
Sbjct  310  FGLCFSTKVEGLNVPSIDLVLQSEMVKWRIYESNSMVKVSDEVMCLGFLDGGVNQKASIV  369

Query  397  IGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            IGG+QLEDNLLEFNLGTSMLGFTS   M  TSCS F
Sbjct  370  IGGHQLEDNLLEFNLGTSMLGFTSSLAMVETSCSDF  405



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 122/157 (78%), Gaps = 8/157 (5%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +KL LNT+LL +D E +GGTRIST+ P+TT+KT+IY  F+++Y     SMGL++V+P+AP
Sbjct  250  KKLSLNTTLLTMDGEGQGGTRISTISPFTTMKTSIYKTFVEAYERFGFSMGLTKVEPIAP  309

Query  562  FEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F +CFS     G +VP V+ VLQSEMVKWR+   NSMVKV D VMCLGFLDGG  Q AS+
Sbjct  310  FGLCFSTKLEEGLNVPSVDLVLQSEMVKWRIYESNSMVKVSDEVMCLGFLDGGANQKASI  369

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGG+QLEDNLLEFNLGTSMLGFTS   M  TSCS F
Sbjct  370  VIGGHQLEDNLLEFNLGTSMLGFTSSLSMVETSCSDF  406



>ref|XP_007034626.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05552.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=420

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 122/159 (77%), Gaps = 12/159 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            ++L ++ S+L+ D+E + GT++ST+VPYTT+K++IY  F  +Y ++A SM ++RV  VAP
Sbjct  250  KRLAVDKSMLLGDEEGKLGTKLSTIVPYTTVKSSIYAIFSKAYAKAADSMNMTRVAAVAP  309

Query  562  FEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE+CFS  G +       VP+++ +LQSEMVKWR+   NSMVKV + VMCLGFLDGGL Q
Sbjct  310  FELCFSSKGIENTILGPLVPEIDLILQSEMVKWRIQGRNSMVKVSNQVMCLGFLDGGLEQ  369

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  302
             +S+VIGG QLEDNLLEF++G+SMLGF+S  L+  T+CS
Sbjct  370  SSSIVIGGLQLEDNLLEFDVGSSMLGFSSSLLLKETTCS  408



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 118/169 (70%), Gaps = 11/169 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +KL +N S+L ++QE  GGT+IST VPYTT+ +T+Y+ F+ +Y+++A  M ++   PVAP
Sbjct  271  KKLSINESMLSVNQEGVGGTKISTAVPYTTMVSTLYNTFIKAYIKAAIGMNMTMAPPVAP  330

Query  562  FEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F +CF           S+VP ++ VLQSEMVKWR+   NS V+V D VMCLGFLDGG   
Sbjct  331  FGICFRSERLEANRDASNVPIIDLVLQSEMVKWRIEGRNSFVQVNDKVMCLGFLDGGSSS  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSL-MAGTSCSHFTRFSMERDS  269
             ASVV+GGYQLEDNL+EF LGT MLGF++L M  T+CS      + R++
Sbjct  391  KASVVLGGYQLEDNLVEFKLGTKMLGFSALAMGHTTCSDLRTSYIPREA  439



>ref|XP_002517162.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45325.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=411

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 115/166 (69%), Gaps = 12/166 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R + +N   L L QE  G T+IST+VPYTTL+++IY  F+ +YL++A SM L RV  VAP
Sbjct  242  RSIKINGKKLALGQEGIGFTKISTIVPYTTLESSIYETFIKAYLKAANSMNLIRVASVAP  301

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F +CFS        +G +VP ++ VLQSEMVKWR+   NSMV+V D  MCLGFLDGGL  
Sbjct  302  FGLCFSSKGIERSILGPNVPAIDLVLQSEMVKWRLHGGNSMVEVNDEAMCLGFLDGGLDP  361

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFT--SLMAGTSCSHFTRFSM  281
              S+VIGG QLED LLEF+LGTSMLGF+   L   TSCS+F   SM
Sbjct  362  KNSIVIGGLQLEDTLLEFDLGTSMLGFSLPLLQRQTSCSNFLLESM  407



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 107/150 (71%), Gaps = 12/150 (8%)
 Frame = -3

Query  685  TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDV  527
            T+ISTVVPYTT+++ IY  F+++Y+++A SM L+ V PVAPFE+CFS        +G +V
Sbjct  266  TKISTVVPYTTMESKIYGTFVEAYVKAATSMNLTLVTPVAPFEICFSSKGVENQRIGPNV  325

Query  526  PKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFN  356
            P ++ +LQSEMVKWR+   NSMV V D VMCL FLDGGL    S+VIGGYQ+ED LLEFN
Sbjct  326  PIIDLILQSEMVKWRIYGRNSMVPVSDEVMCLAFLDGGLSPKDSIVIGGYQIEDYLLEFN  385

Query  355  LGTSMLGFTS--LMAGTSCSHFTRFSMERD  272
            LG SMLGF+S  LM    CS F    M R+
Sbjct  386  LGNSMLGFSSSLLMGQKGCSDFEASVMSRE  415



>emb|CBI32364.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  +++ +AA++ ++RV  VAP
Sbjct  234  KAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKAFTKAFISAAAAINITRVAAVAP  293

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D V+CLGF+DGG   
Sbjct  294  FNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSDDVLCLGFVDGGANP  353

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  354  RTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  394



>ref|XP_002272235.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=436

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  +++ +AA++ ++RV  VAP
Sbjct  270  KAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKAFTKAFISAAAAINITRVAAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D V+CLGF+DGG   
Sbjct  330  FNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSDDVLCLGFVDGGANP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  390  RTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>gb|KEH36785.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=417

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 119/171 (70%), Gaps = 14/171 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +K+  NT  L L QE   GT +S++VPYTT++++IY  F  + L++A SM +SRVD VAP
Sbjct  249  KKVSFNT--LSLSQEGNSGTLLSSIVPYTTMQSSIYANFKSAILKAALSMNISRVDSVAP  306

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE+CF       S +G +VP ++ VLQSEMVKWR+   NSMV+V D VMCLG LDGG  Q
Sbjct  307  FEICFGSNGIGASKIGPNVPVIDLVLQSEMVKWRIHGRNSMVRVSDDVMCLGILDGGDEQ  366

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSMERDSA  266
               +VIGGYQLED L++F+  +SM+GF+S  L+  TSCS+F   SM+  S+
Sbjct  367  KNLIVIGGYQLEDVLVQFDFDSSMVGFSSSLLIRDTSCSNFRFGSMDVQSS  417



>ref|XP_010242827.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=434

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D++  GGTRISTVVPYTTL+T+IY    D++L  A S G  R  PV+P
Sbjct  267  KPVALNTSLLSIDKKGFGGTRISTVVPYTTLETSIYEAVTDAFLTEATSTGFIREAPVSP  326

Query  562  FEVCFS----GVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQG  410
            FEVC      G+G D  VPK++ VLQSE V WR    NSMV VGD V+CLG LDGGL   
Sbjct  327  FEVCIRANVPGIGPDDHVPKLDLVLQSESVYWRFEHRNSMVTVGDSVLCLGMLDGGLKPE  386

Query  409  ASVVIGGYQLEDNLLEFNLGTSMLGFTSLM-AGTSCSHF  296
             S+VIGG+QLEDNLL+F+L  S LGF+SL+ +  +CS F
Sbjct  387  TSIVIGGHQLEDNLLQFDLRGSKLGFSSLLSSAATCSSF  425



>emb|CAN80378.1| hypothetical protein VITISV_038701 [Vitis vinifera]
Length=436

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  +++ +AA++ ++RV  VAP
Sbjct  270  KAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKXFTKAFISAAAAINITRVAAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D V+CLGF+DGG   
Sbjct  330  FNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSDDVLCLGFVDGGANP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  390  RTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>ref|XP_002280508.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=388

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  697  VEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGVGSD--VP  524
            + GGTR+STVVPYTT+K ++Y  F  +Y+++AASM ++RV+ +APF VCF    S+  VP
Sbjct  238  ITGGTRLSTVVPYTTMKRSVYDIFTKAYIKAAASMNITRVESMAPFGVCFRSESSEPAVP  297

Query  523  KVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNL  353
             ++ VLQSEMVKWR+   NSMV+V D VMCLGFLDGG+  G ++VIGG+QLEDNLLEF+L
Sbjct  298  TIDLVLQSEMVKWRILGRNSMVRVSDKVMCLGFLDGGVDPGTAIVIGGHQLEDNLLEFDL  357

Query  352  GTSMLGF  332
             TSMLGF
Sbjct  358  STSMLGF  364



>emb|CAN68736.1| hypothetical protein VITISV_030193 [Vitis vinifera]
Length=441

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 117/161 (73%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++PL++SLL +++   GGT+ISTV PYT L+T+IY+ F   +L+ A +  ++RV PVAP
Sbjct  275  KQVPLDSSLLAINKNGIGGTKISTVNPYTLLQTSIYNSFTKLFLQEAMAHNVTRVSPVAP  334

Query  562  FEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD V CLGFLDGGL Q
Sbjct  335  FDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGDDVACLGFLDGGLNQ  394

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  395  RTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>ref|XP_002284868.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=441

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 117/161 (73%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++PL++SLL +++   GGT+ISTV PYT L+T+IY+ F   +L+ A +  ++RV PVAP
Sbjct  275  KQVPLDSSLLAINKNGIGGTKISTVNPYTLLQTSIYNSFTKLFLQEAMAHNVTRVSPVAP  334

Query  562  FEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD V CLGFLDGGL Q
Sbjct  335  FDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGDDVACLGFLDGGLNQ  394

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  395  RTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>ref|XP_010255899.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=448

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 111/161 (69%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++P+NT+LL  D++  GGT+IST  PYTTL T+IY     ++  +AASM +SRV  VAP
Sbjct  282  KRVPINTTLLSFDKDGVGGTKISTATPYTTLHTSIYKAVTQAFANAAASMKMSRVASVAP  341

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKW---RMNSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        +G  VP ++ VL S+ V W   R NSMV+V DGVMCLG +D G   
Sbjct  342  FGVCFSSKSIKRTRMGPLVPAIDLVLHSQDVYWSISRSNSMVQVKDGVMCLGLVDAGKNP  401

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L +SMLGFTS  L  GT+C++F
Sbjct  402  RTSIVIGGHQLEDNLLQFDLASSMLGFTSSLLGHGTNCANF  442



>gb|KDP40108.1| hypothetical protein JCGZ_02106 [Jatropha curcas]
Length=425

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 118/173 (68%), Gaps = 16/173 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQE-VEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDP--  572
            R + +N   L L Q   +GGT+IST VPYTTL+++IY  F+ +Y ++A SM L+RVDP  
Sbjct  253  RSIRINGKRLALGQGGFKGGTKISTTVPYTTLESSIYSTFIKAYTKAANSMNLTRVDPEP  312

Query  571  VAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG  422
             +PF +CFS        +G  VP ++ VLQSEMVKWR+   NSMV+V D +MCLG LDGG
Sbjct  313  SSPFGLCFSSKGIANTIMGPMVPAIDLVLQSEMVKWRIHGRNSMVQVSDEMMCLGLLDGG  372

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFT--SLMAGTSCSHFTRFSMERDS  269
            L    S+VIGG+QLED LLEF+LG SMLGF+   LM  TSCS F   SM +DS
Sbjct  373  LESENSIVIGGFQLEDTLLEFDLGNSMLGFSFPILMRQTSCSSFLD-SMGKDS  424



>emb|CDP03612.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 110/161 (68%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D    GGT+ISTV PYT L+T+IY    ++++  AA+  +SRV  VAP
Sbjct  89   KAVPLNATLLTIDSRGNGGTKISTVNPYTVLETSIYKAVTEAFISEAAAWNISRVAGVAP  148

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVC S        +G  VP+++ VLQS+ V W +   NSMV V D V+CLGF++GG+  
Sbjct  149  FEVCVSSKNVFSTRLGPSVPQIDLVLQSQSVVWSITGSNSMVYVNDNVLCLGFVNGGVNP  208

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLED LL+F+L TS LGFTS + G  T+C++F
Sbjct  209  RTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGSRTTCANF  249



>gb|KDP21480.1| hypothetical protein JCGZ_21951 [Jatropha curcas]
Length=434

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 113/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +K+ LN SLL +D +  GGT+ISTV PYT L+++I+    ++++  AA M +SRV  VAP
Sbjct  268  KKVTLNDSLLTIDSQGNGGTKISTVNPYTVLESSIFSAVTEAFISEAAEMNISRVGSVAP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        +G  VP +  VLQ+E V WR+   NS+V+V D V+CLG ++GGL  
Sbjct  328  FEVCFSRRNVVSTRLGYRVPSISLVLQNENVVWRIFGANSIVQVSDDVLCLGLINGGLNP  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLEDNL++F+L TS LGF+SL+ G  T+CS+F
Sbjct  388  RTSIVIGGYQLEDNLVQFDLATSRLGFSSLLFGRQTTCSNF  428



>ref|XP_004486144.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=411

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 116/164 (71%), Gaps = 15/164 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +K+  NT    L QE   GT++S++VPYTT++++IY  F  ++L++A SM ++RV  VAP
Sbjct  245  KKVSFNTP--SLSQEGNSGTKLSSIVPYTTIQSSIYGNFKSAFLKAAFSMNMTRVTSVAP  302

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCF       S VG +VP ++FVLQSEMVKW +   NSMVK+ D VMCLG LDGG+ Q
Sbjct  303  FDVCFDSNGIDESKVGPNVPVIDFVLQSEMVKWSIYGRNSMVKLSDDVMCLGLLDGGVEQ  362

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  287
               +VIGGYQ ED L++F+  +SM+GF+S  LM  +SCS+F RF
Sbjct  363  KNPIVIGGYQFEDVLVQFDFDSSMVGFSSSLLMRDSSCSNF-RF  405



>gb|KJB61114.1| hypothetical protein B456_009G341600 [Gossypium raimondii]
Length=403

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 112/152 (74%), Gaps = 5/152 (3%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N   L + ++ +   ++STVVPYTT+ +++Y  F  +Y+E+A  M ++RV+ VAP
Sbjct  240  QSIKINGRRLAVHEQGKLEAKLSTVVPYTTMVSSVYAIFSKAYVEAATKMNMTRVESVAP  299

Query  562  FEVCFSGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIG  392
            F +CFS  G  VP+++ VLQSEMVKWR+   NSMVKV +  MCLGFLDGGL Q + +V+G
Sbjct  300  FGLCFSSKGPLVPEIDLVLQSEMVKWRIQGRNSMVKVSEESMCLGFLDGGLEQSSPIVLG  359

Query  391  GYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  302
            G Q+EDNLLEF++G+SMLGF+S  L+  T+CS
Sbjct  360  GLQMEDNLLEFDIGSSMLGFSSSLLLKETTCS  391



>ref|XP_011082548.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=432

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 109/158 (69%), Gaps = 12/158 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +NT+LL +D +  GGT+ISTV PYT L+T+IY  F  +Y+++AA+  +SRV  VAPF+VC
Sbjct  270  INTTLLNIDSQGNGGTKISTVNPYTLLETSIYRAFTSAYIQAAAARNISRVAGVAPFDVC  329

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS        VG  VP ++ VLQ +   W +   NSMV+V D V+CLGFLDGG     S+
Sbjct  330  FSSENVFSTRVGPSVPYIDLVLQGQDAVWTITGSNSMVQVNDNVLCLGFLDGGSNPRTSI  389

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
            VIGGYQLEDNLL+F+L  S LGF+S + G  T+C++F 
Sbjct  390  VIGGYQLEDNLLQFDLAASRLGFSSTLLGRRTTCANFN  427



>emb|CAN61502.1| hypothetical protein VITISV_011733 [Vitis vinifera]
Length=415

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNTSLL ++ +  GGT+ISTV PYT ++T+IY  F  +++ +AASM ++RV  VAP
Sbjct  250  KAVPLNTSLLSINSKGVGGTKISTVNPYTVMETSIYSAFTKAFISAAASMNITRVAAVAP  309

Query  562  FEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS         G+ VP +  VLQ+  V WR+   NSMV V   V+CLGF+DGG   
Sbjct  310  FSVCFSSKNVYSTRGGAAVPTIGLVLQNNSVVWRIFGANSMVFVNGDVLCLGFVDGGANP  369

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDNLL+F+L  S LGF+S  L + T+CS+F
Sbjct  370  RTSIVIGGYQLEDNLLQFDLAASRLGFSSSLLFSQTTCSNF  410



>ref|XP_011026191.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=438

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 113/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D + +GGT+ISTV PYT L+++I++    +++  AA+  ++RV  VAP
Sbjct  272  KTVPLNATLLSIDSQGKGGTKISTVNPYTVLESSIFNAVTRAFINEAAARNITRVASVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCFS        +G+ VP +  VLQ+E V WR+   NSMV+V D V+CLGF++GG   
Sbjct  332  FDVCFSRDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSMVQVSDNVLCLGFVNGGSNP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+CS+F
Sbjct  392  TTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCSNF  432



>ref|XP_007154122.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
 gb|ESW26116.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
Length=445

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 114/165 (69%), Gaps = 17/165 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + L +NTSLL +D++  GGT++STV+PYT L +++YHP L+++++ AA M + RV PVAP
Sbjct  279  KILNVNTSLLSIDKQGNGGTKLSTVIPYTKLHSSLYHPLLNAFVKKAAVMKMKRVSPVAP  338

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGL--  419
            F  CF+         G +VP +E VL+   V+WR+   NSMVKV   V CLGF+D GL  
Sbjct  339  FGACFNSRTVGKTVTGPNVPTIELVLRGG-VQWRIYGVNSMVKVNKKVQCLGFVDAGLEL  397

Query  418  -GQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             G  A S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   +CSHF
Sbjct  398  EGPAATSIVIGGYQMEDNLLEFDLASSKLGFSSSLLLHNATCSHF  442



>gb|ACU24232.1| unknown [Glycine max]
Length=403

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +N   +  D  + GG ++STVVPYTTL+T+IY  F  +YL++A+SM + RVDPV+PF +C
Sbjct  245  INGKKVSFDSPLGGGAQLSTVVPYTTLQTSIYANFESAYLKAASSMSMKRVDPVSPFGLC  304

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F       S VG +VP ++ VLQSEMVKW +   NSMV+V D VMCLGF+DGG      +
Sbjct  305  FESNGVGSSQVGPNVPVIDLVLQSEMVKWSIHGRNSMVQVNDDVMCLGFVDGGENPRNPI  364

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGGYQLED L++ +  TSM+GF+   L    +CSHF
Sbjct  365  VIGGYQLEDVLVQIDFDTSMVGFSPSLLTKHATCSHF  401



>gb|EYU38145.1| hypothetical protein MIMGU_mgv1a006647mg [Erythranthe guttata]
Length=436

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 109/161 (68%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +NT+LL++D E  GGT+ISTV PYT ++T+IY  F  +Y+  AA+  +SRV  VAP
Sbjct  270  KPISINTTLLIIDSEGNGGTKISTVNPYTLMETSIYRAFSAAYIREAAARNISRVAGVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCFS        VG  VP ++ VLQ +   W +   NSMV+V D V+CLGFLD G   
Sbjct  330  FDVCFSSSNVFGTRVGPAVPYIDLVLQGQNAVWTITGSNSMVRVNDDVLCLGFLDAGSNP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQ+EDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  390  VTSIVIGGYQIEDNLLQFDLAASRLGFSSTLLGRQTTCANF  430



>ref|XP_003542884.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN37575.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +N   +  D  + GG ++STVVPYTTL+T+IY  F  +YL++A+SM + RVDPV+PF +C
Sbjct  245  INGKKVSFDTPLGGGAQLSTVVPYTTLQTSIYANFESAYLKAASSMSMKRVDPVSPFGLC  304

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F       S VG +VP ++ VLQSEMVKW +   NSMV+V D VMCLGF+DGG      +
Sbjct  305  FESNGVGSSQVGPNVPVIDLVLQSEMVKWSIHGRNSMVQVNDDVMCLGFVDGGENPRNPI  364

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGGYQLED L++ +  TSM+GF+   L    +CSHF
Sbjct  365  VIGGYQLEDVLVQIDFDTSMVGFSPSLLTKHATCSHF  401



>ref|XP_002302122.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
 gb|EEE81395.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
Length=438

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 113/161 (70%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D + +GGT+ISTV PYT L+++I++    +++  +A+  ++RV  VAP
Sbjct  272  KTVPLNATLLSIDSQGKGGTKISTVNPYTVLESSIFNAVTRAFINESAARNITRVASVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCFS        +G+ VP +  VLQ+E V WR+   NSMV+V D V+CLGF++GG   
Sbjct  332  FDVCFSSDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSMVQVSDNVLCLGFVNGGSNP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+C++F
Sbjct  392  TTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCANF  432



>ref|XP_006489581.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++  A+  + RV PVAPF 
Sbjct  275  VPLNTSLLSIDKEGFGGTKISTVNPYTVLHTSIYNALARAFIKEVAN--IPRVTPVAPFG  332

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG  VP+++ VLQS  V WR+   NSMV+V D V+CLGF+DGG+    
Sbjct  333  ACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>emb|CDP10858.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 111/161 (69%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN +LL +D++  GGT+ISTV PYT L+T+I+    ++++  AA+  +SRV  VAP
Sbjct  272  KAVKLNNTLLTIDRQGYGGTKISTVNPYTVLETSIFKAVTNAFISEAATRNISRVPGVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        +G+ VP ++ VLQ + V W +   NSMV V D V+CLGF+DGGL  
Sbjct  332  FEVCFSSENVLGTRLGASVPYIDLVLQGQNVVWTITGSNSMVYVNDNVLCLGFVDGGLNP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLED LL+F+L TS LGFTS + G  T+CS+F
Sbjct  392  RTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGAQTTCSNF  432



>gb|KDO74788.1| hypothetical protein CISIN_1g036132mg [Citrus sinensis]
Length=437

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++  A+  + RV PVAPF 
Sbjct  275  VPLNTSLLSIDKEGVGGTKISTVNPYTVLHTSIYNALARAFVKEVAN--IPRVTPVAPFG  332

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG  VP+++ VLQS  V WR+   NSMV+V D V+CLGF+DGG+    
Sbjct  333  ACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>ref|XP_009411762.1| PREDICTED: basic 7S globulin-like [Musa acuminata subsp. malaccensis]
Length=434

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 112/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN +LL +D++  GGT+ISTV PYTTL+T+IY    +++  +AA  G+ RV PVAPF 
Sbjct  272  VPLNKTLLSIDKDGVGGTKISTVTPYTTLQTSIYRAVTNAF--AAALAGVRRVPPVAPFG  329

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
            +CF       + VG  VP+++ VL S+ V WR+   NSMV+V D V+CLGF+DGG     
Sbjct  330  LCFDPSSIGSTRVGPAVPQIDLVLPSQNVYWRIFGANSMVQVRDKVLCLGFVDGGAEPRT  389

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  390  SIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  428



>ref|XP_007154121.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
 gb|ESW26115.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
Length=416

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 111/161 (69%), Gaps = 16/161 (10%)
 Frame = -3

Query  730  LNTSLLVLD----QEVEGG-----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRV  578
            +N   L LD     E EGG     T IS++VPYTT++++IY+ F +++L++A SM ++RV
Sbjct  245  INGKRLSLDVSEFNEQEGGGGGALTLISSIVPYTTMQSSIYNSFKEAFLDAAVSMNMTRV  304

Query  577  DPVAPFEVCFSG--VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
              VAPFE+CFS   VG  VP +E VLQSEMVKW +   NSMV+V D V CLGF DGG+  
Sbjct  305  ASVAPFELCFSSSQVGPSVPVIELVLQSEMVKWSIHGRNSMVRVSDEVACLGFSDGGVNL  364

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLED +++F+L TSM+GF+S  L   T CS F
Sbjct  365  RNSIVIGGYQLEDVIVQFDLATSMVGFSSSLLTKKTKCSDF  405



>ref|XP_003546133.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN33057.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +N   +  D  + GG ++STVVPYTTL+T+IY  F  +YL++A+SM + RVDPV+PF +C
Sbjct  245  INGKKVAFDTPLGGGAQLSTVVPYTTLQTSIYDNFESAYLKAASSMDMKRVDPVSPFGLC  304

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F       S VG +VP ++ VLQSEMVKW +   NSMV+V D VMCLGF+DGG     S+
Sbjct  305  FESNGVGSSQVGPNVPIIDLVLQSEMVKWSIYGRNSMVQVSDDVMCLGFVDGGENPRNSI  364

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGG+QLED L++ +  TSM+GF+   L    SCS F
Sbjct  365  VIGGFQLEDVLVQIDFDTSMVGFSPSLLTKQASCSDF  401



>gb|KDP40112.1| hypothetical protein JCGZ_02110 [Jatropha curcas]
Length=434

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 114/161 (71%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNTSLL +D+E  GGT+ISTV PYT ++TTIY+ F++++ ++ A  G+ +V PVAP
Sbjct  270  KAVPLNTSLLSIDKEGFGGTKISTVDPYTVMETTIYNEFINAFRKALA--GVPKVAPVAP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F +CF+        VG  VP+++ VLQS  V WR+   NSMV+V   V+CLGF DGG+  
Sbjct  328  FGLCFNSTNIGSTRVGPAVPQIDLVLQSSTVFWRIFGANSMVQVKSDVLCLGFFDGGVNP  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+QLE+NLL+F+L  S LGF+S  L   T+C++F
Sbjct  388  RTSVVIGGHQLENNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_011014389.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=435

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 116/172 (67%), Gaps = 18/172 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQE-VEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS---MGLSRVD  575
            + + +N   L L Q+ + GGT+IST VPYTTL+++IY  F+ +Y E+A +   + ++ V 
Sbjct  258  KSIKINGKRLSLRQKGIGGGTKISTTVPYTTLESSIYSTFIKAYKEAATNNYFLNMTVVA  317

Query  574  PVAPFEVCFSG--------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLD  428
            PVAPF +CFS         +G  VP ++ VLQSEMVKWR+   N+MV V D VMCLGFLD
Sbjct  318  PVAPFGLCFSSKEVPSSMLLGPMVPAIDLVLQSEMVKWRVHGRNAMVPVLDEVMCLGFLD  377

Query  427  GGLGQ--GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCSHFTRFSME  278
            GG      +S+VIGG+QLEDNLLEFNLGTSMLGF+S    TSCS +    M+
Sbjct  378  GGFKSKTSSSIVIGGFQLEDNLLEFNLGTSMLGFSS-TRHTSCSDYHTRMMQ  428



>ref|NP_001239980.1| uncharacterized protein LOC100806719 precursor [Glycine max]
 gb|ACU23537.1| unknown [Glycine max]
Length=414

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = -3

Query  709  LDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG  542
            L  E EGG    T +ST+VPYTT++++IY+ F  S+ ++A +M ++RV  VAPFE+CFS 
Sbjct  253  LSNEHEGGGGVLTLLSTIVPYTTMQSSIYNSFKTSFEDAAVAMNITRVASVAPFELCFSS  312

Query  541  VGSDV----PKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQ  383
             GS V    P +E VLQSEMVKW +   NSMV+V D V+CLGFLDGG+    S+VIGGYQ
Sbjct  313  RGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRVSDEVLCLGFLDGGVNPRNSIVIGGYQ  372

Query  382  LEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            LED +++F+L TSM+GF+S  +   T CS F
Sbjct  373  LEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>gb|KHN03053.1| Basic 7S globulin [Glycine soja]
Length=414

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = -3

Query  709  LDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG  542
            L  E EGG    T +ST+VPYTT++++IY+ F  S+ ++A +M ++RV  VAPFE+CFS 
Sbjct  253  LSNEHEGGGGVLTLLSTIVPYTTMQSSIYNSFKTSFEDAAVAMNMTRVASVAPFELCFSS  312

Query  541  VGSDV----PKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQ  383
             GS V    P +E VLQSEMVKW +   NSMV+V D V+CLGFLDGG+    S+VIGGYQ
Sbjct  313  RGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRVSDEVLCLGFLDGGVNPRNSIVIGGYQ  372

Query  382  LEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            LED +++F+L TSM+GF+S  +   T CS F
Sbjct  373  LEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>ref|XP_009342158.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=408

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 97/141 (69%), Gaps = 14/141 (10%)
 Frame = -3

Query  694  EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VG  536
            EG  ++ST+VPYT ++++IY  F  +Y ++A SM ++RV PVAPF  CFS        VG
Sbjct  260  EGKIKLSTIVPYTXMESSIYATFTKAYEQTATSMNITRVSPVAPFGQCFSSRENDGTLVG  319

Query  535  SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLL  365
              VP ++ VLQSEMVKWR+   NSMV+V D VMCLGFLDGGL    S+VIGGYQLED LL
Sbjct  320  PKVPAIDLVLQSEMVKWRIHGRNSMVQVSDEVMCLGFLDGGLNLKTSMVIGGYQLEDTLL  379

Query  364  EFNLGTSMLGFTSLMAGTSCS  302
             F++G S LGFT      SCS
Sbjct  380  HFDVGASRLGFTQ----QSCS  396



>ref|XP_003590665.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES60916.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=435

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 10/155 (6%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +D    GGT+ISTV PYT L+ +IY    D++++++A+  + RV  VAPFE C
Sbjct  275  LNTSLLSIDNNGVGGTKISTVDPYTVLEASIYKAVTDAFVKASAARNIKRVGSVAPFEFC  334

Query  550  FSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVI  395
            ++ +     G+ VP +E  LQ+E V WR+   NSMV + D V+CLGF++GG     S+VI
Sbjct  335  YTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVSINDEVLCLGFVNGGKNTRTSIVI  394

Query  394  GGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            GGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  395  GGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>ref|XP_011020124.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=431

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN SLL +++E  GGT+ISTV  YT ++TTIY+   DS++   A   + RV  VAPF 
Sbjct  267  VPLNASLLSINKEGYGGTKISTVNAYTVMETTIYNAVTDSFVRELAKANVPRVASVAPFG  326

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG  VP+++ VLQS+ V WR+   NSMV+V D V+CLGF+DGG+    
Sbjct  327  ACFNSKNIVGTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVKDDVLCLGFVDGGVNPRT  386

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  387  SIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>ref|XP_006419808.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
 gb|ESR33048.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
Length=436

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 112/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D++  GGT+ISTV PYT ++T+IY  F +++++  A++   RV PV+PF 
Sbjct  274  VPLNTSLLSVDKKGFGGTKISTVNPYTVMETSIYKAFTEAFIKELANV--PRVKPVSPFG  331

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CFS        VG+ VP ++ VLQS  V W +   NSMV+V D V+CLGF+DGG+    
Sbjct  332  TCFSSPHIGSTRVGAAVPLIDLVLQSSKVIWSIFGANSMVQVKDDVLCLGFVDGGVNPRT  391

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  392  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>gb|AFK46427.1| unknown [Medicago truncatula]
Length=435

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 107/155 (69%), Gaps = 10/155 (6%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +D    GGT+ISTV PYT L+ +IY    D+++++ A+  + RV  VAPFE C
Sbjct  275  LNTSLLSIDNNGVGGTKISTVDPYTVLEASIYKAVTDAFVKAPAARNIKRVGSVAPFEFC  334

Query  550  FSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVI  395
            ++ +     G+ VP +E  LQ+E V WR+   NSMV + D V+CLGF++GG     S+VI
Sbjct  335  YTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVSINDEVLCLGFVNGGKNTRTSIVI  394

Query  394  GGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            GGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  395  GGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>ref|XP_002308984.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
 gb|EEE92507.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
Length=431

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 108/159 (68%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN SLL +++E  GGT+ISTV  YT ++TTIY+   DS++   A   + RV  VAPF 
Sbjct  267  VPLNASLLSINREGYGGTKISTVNAYTVMETTIYNAVTDSFVRELAKANVPRVASVAPFG  326

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG  VP+++ VLQS+ V WR+   NSMV+V D V+CLGF+DGG+    
Sbjct  327  ACFNSKNIGSTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVKDDVLCLGFVDGGVNPRT  386

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  387  SIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>ref|XP_010035593.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=436

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++PLN SLL + +E  GGT+ISTV PYT ++T+IY   + ++++  + +   RV PV P
Sbjct  272  KQVPLNASLLSIGKEGNGGTKISTVNPYTVMQTSIYKAVVGAFVKELSQV--RRVAPVKP  329

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + VG  VP+++ VLQS  V WR+   NSMV+V +GV+CLGF+DGGL  
Sbjct  330  FRACFDSNSIGSTRVGPGVPQIDLVLQSSSVYWRIFGANSMVQVKEGVLCLGFVDGGLSP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  390  KTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  430



>ref|XP_008810759.1| PREDICTED: basic 7S globulin-like [Phoenix dactylifera]
Length=431

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 110/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D+   GGT+ISTV PYTTL+T+IY     ++ ES A+  ++R   V+P
Sbjct  267  KTVPINTTLLSIDRNGVGGTKISTVTPYTTLETSIYKAVASAFEESLAN--ITRAAAVSP  324

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF         VG  VP ++ VL+SE V WR+   NSMV+V D V+CLGF+DGG   
Sbjct  325  FTVCFDSKEIGSTRVGPAVPSIDLVLESESVFWRIFGSNSMVQVNDDVLCLGFVDGGANP  384

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+QLEDNLL+F+L T+ LGF+S  L   T+C++F
Sbjct  385  RTSVVIGGHQLEDNLLQFDLATTRLGFSSSLLFRQTTCANF  425



>ref|XP_002517165.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45328.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=434

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNTSLL +D+E  GGT+ISTV PYT L+TTIY      +++  A +   RV PV+P
Sbjct  270  KAVPLNTSLLFIDKEGVGGTKISTVDPYTVLETTIYQAVTKVFIKELAEV--PRVAPVSP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF+        VG  VP+++ VLQS  V WR+   NSMV+V   V+CLGF+DGGL  
Sbjct  328  FGVCFNSSNIGSTRVGPAVPQIDLVLQSSSVFWRIFGANSMVQVKSDVLCLGFVDGGLNP  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+Q+EDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  388  RTSIVIGGHQIEDNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_006489295.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=436

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 112/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D++  GGT+ISTV PYT ++T+IY  F +++++  A++   RV PV+PF 
Sbjct  274  VPLNTSLLSVDKKGFGGTKISTVNPYTVMETSIYKAFTEAFIKELANV--PRVKPVSPFG  331

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CFS        VG+ V +++ VLQS  V W +   NSMV+V D V+CLGF+DGG+    
Sbjct  332  TCFSSPHIGSTRVGAAVAQIDLVLQSSKVIWSIFGANSMVQVKDDVLCLGFVDGGVNPRT  391

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  392  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>ref|XP_006419833.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
 gb|ESR33073.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
Length=437

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 110/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++  A+  + RV PVAPF 
Sbjct  275  VPLNTSLLSIDKEGFGGTKISTVNPYTVLHTSIYNALARAFIKEVAN--IPRVTPVAPFG  332

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
              F+        VG  VP+++ VLQS  V WR+   NSMV+V D V+CLGF+DGG+    
Sbjct  333  AYFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVRDDVLCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>ref|XP_006489297.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +  A+    RVD V+PF 
Sbjct  275  VPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTKELANA--PRVDSVSPFG  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGG+    
Sbjct  333  ACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_007224886.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
 gb|EMJ26085.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
Length=400

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 14/149 (9%)
 Frame = -3

Query  715  LVLDQE-VEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFS--  545
            L L++E    G ++ST VPYTT+++++Y  F  +Y ++A +M ++RV PVAPF +CFS  
Sbjct  243  LSLNKEGFREGIKLSTTVPYTTMESSVYVTFTRAYEQAAMAMNMTRVAPVAPFVLCFSSE  302

Query  544  -----GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGG  389
                 GVG  VP ++ VLQSEMVKWR+   NSMV+V + VMCLGFLDGG     S+VIGG
Sbjct  303  QAEGRGVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVSNQVMCLGFLDGGSDLKTSIVIGG  362

Query  388  YQLEDNLLEFNLGTSMLGFTSLMAGTSCS  302
            YQLED LL F+L  S+LGF+S    TSCS
Sbjct  363  YQLEDTLLHFDLSASVLGFSS---QTSCS  388



>ref|XP_006489296.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 14/160 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +  A+    RVD V+PF 
Sbjct  275  VPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTKELANA--PRVDSVSPFG  332

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF         VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGG+    
Sbjct  333  ACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F 
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNFN  432



>ref|XP_003518926.1| PREDICTED: basic 7S globulin [Glycine max]
Length=435

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 115/162 (71%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL ++ +  GGT+IS+V PYT L+ +I+    +++++++++  ++RV  VAP
Sbjct  268  KTVPLNTTLLSINSKGVGGTKISSVNPYTVLEDSIFKAVTEAFVKASSARNITRVASVAP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD-GVMCLGFLDGGLG  416
            FEVCFS        +G+ VP +E VLQ++   WR+   NSMV V D  V+CLGF++GG  
Sbjct  328  FEVCFSRENVLATRLGAAVPTIELVLQNQKTVWRIFGANSMVSVSDDKVLCLGFVNGGEN  387

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               S+VIGGYQLEDNLL+F+L TS LGF+SL+ G  T+C++F
Sbjct  388  PRTSIVIGGYQLEDNLLQFDLATSRLGFSSLLYGSRTTCANF  429



>ref|XP_010255900.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=434

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 111/161 (69%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN++LL +D    GGT+ISTV PYT ++++IY    +++++ A+SMG++RV  VAP
Sbjct  268  KAVSLNSTLLSIDNSGVGGTKISTVNPYTVMESSIYKAVTEAFIQEASSMGITRVAAVAP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        VG  VP ++ VLQ++   WR+   NSMV+V + V+CLG ++GG   
Sbjct  328  FGVCFSSKNISSTRVGPAVPTIDLVLQNQSTFWRIFGANSMVQVSNDVLCLGIVNGGSNP  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  388  RTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  428



>ref|XP_003590668.1| Basic 7S globulin [Medicago truncatula]
 gb|AES60919.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=434

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEV  554
            L+TSLL +D     GGT+ISTV PYT L+ +IY    D++++++A+  + RVD VAPFE 
Sbjct  274  LDTSLLSIDSSNGAGGTKISTVDPYTVLEASIYKAVTDAFVKASAARNIKRVDSVAPFEF  333

Query  553  CFSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVV  398
            C++ V     G+DVP +E  LQ+ ++ WR+   NSMV + D V+CLGF+ GG    AS+V
Sbjct  334  CYTNVTGTRLGADVPTIELYLQNNVI-WRIFGANSMVNINDEVLCLGFVIGGENTWASIV  392

Query  397  IGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
            IGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F 
Sbjct  393  IGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNFN  429



>gb|KFK42682.1| hypothetical protein AALP_AA1G026200 [Arabis alpina]
Length=433

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 115/162 (71%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N ++L ++ +   GGT++STV PYT ++T+IY+ F  +++ +A++  +SRV  V 
Sbjct  266  KSVPINKTMLKINGDTGFGGTKLSTVNPYTVMETSIYNAFTSAFIRAASARNISRVSSVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP+++ VLQS+ V WR+   NSMV VG+ V+CLGF+DGG+ 
Sbjct  326  PFGACFSTANVGVTRVGYAVPEIQLVLQSKDVVWRIFGANSMVSVGNDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            +  SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++F
Sbjct  386  ESTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRSTNCANF  427



>ref|XP_008340919.1| PREDICTED: basic 7S globulin [Malus domestica]
Length=406

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 104/157 (66%), Gaps = 15/157 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +    + LD E EG  ++ST+VPYTT +++IY  F  +Y ++A SM ++RV PVAP
Sbjct  243  KSIKIRGKKMSLDIE-EGKIKLSTIVPYTTXESSIYATFTKAYEQAAMSMNMTRVSPVAP  301

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        VG  VP ++ VLQSE+VKWR+   NSMV+V + VMCLGFLDGGL  
Sbjct  302  FGQCFSSRKKDGTLVGPKVPVIDLVLQSELVKWRIHGRNSMVQVRNEVMCLGFLDGGLNL  361

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  302
              S+VIGGYQLED LL F++G S LGFT      SCS
Sbjct  362  KTSMVIGGYQLEDTLLHFDVGASRLGFTQ----QSCS  394



>ref|XP_006419831.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
 gb|ESR33071.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
Length=435

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 111/159 (70%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NTSLL +D++  GGT+ISTV PYT L+++IY  F++++ +  A +   RV PV+PF 
Sbjct  273  IPMNTSLLSIDKKGFGGTKISTVHPYTVLESSIYEVFIEAFTKGLAKV--PRVKPVSPFG  330

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+         G+ VP+++ VLQS  V W +   NSMV+V D V+CLGF+DGG+    
Sbjct  331  ACFNSTHIGSTRAGAAVPQIDLVLQSSKVIWSIFGANSMVQVKDDVLCLGFVDGGVNPRT  390

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  391  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  429



>ref|XP_004298169.1| PREDICTED: basic 7S globulin-like [Fragaria vesca subsp. vesca]
Length=414

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + + +N   L L+ +E  GG ++ST+VPY+T++ ++Y  F+ ++ ++A +M ++RV  VA
Sbjct  242  KSIRVNGKQLALNYKEGLGGIKLSTIVPYSTMERSVYAVFVRAFEQAAMAMNMTRVASVA  301

Query  565  PFEVCF--------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGL  419
            PF +CF        + VGS VP V+  LQSEMVKWR+   NSMV+V D VMCLGFLDGGL
Sbjct  302  PFGLCFGSKNIDGSTRVGSRVPVVDLGLQSEMVKWRLHGRNSMVQVSDEVMCLGFLDGGL  361

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  302
             Q  S+V+GG+QLED LL F+LG SMLGF+S  LM   +CS
Sbjct  362  EQKTSIVLGGHQLEDTLLHFDLGASMLGFSSSKLMDQNTCS  402



>ref|XP_010278291.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=470

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 111/157 (71%), Gaps = 13/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN+ LL +D E  GGT+ISTVVPYTTL+T+IY+    +++E A SMG++RV  VAPF  C
Sbjct  308  LNSDLLSIDGEGVGGTKISTVVPYTTLETSIYNSVTGAFMEEAISMGITRVGAVAPFGAC  367

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS        +G++VP ++ VLQ + V WR+   N+MV V +GV+CLGFLDGG     S+
Sbjct  368  FSSESIRGSRMGAEVPSIDLVLQGQSV-WRIFGKNAMVDVREGVLCLGFLDGGRNPRTSI  426

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  296
            V+GG+QLED LL+F+L TS LGF+ L+    TSC++F
Sbjct  427  VLGGHQLEDILLQFDLKTSKLGFSPLLHYRQTSCANF  463



>gb|KHN03449.1| Basic 7S globulin [Glycine soja]
Length=410

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVD  575
             +L L+TS      E +G     T +ST++PYTT++++IY+ F  S+ ++A +M ++RV 
Sbjct  238  NRLSLDTSSSESSNEQDGSVGALTLLSTILPYTTMQSSIYNSFKTSFEDAAVAMNMTRVA  297

Query  574  PVAPFEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
             VAPFE+CFS      G  VP +E VLQSEMVKW +   NSMV+V D V+CLGFLDGG+ 
Sbjct  298  SVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVSDEVVCLGFLDGGVN  357

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  358  PRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  399



>ref|XP_003550008.2| PREDICTED: basic 7S globulin 2-like [Glycine max]
Length=432

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVD  575
             +L L+TS      E +G     T +ST++PYTT++++IY+ F  S+ ++A +M ++RV 
Sbjct  260  NRLSLDTSSSESSNEQDGSVGALTLLSTILPYTTMQSSIYNSFKTSFEDAAVAMNMTRVA  319

Query  574  PVAPFEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
             VAPFE+CFS      G  VP +E VLQSEMVKW +   NSMV+V D V+CLGFLDGG+ 
Sbjct  320  SVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVSDEVVCLGFLDGGVN  379

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLED +++F+L TSM+GF+S  +   T CS F
Sbjct  380  PRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  421



>ref|XP_008222987.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=438

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D E  GGT+ISTV PYT L+T+IY+  +D+++++ A   + RV  VAP
Sbjct  274  KAVALNTSLLKIDSEGYGGTKISTVNPYTVLETSIYNAVVDAFVKTVAE--IPRVKAVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         VG  VP ++ VLQSE V WR+   NSMV V D V+CLGF+DGG   
Sbjct  332  FGACFDSKNIGSTRVGPAVPAIDLVLQSESVYWRVFGANSMVAVSDDVLCLGFVDGGERP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L  S LGF+S    + T+C++F
Sbjct  392  RTSIVIGGHQLEDNLLQFDLAASRLGFSSSLFFSRTTCANF  432



>ref|XP_006419811.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
 gb|ESR33051.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
Length=437

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +  A+    RV+ V+PF 
Sbjct  275  VPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTKELANA--PRVESVSPFG  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGG+    
Sbjct  333  ACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>emb|CDX86682.1| BnaC08g00210D [Brassica napus]
Length=415

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL +D     GGT+ISTV PYT L+T+IY+ F  +Y   AA   ++RV  VA
Sbjct  248  KTVPINATLLKIDGTTGVGGTKISTVNPYTVLETSIYNAFTSAYAREAAGRNITRVASVA  307

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  308  PFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSDDVICLGFVDGGVN  367

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  368  ARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  409



>ref|XP_006419809.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
 gb|ESR33049.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
Length=437

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 109/160 (68%), Gaps = 14/160 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +  A+    RV+ V+PF 
Sbjct  275  VPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTKELANA--PRVESVSPFG  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGG+    
Sbjct  333  ACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGFVDGGVNPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F 
Sbjct  393  SIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNFN  432



>emb|CDY15456.1| BnaA08g27400D [Brassica napus]
Length=415

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL +D     GGT+ISTV PYT L+T+IY+ F  +Y+  AA   ++RV  VA
Sbjct  248  KTVPINATLLKIDGTTGVGGTKISTVNPYTVLETSIYNAFTSAYVREAAGRNITRVASVA  307

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D ++CLGF+DGG+ 
Sbjct  308  PFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSDDIICLGFVDGGVN  367

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  368  ARTSVVIGGYQLEDNLIEFDLASNKFGFSSTLLGRRTNCANF  409



>gb|KJB46995.1| hypothetical protein B456_008G005100 [Gossypium raimondii]
Length=436

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            + LNT+LL ++ E  GGT+ISTV PYT L+++I+    ++++  AA+M +SRV  VAPFE
Sbjct  272  ISLNTTLLSINNEGVGGTKISTVDPYTVLESSIFKAVTEAFINEAAAMNISRVAGVAPFE  331

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
            VCFS        +G  VP ++ VLQ++ V WRM   NSMV+V   V+CLGF++GG     
Sbjct  332  VCFSSSNIASTRLGPTVPSIDLVLQNQNVFWRMFGSNSMVEVNRDVLCLGFVNGGSNPTT  391

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            S+VIGG+QLE+ LL+F+L TS LGF++ + G  T+C++F
Sbjct  392  SIVIGGHQLENTLLQFDLATSRLGFSATLLGRQTTCANF  430



>ref|XP_006419829.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
 gb|ESR33069.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
Length=327

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +  A   + RV PV+PF 
Sbjct  165  IPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTKELAK--VPRVKPVSPFG  222

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+         G  VP+++ VLQS    W +   NSMV+V   V+CLGF+DGG+    
Sbjct  223  ACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCLGFVDGGVHPRT  282

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  283  SIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  321



>ref|XP_008222998.1| PREDICTED: basic 7S globulin 2 [Prunus mume]
Length=411

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 97/139 (70%), Gaps = 13/139 (9%)
 Frame = -3

Query  688  GTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFS-------GVGSD  530
            G ++ST VPYTT++ ++Y  F  +Y ++A +M ++RV PVAPF +CFS       GVG  
Sbjct  264  GIKLSTTVPYTTMERSVYVTFTRAYEQAAMAMNMTRVTPVAPFGLCFSSEQAEGRGVGPK  323

Query  529  VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEF  359
            VP ++ VLQSEMVKWR+   NSMV+V   VMCLGFLDGG     S+VIGGYQLED LL F
Sbjct  324  VPAIDLVLQSEMVKWRIHGRNSMVQVSTQVMCLGFLDGGSDLKTSIVIGGYQLEDTLLHF  383

Query  358  NLGTSMLGFTSLMAGTSCS  302
            +L  S+LGF+S    TSCS
Sbjct  384  DLSASVLGFSS---QTSCS  399



>ref|XP_011015097.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A +   RV  VA
Sbjct  263  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELALV--PRVASVA  320

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGGL 
Sbjct  321  PFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCLGFVDGGLN  380

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  PRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>gb|KFK42681.1| hypothetical protein AALP_AA1G026100 [Arabis alpina]
Length=433

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+NT+LL +D     GGT+ISTV PYT L+T+I++ F  +++  AA+  +SRV  VA
Sbjct  266  KTVPINTTLLKIDSVTGIGGTKISTVNPYTVLETSIFNAFTTAFVREAAARNISRVASVA  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NS+V V D V+CLGF+DGG+ 
Sbjct  326  PFGACFSTKNVVPTRLGYAVPEIQLVLHSNNVVWRITGSNSVVSVSDDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  386  ARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGSRTTCANF  427



>ref|XP_011011197.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A +   RV  VA
Sbjct  263  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELALV--PRVASVA  320

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGGL 
Sbjct  321  PFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCLGFVDGGLN  380

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  PRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>ref|XP_011011196.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A +   RV  VA
Sbjct  273  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELALV--PRVASVA  330

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGGL 
Sbjct  331  PFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCLGFVDGGLN  390

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  391  PRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_011015096.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 110/162 (68%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A +   RV  VA
Sbjct  273  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELALV--PRVASVA  330

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGGL 
Sbjct  331  PFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQVKSDVMCLGFVDGGLN  390

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  391  PRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_007147764.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
 gb|ESW19758.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
Length=410

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +N   +  D  + GG ++STVVPYTTL+T+I+  F  +YL++A+ + +SRV PV+PF +C
Sbjct  243  INGKKVSFDAPLGGGAQLSTVVPYTTLQTSIFANFESAYLKAASILNMSRVSPVSPFGLC  302

Query  550  FS--GVGS-----DVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS  GVGS     +VP ++ VLQSEMVKW +   NSMV+V   VMCLGF+DGG      +
Sbjct  303  FSSNGVGSSQMGPNVPVIDLVLQSEMVKWSIHGRNSMVQVSKDVMCLGFVDGGENPRNPI  362

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGGYQLED L++F+  TSM+GF+   L    SCS F
Sbjct  363  VIGGYQLEDVLVQFDFDTSMVGFSPSLLTRHASCSDF  399



>ref|XP_002277699.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=435

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D +  GGT+ISTV PYT L+T+IY     ++L+  ++  ++RV  V+P
Sbjct  271  KAVPLNATLLSIDSQGYGGTKISTVHPYTVLETSIYKAVTQAFLKELST--ITRVASVSP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        VG  VP ++ VLQ + V WR+   NSMV+V D V+CLGF+DGG+  
Sbjct  329  FGACFSSKDIGSTRVGPAVPPIDLVLQRQSVYWRVFGANSMVQVSDNVLCLGFVDGGVNP  388

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  389  RTSIVIGGRQLEDNLLQFDLATSRLGFSSSLLSRQTTCSNF  429



>ref|XP_008235257.1| PREDICTED: basic 7S globulin 2-like [Prunus mume]
Length=473

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 108/161 (67%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +NT+LL +D++  GGT+ISTV PYT L+ +I+    ++++  + SM ++RV  V P
Sbjct  307  KSVAVNTTLLSIDRDGVGGTKISTVNPYTVLEASIFKAVTEAFISESKSMNITRVSSVGP  366

Query  562  FEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        VG  VP ++ VLQ+E   WR+   NSMV+V D V+CL  ++GG   
Sbjct  367  FEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSMVQVNDDVLCLAVVNGGESP  426

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  427  RTSVVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  467



>ref|XP_002311834.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
 gb|EEE89201.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
Length=437

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 19/174 (11%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQE-VEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS---MGLSRVD  575
            + + +N   L L Q+ + GGT+IST VPYTTL+++IY  F+ +Y ESA +   + ++ V 
Sbjct  258  KSIKINGKRLSLRQKGIGGGTKISTTVPYTTLESSIYSTFIKAYKESATNNYFLNMTVVA  317

Query  574  PVAPFEVCFSG--------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLD  428
            PVAPF +CFS         +G  VP ++ VLQSEMVKWR+   N+MV V D VMCLGFLD
Sbjct  318  PVAPFGLCFSSKEVPSSMLLGPMVPVIDLVLQSEMVKWRVHGRNAMVPVLDEVMCLGFLD  377

Query  427  GGLGQGAS--VVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSME  278
            GG     S  +VIGG+QLEDNLLEFNLGTSMLGF+S  L   TSCS +    M+
Sbjct  378  GGSKSKTSSSIVIGGFQLEDNLLEFNLGTSMLGFSSSLLTRHTSCSDYHTRMMQ  431



>ref|XP_007201544.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
 gb|EMJ02743.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
Length=412

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 108/161 (67%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +NT+LL +D++  GGT+ISTV PYT L+ +I+    ++++  + SM ++RV  V P
Sbjct  246  KPVAVNTTLLSIDRDGVGGTKISTVNPYTVLEASIFKAVTEAFISESKSMNITRVSSVGP  305

Query  562  FEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        VG  VP ++ VLQ+E   WR+   NSMV+V D V+CL  ++GG   
Sbjct  306  FEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSMVQVNDDVLCLAVVNGGESP  365

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  366  RTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  406



>ref|XP_010938774.1| PREDICTED: basic 7S globulin-like [Elaeis guineensis]
Length=431

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT LL +D+   GGT+ISTV PYT L+T+IY     ++ +S A++  ++   VAP
Sbjct  267  KTVPINTKLLSIDRNGVGGTKISTVTPYTVLETSIYKAVTSAFQKSLANV--TKAAAVAP  324

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF+        VG  VP ++ VLQ+  V WR+   NSMV+V D V+CLGF+DGG   
Sbjct  325  FTVCFNSKEIGSTRVGPAVPSIDLVLQNANVFWRIFGANSMVQVNDDVLCLGFVDGGAKP  384

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  385  RTSVVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  425



>gb|KDO74795.1| hypothetical protein CISIN_1g037976mg [Citrus sinensis]
Length=435

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +  A   + RV PV+PF 
Sbjct  273  IPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTKELAK--VPRVKPVSPFG  330

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+         G  VP+++ VLQS    W +   NSMV+V   V+CLGF+DGG+    
Sbjct  331  ACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCLGFVDGGVHPRT  390

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  391  SIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>ref|XP_006489309.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=435

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 109/159 (69%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +  A +   RV PV+PF 
Sbjct  273  IPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTKELAKV--PRVKPVSPFG  330

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+         G  VP+++ VLQS    W +   NSMV+V   V+CLGF+DGG+    
Sbjct  331  ACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVKRDVLCLGFVDGGVHPRT  390

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  391  SIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>ref|XP_010522713.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=429

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 111/161 (69%), Gaps = 15/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +++E  GGT+ISTV PYT L+T+IY+  + +++   A+    RV  VAP
Sbjct  266  KPVPLNQTLLKINREGFGGTKISTVNPYTVLETSIYNAVVSAFVRETAA---KRVAAVAP  322

Query  562  FEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS  GVGS      VP+++ VLQS  V WR+   NSMV V D V+CLGF+DGG+  
Sbjct  323  FGACFSTEGVGSTRLGPAVPEIDLVLQSNDVVWRIFGANSMVSVRDDVICLGFVDGGVNP  382

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLEDN+++F+L  S LGF+S + G  T+C++F
Sbjct  383  RTSIVIGGYQLEDNVVQFDLAASRLGFSSTLLGRRTNCANF  423



>ref|XP_007034630.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05556.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=375

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN +LL +++E  GGT+ISTV PYT ++T+IY   +++++++ +   + RV  VAP
Sbjct  211  KAVQLNNTLLSINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIKAISQ--IPRVPAVAP  268

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         VG  VP+++ VLQS+ V W +   NSMV+V + V+CLGF+DGGL  
Sbjct  269  FSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVSNDVLCLGFVDGGLEP  328

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  329  TTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  369



>ref|XP_006418255.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
 gb|ESQ36608.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
Length=437

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLL-VLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL ++     GGT+ISTV PYT ++T+I++ F  +++  AA+  ++RV  V 
Sbjct  270  KSVPINKTLLKIVASTGFGGTKISTVDPYTVMETSIFNAFTSAFVREAAARNITRVSSVK  329

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP+++ VLQS  V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  330  PFGACFSTQNVGVTRVGYAVPEIQLVLQSNNVVWRIFGANSMVSVSDDVICLGFVDGGVN  389

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++F
Sbjct  390  ARTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRRTNCANF  431



>gb|KJB23117.1| hypothetical protein B456_004G081800 [Gossypium raimondii]
Length=433

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 109/161 (68%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNT+LL ++ E  GGT+ISTV PYT L+ +I+    ++++  AA+  ++RV  VAP
Sbjct  267  KPVSLNTTLLSINSEGVGGTKISTVNPYTALEASIFKAVTEAFINEAAARNITRVAGVAP  326

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        +G+ VP ++ VLQ+E   WR+   NSMV+V   V CLGF++GG   
Sbjct  327  FEVCFSSRNIVGTRLGAAVPSIDLVLQNENTFWRIFGANSMVEVSREVSCLGFVNGGSNP  386

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLED LL+F+L TS LGF+S + G  T+C++F
Sbjct  387  MTSIVIGGYQLEDTLLQFDLATSRLGFSSTLLGRQTTCANF  427



>ref|XP_008438716.1| PREDICTED: basic 7S globulin-like isoform X1 [Cucumis melo]
 ref|XP_008438717.1| PREDICTED: basic 7S globulin-like isoform X2 [Cucumis melo]
Length=425

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 109/162 (67%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D+   GGT+ISTV PYT L+ +IY+  + ++     +  + RVD VAP
Sbjct  264  KTVPLNTTLLKIDRNGNGGTKISTVNPYTVLEPSIYNALVKTFTTELGN--IPRVDAVAP  321

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVC+S        +G  V  ++ +LQ++ V WRM   NSMV V D V+CLGF+DGG+  
Sbjct  322  FEVCYSSKSFGSTELGPGVASIDLILQNKKVIWRMFGANSMVLVNDEVLCLGFVDGGVEA  381

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
              +VVIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F 
Sbjct  382  KTAVVIGAHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANFN  423



>ref|XP_006495483.1| PREDICTED: basic 7S globulin-like, partial [Citrus sinensis]
Length=174

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 98/143 (69%), Gaps = 12/143 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +  A+    RVD V+PF 
Sbjct  34   VPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTKELANA--PRVDSVSPFG  91

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF       + VG  VP+++ VLQS  V WR+   NSMV+V   VMCLGF+DGG+    
Sbjct  92   ACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVKSNVMCLGFVDGGVNPRT  151

Query  406  SVVIGGYQLEDNLLEFNLGTSML  338
            S+VIGG+QLEDNLL+F+L TS L
Sbjct  152  SIVIGGHQLEDNLLQFDLATSRL  174



>ref|NP_001241217.1| uncharacterized protein LOC100818868 precursor [Glycine max]
 gb|ACU22861.1| unknown [Glycine max]
 gb|KHN03448.1| Basic 7S globulin [Glycine soja]
Length=450

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 107/161 (66%), Gaps = 17/161 (11%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +NTSLL +D++  GG ++STVVPYT   T+IY P ++ +++ AA   + RV  VAPF  C
Sbjct  288  VNTSLLSIDRQGNGGCKLSTVVPYTKFHTSIYQPLVNDFVKQAALRKIKRVTSVAPFGAC  347

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA--  407
            F          G +VP ++ VL+   V+WR+   NSMVKV   V+CLGF+DGGL  G+  
Sbjct  348  FDSRTIGKTVTGPNVPTIDLVLKGG-VQWRIYGANSMVKVSKNVLCLGFVDGGLEPGSPI  406

Query  406  --SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   SCSHF
Sbjct  407  ATSIVIGGYQMEDNLLEFDLVSSKLGFSSSLLLHMASCSHF  447



>gb|EMS47745.1| Basic 7S globulin [Triticum urartu]
Length=329

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 105/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN SLLV+D++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  168  RAVPLNASLLVIDKQGGGGTKLSTVAPYTVLETSIHKAVTDAF--AAETAMIPRVRAVAP  225

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE VLQSE   W +   NSMV V  G +CLG +DGG   
Sbjct  226  FKLCYDGSKVGSTRVGPAVPTVELVLQSEAASWVVFGANSMVAVKGGALCLGVVDGGAAP  285

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVV+GG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  286  RTSVVVGGHMMEDNLLEFDLQRSRLGFSSSLLFRQTTCNNF  326



>ref|XP_006387875.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
 gb|ERP46789.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
Length=411

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 109/162 (67%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A   + RV  VA
Sbjct  245  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELAL--VPRVASVA  302

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V W +   NSMV+V   VMCLGF+DGGL 
Sbjct  303  PFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQVKSDVMCLGFVDGGLN  362

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  363  PRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  404



>ref|XP_007034629.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05555.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=436

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN +LL +++E  GGT+ISTV PYT ++T+IY   +++++++ +   + RV  VAP
Sbjct  272  KAVQLNNTLLSINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIKAISQ--IPRVPAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         VG  VP+++ VLQS+ V W +   NSMV+V + V+CLGF+DGGL  
Sbjct  330  FSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVSNDVLCLGFVDGGLEP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  390  TTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  430



>gb|KEH36784.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=430

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 111/162 (69%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++ LNTSLL +  E EGGT++ST+ PYT ++T+IY+ F+D++ +    +   +V PV P
Sbjct  266  KQISLNTSLLSIGDEGEGGTKVSTLNPYTIMETSIYNDFVDAFAKELEDV--PKVKPVKP  323

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++CF       + VG  VP ++FVLQ++ V WRM   NSMV+V  GV CL F+DGG+  
Sbjct  324  FKLCFNLQNLGVTRVGPAVPTIDFVLQNKDVFWRMFGANSMVQVSYGVYCLAFVDGGVEV  383

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F 
Sbjct  384  TTSIVIGGHQLEDNLLQFDLHNSRLGFSSSLLSRQTTCANFN  425



>ref|XP_004134152.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170541.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57019.1| hypothetical protein Csa_3G149990 [Cucumis sativus]
Length=429

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D    GGT+ISTV PYT L+T+IY   + ++     +  + RV  VAP
Sbjct  265  KTVPLNTTLLKIDSNGNGGTKISTVNPYTVLETSIYRALVKTFTSELGN--IPRVAAVAP  322

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVC+S        +G  VP ++ +LQ++ V WRM   NSMV V + V+CLGF++GG+  
Sbjct  323  FEVCYSSKSFGSTELGPSVPSIDLILQNKKVIWRMFGANSMVVVTEEVLCLGFVEGGVEA  382

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIGG+Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  383  ETAMVIGGHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANF  423



>gb|KCW49915.1| hypothetical protein EUGRSUZ_K03382 [Eucalyptus grandis]
Length=422

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 107/159 (67%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            L LN++LL +D E  GGT+ISTV PYT L+++IY    +++++ A S+ ++RV  V+PFE
Sbjct  258  LSLNSTLLSIDSEGYGGTKISTVNPYTVLESSIYASLTEAFVKEATSINITRVSAVSPFE  317

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG+ VP +  VLQ E   W +   NSMV+V   V+CLGF+DGG     
Sbjct  318  YCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSMVEVSQDVLCLGFVDGGSRPRT  377

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  378  SIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  416



>ref|XP_008390829.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=438

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 107/158 (68%), Gaps = 14/158 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +D E  GGT++STV PYT L+ +IY+  ++++++  A+  + RV  VAPF  C
Sbjct  278  LNTSLLAIDNEGYGGTKLSTVNPYTVLEKSIYNAVVNAFVKEVAN--IPRVKAVAPFGAC  335

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F+        VG  VP+++ VLQSE V WR+   NSMV+V D V+CLGF+DGG     S+
Sbjct  336  FNSKNIGSTRVGPAVPQIDLVLQSESVYWRIFGANSMVQVSDDVLCLGFVDGGERPRTSI  395

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            VIGG+QLEDNL++ +L  S LGF+S  L   T+C++F 
Sbjct  396  VIGGHQLEDNLVQIDLAASKLGFSSSLLFRQTTCANFN  433



>ref|XP_008458562.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=417

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 112/165 (68%), Gaps = 16/165 (10%)
 Frame = -3

Query  739  KLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDP  572
            +L LN SLL L++  +GG    TR+STVVPYT L+++I++    ++  +AA+M +  V P
Sbjct  244  RLDLNKSLLDLEEAGDGGGGGGTRLSTVVPYTALESSIFNSLTVAFRAAAAAMNMKEVAP  303

Query  571  VAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG  422
            VAPFE CF       +  G  VP++E +LQSEMV W++   NSMVKV D   CLGF+DGG
Sbjct  304  VAPFEACFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDKAYCLGFVDGG  363

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            L    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F+
Sbjct  364  LKPRNAIVLGGYQMEDIVLDFDIGTSMLGFSSSLLQRKRSCSEFS  408



>ref|XP_010111673.1| Basic 7S globulin [Morus notabilis]
 gb|EXC31441.1| Basic 7S globulin [Morus notabilis]
Length=421

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = -3

Query  685  TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDV  527
             ++ST+VPYTT++++IY  F+ +Y  +A SM ++RV+ VAPF +CF       +  G +V
Sbjct  271  AKLSTIVPYTTMESSIYAVFVKAYERAALSMNMTRVESVAPFGLCFGVETVPKTRFGPEV  330

Query  526  PKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFN  356
            P VE  LQSE+VKWR+   N MVKV D V+CLGFLDGGL  GAS+V+GG+QLED +L F+
Sbjct  331  PDVELGLQSELVKWRIHGRNLMVKVSDEVVCLGFLDGGLELGASIVLGGFQLEDVVLHFD  390

Query  355  LGTSMLGFTSLMA-GTSCSHF  296
            +G+SM+GF+ L+    SCS F
Sbjct  391  VGSSMMGFSPLLKWKRSCSDF  411



>ref|XP_010038107.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Eucalyptus 
grandis]
Length=437

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 107/159 (67%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            L LN++LL +D E  GGT+ISTV PYT L+++IY    +++++ A S+ ++RV  V+PFE
Sbjct  273  LSLNSTLLSIDSEGYGGTKISTVNPYTVLESSIYASLTEAFVKEATSINITRVSAVSPFE  332

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG+ VP +  VLQ E   W +   NSMV+V   V+CLGF+DGG     
Sbjct  333  YCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSMVEVSQDVLCLGFVDGGSRPRT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  393  SIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  431



>ref|NP_563679.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAG48774.1|AF332411_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72120.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|84105 and gb|AI100071 
come from this gene [Arabidopsis thaliana]
 gb|AEE27547.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=434

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 108/162 (67%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + LP++ +LL ++     GGT+IS+V PYT L+++IY  F   ++  AA+  + RV  V 
Sbjct  267  KTLPIDPTLLKINASTGIGGTKISSVNPYTVLESSIYKAFTSEFIRQAAARSIKRVASVK  326

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  327  PFGACFSTKNVGVTRLGYAVPEIQLVLHSKDVVWRIFGANSMVSVSDDVICLGFVDGGVN  386

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
             GASVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  387  PGASVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCANF  428



>gb|KDO74796.1| hypothetical protein CISIN_1g038219mg [Citrus sinensis]
Length=435

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (65%), Gaps = 9/156 (6%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL ++++  GGT++ST  PYT L+T+IY  F++++   A    + RV P+APF 
Sbjct  278  VPLNTSLLSINKQGNGGTKVSTADPYTVLETSIYKAFIETF-SKALLFNIPRVKPIAPFG  336

Query  556  VCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVI  395
             CF+     G+  P++  VL      W++   NSMV+VG   MCL F+DGG+    SVVI
Sbjct  337  ACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAMCLAFVDGGVNPRTSVVI  396

Query  394  GGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  397  GGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>ref|XP_006419827.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
 ref|XP_006489579.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
 gb|ESR33067.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
Length=435

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (65%), Gaps = 9/156 (6%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLL ++++  GGT++ST  PYT L+T+IY  F++++   A    + RV P+APF 
Sbjct  278  VPLNTSLLSINKQGNGGTKVSTADPYTVLETSIYKAFIETF-SKALLFNIPRVKPIAPFG  336

Query  556  VCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVI  395
             CF+     G+  P++  VL      W++   NSMV+VG   MCL F+DGG+    SVVI
Sbjct  337  ACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAMCLAFVDGGVNPRTSVVI  396

Query  394  GGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  397  GGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>ref|XP_006380060.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
 gb|ERP57857.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
Length=439

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + ++++  A   + RV  VA
Sbjct  273  KAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFVKELAL--VPRVASVA  330

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF+        VG  VP+++ VLQS  V W +   NSMV+V   VMCLGF+DGGL 
Sbjct  331  PFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQVKSDVMCLGFVDGGLN  390

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               S+VIGGYQLE+NLL+F++ TS LGF+S  L   T+C++F
Sbjct  391  PRTSIVIGGYQLENNLLQFDIATSRLGFSSSLLFRQTTCANF  432



>ref|XP_007034627.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05553.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=456

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNTSLL  D E  GGT+ISTV PY  ++T+IY+  + ++L+  A++  S+V  VAP
Sbjct  289  KTVPLNTSLLSFDNEGNGGTKISTVKPYMLMETSIYNAVVKAFLQEIANV--SQVAAVAP  346

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
               CF+         G  VP ++ VLQS++V WR+   NSMV V + V+CLG +DGG   
Sbjct  347  LGACFNSNSIEKTRAGPAVPPIDLVLQSDLVYWRVFGANSMVHVSENVLCLGAVDGGSNP  406

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  407  RTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  447



>ref|XP_006489306.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=394

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 113/155 (73%), Gaps = 9/155 (6%)
 Frame = -3

Query  709  LDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG  536
            L   +EG T++ST+VPY T++++IY  F  ++ ++AA  S  +S V PVAPF +CFS  G
Sbjct  240  LSVTIEGLTKLSTIVPYATMESSIYATFAKAFTKAAAAASRDMSVVAPVAPFSLCFSSKG  299

Query  535  ---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLED  374
               S VP ++FVLQSEMVKWR    NSMVKV + V+CLGFLDGG    +S+V+GG+QLED
Sbjct  300  FNGSAVPVIDFVLQSEMVKWRFYGSNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLED  359

Query  373  NLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  269
            N+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  360  NVMDFDLGTSMLGFSTLR-GTCCSDFSPNSVLDES  393



>gb|KDO74801.1| hypothetical protein CISIN_1g040581mg [Citrus sinensis]
Length=394

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 113/155 (73%), Gaps = 9/155 (6%)
 Frame = -3

Query  709  LDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG  536
            L   +EG T++ST+VPY T++++IY  F  ++ ++AA  S  +S V PVAPF +CFS  G
Sbjct  240  LSVTIEGLTKLSTIVPYATMESSIYATFAKAFTKAAAAASRDMSVVAPVAPFSLCFSSKG  299

Query  535  ---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLED  374
               S VP ++FVLQSEMVKWR    NSMVKV + V+CLGFLDGG    +S+V+GG+QLED
Sbjct  300  FNGSAVPVIDFVLQSEMVKWRFYGSNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLED  359

Query  373  NLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  269
            N+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  360  NVMDFDLGTSMLGFSTLR-GTCCSDFSPNSVLDES  393



>ref|XP_010255898.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=435

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 111/165 (67%), Gaps = 16/165 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + L LN +LL +DQ   GGT+ISTVVPYTT++T+IY     +++  AAS+ L+  DP+ P
Sbjct  262  KALELNKTLLAIDQNGFGGTKISTVVPYTTMETSIYKALTAAFITEAASLNLTXTDPLKP  321

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVK-VGDG---VMCLGFLDG  425
            F VC++        VG  VP ++ V++ + + WR+   NSMV+ VG+    V+CLGF+DG
Sbjct  322  FSVCYASNDVFSTRVGPAVPTIDLVMERDDIFWRIFGANSMVRMVGEKEEEVVCLGFVDG  381

Query  424  GLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  296
            G     S+VIGG+Q+EDNLL+F+LG   +GF+SL+    T+C++F
Sbjct  382  GANPRTSIVIGGHQMEDNLLQFDLGMKRVGFSSLLLIKQTNCANF  426



>ref|XP_004290668.1| PREDICTED: basic 7S globulin 2-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 110/162 (68%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + + +NT+LL ++     GGT+ISTV PYT L+ +I+    ++++  +A+  +SRV+ VA
Sbjct  272  KAVTINTTLLSINTTSGVGGTKISTVNPYTVLEASIFKAVTEAFITESAARNISRVNAVA  331

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PFEVCFS        +G  VP+++ VLQ+E   WR+   NSMV V D V+CLGF++GG  
Sbjct  332  PFEVCFSTENVLSTRLGPSVPEIDLVLQNESTYWRIFGANSMVYVSDNVVCLGFVNGGED  391

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               S+VIGG+QLEDNL++F+L  S +GF+S + G  T+CS+F
Sbjct  392  ARTSIVIGGHQLEDNLVQFDLAASRVGFSSTLLGRQTTCSNF  433



>ref|XP_009111159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Brassica 
rapa]
Length=434

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 105/162 (65%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL +D     GGT+ISTV PYT  +T+IY     +Y+  AA   ++RV  VA
Sbjct  267  KTVPINATLLKIDGTTGVGGTKISTVKPYTVQETSIYSASTAAYVREAAGRNITRVASVA  326

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  327  PFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSDDVICLGFVDGGVN  386

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  387  ARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  428



>gb|KCW49914.1| hypothetical protein EUGRSUZ_K03381, partial [Eucalyptus grandis]
Length=413

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R L LN++LL +D    GGT+ISTV PYT L+++I+    ++++E   +M ++R   V+P
Sbjct  247  RNLSLNSTLLSIDGNGYGGTKISTVDPYTVLESSIFATLTEAFVEEVTAMNITRASAVSP  306

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE CFS        VG  VP +  VLQS+ V W +   NSMV+V   V+CLGF+DGG   
Sbjct  307  FEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSMVQVSQDVLCLGFVDGGSSP  366

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  367  RTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  407



>ref|XP_006419821.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
 gb|ESR33061.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
Length=394

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 114/155 (74%), Gaps = 9/155 (6%)
 Frame = -3

Query  709  LDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG  536
            L   +EG T++ST+VPY T++++IY  F  ++ ++AA  S  +S V PVAPF +CFS  G
Sbjct  240  LSVTIEGLTKLSTIVPYATMESSIYATFAKAFTKAAAAASRDMSVVAPVAPFGLCFSSKG  299

Query  535  ---SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLED  374
               S VP ++FVLQSEMVKWR+   NSMVKV + V+CLGFLDGG    +S+V+GG+QLED
Sbjct  300  FNGSAVPVIDFVLQSEMVKWRIYGSNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLED  359

Query  373  NLLEFNLGTSMLGFTSLMAGTSCSHFTRFSMERDS  269
            N+++F+LGTSMLGF++L  GT CS F+  S+  +S
Sbjct  360  NVMDFDLGTSMLGFSALR-GTCCSDFSPNSVLDES  393



>ref|XP_006304586.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
 gb|EOA37484.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
Length=434

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 105/159 (66%), Gaps = 12/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+N  LL ++    GGT+ISTV PYT ++++IY  F   ++  AA+  ++RV  V PF 
Sbjct  270  VPINPRLLKINSTGFGGTKISTVNPYTVMESSIYKAFTSEFVRQAAARNITRVASVKPFG  329

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CFS        VG  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+    
Sbjct  330  ACFSTQNIGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRDDVICLGFVDGGVNART  389

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  390  SVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>ref|XP_010038106.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=438

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R L LN++LL +D    GGT+ISTV PYT L+++I+    ++++E   +M ++R   V+P
Sbjct  272  RNLSLNSTLLSIDGNGYGGTKISTVDPYTVLESSIFATLTEAFVEEVTAMNITRASAVSP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE CFS        VG  VP +  VLQS+ V W +   NSMV+V   V+CLGF+DGG   
Sbjct  332  FEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSMVQVSQDVLCLGFVDGGSSP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  392  RTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  432



>ref|XP_002889446.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65705.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 108/162 (67%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL ++     GGT+IS+V PYT L+++IY+ F   +++ AA+  ++RV  V 
Sbjct  266  KTVPINPTLLKINASTGFGGTKISSVNPYTVLESSIYNAFTSEFVKQAAARNITRVASVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  326  PFSACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVSDDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  386  ARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_010556788.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=464

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 109/161 (68%), Gaps = 15/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D +  GGT+ISTV PYT L+T+IY+  + +++   A+    RV  VAP
Sbjct  301  KPVPLNQTLLKIDDKGVGGTKISTVDPYTVLETSIYNAVVSAFVRETAA---KRVKAVAP  357

Query  562  FEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS  GVGS      VP ++ VLQ++ V W +   NS+V VG+ VMCLGF+DGG+  
Sbjct  358  FGACFSSKGVGSTRLGPAVPAIDLVLQNKDVVWSIFGANSVVSVGNDVMCLGFVDGGVNP  417

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGGYQLEDNL++ +L  S LGF+S + G  T+C++F
Sbjct  418  RTSIVIGGYQLEDNLIQLDLAASKLGFSSTLLGRRTTCANF  458



>ref|XP_010278299.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=426

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 112/173 (65%), Gaps = 14/173 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA-ASMGLSRVDPV  569
            +KL LN SLL +D +E  GGT++ TVVPY+T++++IY  F  ++  +A A+  ++RV  V
Sbjct  254  KKLSLNASLLSIDDREGTGGTKLGTVVPYSTMESSIYAIFTKAFERAAIAAFNMTRVASV  313

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGL  419
             PF VCFS         G  VP ++ VLQSEMV WR+   NSMV+V + VMCLGFLDGG 
Sbjct  314  GPFGVCFSSESVDITRTGPSVPTIDLVLQSEMVYWRISGANSMVQVSEDVMCLGFLDGGP  373

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSMERDSA  266
                S+V+GG+QLE+NL+  ++G S LGF+S  L    +CS F    + R S+
Sbjct  374  NARTSIVVGGFQLENNLVLLDVGASRLGFSSSLLTRQMTCSDFNLRPIRRVSS  426



>ref|NP_171821.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAK17160.1|AF325092_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72119.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|H37281, gb|T44167, 
gb|T21813, gb|N38437, gb|Z26470, gb|R65072, gb|N76373, 
gb|F15470, gb|Z35182, gb|H76373, gb|Z34678 and gb|Z35387 
come from this gene [Arabidopsis thaliana]
 gb|AAK59531.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15204.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27546.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=433

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 108/162 (67%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL ++     GGT+IS+V PYT L+++IY+ F   +++ AA+  + RV  V 
Sbjct  266  KTVPINPTLLKINASTGIGGTKISSVNPYTVLESSIYNAFTSEFVKQAAARSIKRVASVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP++E VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  326  PFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANSMVSVSDDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  386  ARTSVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCANF  427



>ref|XP_002517164.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45327.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=433

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 111/162 (69%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLNT+LL ++ +   GGT ISTVVPYT ++TTIY+ F++++++    + + RV  VA
Sbjct  268  KPVPLNTTLLSINSQTGFGGTMISTVVPYTVMETTIYNAFVNAFVKEL--VDVPRVASVA  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF         +G+ VP ++ VLQS  V WR+   NSMV+V + V+CLGF+DGG  
Sbjct  326  PFGACFDASKIVGTRLGAAVPSIDLVLQSSNVFWRIVGANSMVQVNEDVLCLGFVDGGEN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  296
               S+VIGG+QLEDNLL+F+L TS LGF+S +    T+C++F
Sbjct  386  PRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLFSRQTTCANF  427



>gb|KJB25917.1| hypothetical protein B456_004G215700 [Gossypium raimondii]
Length=442

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 113/172 (66%), Gaps = 17/172 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N+SLL +++   GGT+IST VPYT L+++IY+    +++  ++++ L+  D V P
Sbjct  272  KPIQINSSLLAVEENGSGGTKISTAVPYTVLESSIYNALTTAFVNESSALNLTVTDTVKP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV----GDGVMCLGFLDG  425
            F VC+S        VG  VP V+FV+QS+ V WR+   NSMV++    G  V CLGF+DG
Sbjct  332  FGVCYSAADITVTRVGPGVPTVDFVMQSDNVFWRVFGSNSMVRITRDGGGDVWCLGFVDG  391

Query  424  GLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSMER  275
            G+    SVVIGG Q+ DNLL+F+L  S LGFTS  L+ GT+CS+F  F+  R
Sbjct  392  GVNPRTSVVIGGQQMVDNLLQFDLDNSRLGFTSSVLLKGTTCSNF-NFASTR  442



>ref|XP_010522709.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=418

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 108/159 (68%), Gaps = 15/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            LPLN +LL ++ E  G T+ISTV PYT ++T+IY+  L +++   A+    RV  VAPF 
Sbjct  257  LPLNQTLLKINSEGFGRTKISTVNPYTVMETSIYNAVLSAFVRDTAA---KRVAAVAPFG  313

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CFS        +G+ VP+++ VLQS  V W++   NSMV V D V+CLGF+DGG+   +
Sbjct  314  ACFSTEGVASTRLGAAVPEIDLVLQSSDVVWKIFGANSMVSVSDNVICLGFVDGGVNPMS  373

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            S+VIGG+QLEDNL++F+L  S LGF+S + G  T+C++F
Sbjct  374  SIVIGGHQLEDNLVQFDLAASRLGFSSTLLGSRTNCANF  412



>gb|KDO35982.1| hypothetical protein CISIN_1g037784mg, partial [Citrus sinensis]
Length=244

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 106/159 (67%), Gaps = 13/159 (8%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNT+LL +D E  GGT+ ST VPYT L+T+IY   L +++  A    ++RV PV PF 
Sbjct  82   IPLNTTLLSIDSEGIGGTKFSTAVPYTVLETSIYKALLQAFVN-AMPTKVTRVAPVVPFG  140

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF       S +G  VP+++ VLQ+  V W +   NS+V+V + V CLGF+DGG+    
Sbjct  141  ACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVSNDVSCLGFVDGGVTPKT  200

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIGG+QL++NL++F++ +S LGF++  L+  T CS+F
Sbjct  201  SIVIGGHQLDNNLVQFDIASSRLGFSNSLLLQRTMCSNF  239



>ref|XP_010481702.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=438

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 111/163 (68%), Gaps = 13/163 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            +K+P+++ LL +++    GGT+IS+V PYT ++++IY+ F   ++  AA+  ++RV  V 
Sbjct  271  KKVPISSKLLKINRSTGFGGTKISSVNPYTVMESSIYNSFTSEFVRQAAARNITRVASVK  330

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  331  PFGACFSTKNVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRDDVICLGFVDGGVN  390

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
               SV+IGG+QLEDNL+EF+L ++  GF+S + G  T+C++F+
Sbjct  391  AKTSVMIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANFS  433



>ref|XP_006419823.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
 gb|ESR33063.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
Length=422

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 108/161 (67%), Gaps = 13/161 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D E  GGT+ ST VPYT L+T+IY   L +++  A    ++RV PVAP
Sbjct  258  KAIPLNTTLLSIDSEGIGGTKFSTAVPYTVLETSIYKALLQAFVN-AMPTKVTRVAPVAP  316

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       S +G  VP+++ VLQ+  V W +   NS+V+V + V CLGF+DGG+  
Sbjct  317  FGACFNSRDIGSSRLGPSVPQIDLVLQNSKVFWSIIGANSIVRVSNDVSCLGFVDGGVTP  376

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  377  KTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>ref|XP_004151001.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN47256.1| Basic 7S globulin 2 small subunit [Cucumis sativus]
Length=414

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 111/166 (67%), Gaps = 16/166 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVD  575
             +L LN SLL L+   +G     TR+STVVPYT L+++I++    ++  +AA+M +  V 
Sbjct  240  NRLDLNKSLLDLEGVGDGEGGGGTRLSTVVPYTVLESSIFNSLTAAFRAAAAAMNMKEVA  299

Query  574  PVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDG  425
            PVAPFEVCF       +  G  VP++E +LQSEMV W++   NSMVKV D   CLGF+DG
Sbjct  300  PVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDEAYCLGFVDG  359

Query  424  GLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F+
Sbjct  360  GLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRSCSEFS  405



>ref|XP_003637703.1| Basic 7S globulin [Medicago truncatula]
 gb|KEH32186.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=454

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 112/164 (68%), Gaps = 17/164 (10%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
             NT+LL +++  EGGT++STV+P+TTL T+IY+P L+++++ A    + RV  VAPF  C
Sbjct  292  FNTTLLSINKLGEGGTKLSTVIPHTTLHTSIYNPLLNAFVKKAEIRKIKRVKAVAPFGAC  351

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG---LGQG  410
            F       S  G +VP ++ VL+   V+WR+   NSMVKV + V+CLGF+D G   +G  
Sbjct  352  FDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSMVKVNENVLCLGFVDAGSEEVGPS  410

Query  409  A-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  287
            A S++IGG+QLEDNL+EF+L +S LGF+S  L+   SCSHF  F
Sbjct  411  ATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKASCSHFRGF  454



>gb|AFK34779.1| unknown [Medicago truncatula]
Length=454

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 112/164 (68%), Gaps = 17/164 (10%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
             NT+LL +++  EGGT++STV+P+TTL T+IY+P L+++++ A    + RV  VAPF  C
Sbjct  292  FNTTLLSINKLGEGGTKLSTVIPHTTLHTSIYNPLLNAFVKKAEIRKIKRVKAVAPFGAC  351

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG---LGQG  410
            F       S  G +VP ++ VL+   V+WR+   NSMVKV + V+CLGF+D G   +G  
Sbjct  352  FDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSMVKVNENVLCLGFVDAGSEEVGPS  410

Query  409  A-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  287
            A S++IGG+QLEDNL+EF+L +S LGF+S  L+   SCSHF  F
Sbjct  411  ATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKASCSHFRGF  454



>ref|XP_004134154.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170543.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57020.1| Xyloglucan-specific endoglucanase inhibitor protein [Cucumis 
sativus]
Length=435

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D    GGT+ISTV P+T L+++IY   + ++    +   + RV  VAP
Sbjct  271  KPVPLNTTLLKIDSNGNGGTKISTVNPFTVLESSIYKALVKAFTTEVSK--VPRVGAVAP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVC+S        +G+ VP ++ VLQ++ V W M   NSMV+V D V+CLGF+DGG+  
Sbjct  329  FEVCYSSKSFPSTRLGAGVPTIDLVLQNKKVIWSMFGANSMVQVNDEVLCLGFVDGGVDV  388

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  389  RTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>gb|AAX81588.1| nectarin IV [Nicotiana langsdorffii x Nicotiana sanderae]
Length=437

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++    + ++RV  VAP
Sbjct  273  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSMYNAVTNFFVKEL--VNITRVASVAP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         VG  VP+++ VLQ+E V W +   NSMV+V + V+CLGF+DGG+  
Sbjct  331  FGACFDSRTIVSTRVGPAVPQIDLVLQNENVFWTIFGANSMVQVSENVLCLGFVDGGINP  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  391  RTSIVIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  431



>pdb|3VLB|A Chain A, Crystal Structure Of Xeg-edgp
 pdb|3VLB|C Chain C, Crystal Structure Of Xeg-edgp
Length=413

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +A+  ++RV  VAPF  C
Sbjct  253  LNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKESAARNITRVASVAPFGAC  312

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS        +G  VP ++ VLQSE V W +   NSMV + D V+CLG +DGG     S+
Sbjct  313  FSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDNVVCLGVVDGGSNLRTSI  372

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  373  VIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>dbj|BAA03413.1| EDGP precursor [Daucus carota]
Length=433

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +A+  ++RV  VAP
Sbjct  269  KIVALNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKESAARNITRVASVAP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        +G  VP ++ VLQSE V W +   NSMV + D V+CLG +DGG   
Sbjct  329  FGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDNVVCLGVVDGGSNL  388

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  389  RTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  429



>pdb|3VLA|A Chain A, Crystal Structure Of Edgp
Length=413

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +A+  ++RV  VAPF  C
Sbjct  253  LNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKESAARNITRVASVAPFGAC  312

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS        +G  VP ++ VLQSE V W +   NSMV + D V+CLG +DGG     S+
Sbjct  313  FSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDNVVCLGVVDGGSNLRTSI  372

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  373  VIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>ref|XP_006296506.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
 gb|EOA29404.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
Length=437

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 106/161 (66%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P++  LL ++    GGT+IS+V PYT ++++IY  F   ++  AA+  ++RV  V P
Sbjct  271  KTIPISPRLLKINSTGFGGTKISSVNPYTVMESSIYKAFTSEFVRQAAARNITRVASVKP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        VG  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+  
Sbjct  331  FGACFSTQNVGVTRVGYAVPEIQLVLHSKDVVWRIFGGNSMVSVRDDVICLGFVDGGVNA  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  391  RTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  431



>gb|AAT85209.1| unknown protein [Oryza sativa Japonica Group]
Length=255

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  94   RAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--AAETSMIPRVPAVAP  151

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE V QSE   W +   NSMV    G +CLG +DGG+  
Sbjct  152  FKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCLGVVDGGVAS  211

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  212  ETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  252



>ref|XP_006419825.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
 gb|ESR33065.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
Length=409

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D E  GGT+ S  VPYT L+T+IY   L +++  A    ++RV PVAP
Sbjct  245  KAIPLNTTLLSIDSEGIGGTKFSAAVPYTALETSIYKALLQAFVN-AMPTKVTRVAPVAP  303

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       S +G  VP+++ VLQ+  V W +   NS+V+V + V CLGF+DGG+  
Sbjct  304  FGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIVGANSIVRVSNDVSCLGFVDGGVTP  363

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F 
Sbjct  364  KTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNFN  405



>gb|AAM61574.1| EDGP precursor [Arabidopsis thaliana]
Length=433

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N +LL ++     GGT+IS+V PYT L+++IY+ F   +++ A +  + RV  V 
Sbjct  266  KTVPINPTLLKINASTGFGGTKISSVNPYTVLESSIYNAFTSEFVKQALARSIKRVASVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP++E VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  326  PFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANSMVSVSDDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  386  ARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCANF  427



>ref|XP_004495218.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=436

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 104/159 (65%), Gaps = 10/159 (6%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL ++    GGT+ISTV PYT L+ +IY    D +++++ +  L+RVD   P
Sbjct  272  KVVSLNTSLLSINSNGIGGTKISTVDPYTVLEASIYKAVTDGFVKASVARNLTRVDSFHP  331

Query  562  FEVCFSGVG-----SDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
            FE C++ +G     + VP +E VLQ+E V W +   NSMV + D V CLGF++GG     
Sbjct  332  FEFCYTNLGGTRLGAAVPTIELVLQNENVVWSIFGANSMVNINDEVSCLGFVNGGENVRT  391

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            S+VIGGYQL++NLL+F+L  S LGF+S + G  T C +F
Sbjct  392  SIVIGGYQLDNNLLQFDLAASRLGFSSTLFGRQTGCYNF  430



>ref|XP_007034624.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05550.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=387

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 100/160 (63%), Gaps = 12/160 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            L TSLL +D +  GGT+ ST+ PYT L T+IY      +   AA++ +SRV  VAPF +C
Sbjct  228  LKTSLLTIDVKGFGGTKFSTIDPYTVLHTSIYKALGQEFANKAAALKISRVASVAPFGLC  287

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS         G  V  ++ VL+S    WR+   NSMVKV   VMCLGF+DGG     S+
Sbjct  288  FSSKTTRNSETGPAVRVIDLVLESNSAPWRIYGHNSMVKVDKNVMCLGFVDGGSKPRTSI  347

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  287
            VIGG+Q+EDNL EF+L +S LGF+S  L+  TSCSHF  F
Sbjct  348  VIGGHQVEDNLGEFDLVSSKLGFSSSLLLKNTSCSHFRVF  387



>emb|CDO98879.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 108/163 (66%), Gaps = 15/163 (9%)
 Frame = -3

Query  742  RKLPLNTSLL-VLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + + +N++LL + D++  GGT+ISTV PYT ++ +IY  F  ++ +  A  G+ RV PVA
Sbjct  266  KPVAINSTLLKIFDKDGNGGTKISTVNPYTVMERSIYKAFTSAFAK--AFSGVPRVAPVA  323

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PFEVCF+        VG   P ++ VLQS+ V WR+   NSMV+V + V+CLGF+DGGL 
Sbjct  324  PFEVCFNSSKLGSTRVGPPAPTIDLVLQSQSVFWRIFGANSMVQVKEDVLCLGFVDGGLN  383

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
               S+VIG +Q+ DNLL+F+L  S LGF+S  L   T+CS+F 
Sbjct  384  PRTSIVIGLHQIVDNLLQFDLARSRLGFSSTLLFQQTTCSNFN  426



>gb|AIL30493.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Nicotiana tabacum]
Length=437

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++    + ++RV  VAP
Sbjct  273  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVKEL--VNITRVASVAP  330

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + VG  VP ++ VLQ+E V WR+   NSMV+V + V+CLGF+DGG+  
Sbjct  331  FGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVSENVLCLGFVDGGVNP  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  391  RTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  431



>ref|XP_011099700.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=433

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 103/165 (62%), Gaps = 16/165 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            R L  N +LL +D+    GGT I TV PYT L  +I +  +  ++E+AAS  ++RV  VA
Sbjct  266  RTLSFNKTLLSIDKSTGAGGTSIRTVRPYTGLHRSILNALIKEFVEAAASKNITRVASVA  325

Query  565  PFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG--  422
            PFE CF       S  G DVP ++ VLQS+ + WR    NSMV+V + V+CL F+DGG  
Sbjct  326  PFEACFDSKTVGSSKTGPDVPTIDLVLQSKNIYWRFYGSNSMVRVSNDVICLAFVDGGSN  385

Query  421  -LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              G   SVV+GG+QLE++LLEF++  S L F+S  L  GTSCS F
Sbjct  386  LTGPTTSVVVGGHQLENHLLEFDVAASRLRFSSSLLFHGTSCSQF  430



>ref|XP_009611839.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=438

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++    + ++RV  VAP
Sbjct  274  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVKEL--VNITRVASVAP  331

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + VG  VP ++ VLQ+E V WR+   NSMV+V + V+CLGF+DGG+  
Sbjct  332  FGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVSENVLCLGFVDGGVNP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  392  RTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  432



>ref|XP_006489308.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=429

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 104/160 (65%), Gaps = 14/160 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ ++++S ++  + RV P+APF 
Sbjct  266  VPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFIKSYSN--IPRVKPMAPFG  323

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG+  P++   +      W++   NSMV+VG   MCL F+DGG+    
Sbjct  324  ACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGANSMVRVGKHAMCLAFVDGGVNPTT  383

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  384  SIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>ref|XP_004236054.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N  LL +D+   GGT+IST  PY+ L+T+IY     ++++  ++   +RV  VAP
Sbjct  272  KPVTINKKLLGVDKNGNGGTKISTGTPYSMLETSIYDVVTKAFIDELSNA--TRVAAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE+CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLGF++GG+ +
Sbjct  330  FEICFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLGFVNGGIKR  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             AS+VIGGYQLEDNLL+F+L  S LGF+S  L+  T+C++ 
Sbjct  390  TASIVIGGYQLEDNLLQFDLARSTLGFSSSLLLHQTACANL  430



>dbj|BAJ94733.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN SLL +D++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  269  RAVPLNASLLAIDKQGGGGTKLSTVAPYTVLETSIHKAVTDAF--AAETAMIPRVRAVAP  326

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE VLQ+E   W +   NSMV    G +CLG +DGG   
Sbjct  327  FKLCYDGSKVGSTRVGPAVPTVELVLQNEAASWVVFGANSMVAAKGGALCLGVVDGGAAP  386

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  + LGF+S  L   T+C++F
Sbjct  387  RTSVVIGGHTMEDNLLEFDLQRARLGFSSSLLFRQTTCNNF  427



>ref|XP_002877156.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53415.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+N  LL +++E   GGT+IS+V PYT L+++I+  F   ++  A +  ++RV  V 
Sbjct  253  KTVPINQMLLKINKETGFGGTKISSVNPYTVLESSIFKSFTSMFVRQATARNMTRVASVK  312

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  313  PFSACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGGNSMVSVSDDVICLGFVDGGVN  372

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  373  ARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCANF  414



>ref|XP_010457326.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P++  LL +D     GGT+IS+V PYT ++++IY+ F   ++  AA+  ++RV  V 
Sbjct  266  KTVPISPKLLKIDGSTGIGGTKISSVNPYTVMESSIYNSFTSEFVRQAAARNMTRVASVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  326  PFGACFSTKNVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRDDVICLGFVDGGVN  385

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  386  AKTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum]
Length=437

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++  A++  +RV  VAP
Sbjct  273  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVKELANV--TRVAAVAP  330

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCF       + VG  VP ++ VLQ+E V W +   NSMV+V + V+CLG LDGG+  
Sbjct  331  FKVCFDSRNIGSTRVGPAVPSIDLVLQNENVVWTIFGANSMVQVSENVLCLGVLDGGVNS  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  391  RTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>ref|XP_008438718.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D    GGT+ISTV P+T L+++IY   + ++    +   + RV  VAP
Sbjct  271  KPVPLNTTLLKIDSNGNGGTKISTVNPFTVLESSIYKALVKAFTTEVSK--VPRVAAVAP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVC++        +G+ VP ++ VLQ++ V W +   NSMV+V D V+CLGF+DGG+  
Sbjct  329  FEVCYNSKSFPSTRLGAGVPTIDLVLQNKKVIWSIFGANSMVQVNDDVLCLGFVDGGVDV  388

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  389  RTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>ref|XP_010474940.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=432

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 107/162 (66%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P++  LL +D     GGT+IS+V PYT ++++IY+ F   ++  AA+  ++RV  V 
Sbjct  265  KTVPISPKLLKIDGSTGIGGTKISSVNPYTVMESSIYNSFTSEFVRQAAARNMTRVASVK  324

Query  565  PFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF       + VG  VP+++ VL S+ V WR+   NSMV V D V+CLGF+DGG+ 
Sbjct  325  PFGACFRTENVGVTRVGYAVPEIQLVLHSKDVVWRIFGANSMVSVRDDVICLGFVDGGVD  384

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG+QLEDNL+EF+L T+  GF+S + G  T+C++F
Sbjct  385  AKTSVVIGGFQLEDNLVEFDLATNRFGFSSTLLGRSTNCANF  426



>ref|XP_004170412.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
Length=414

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 16/166 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVD  575
             +L LN SLL L+   +G     TR+STVVPYT L+++I++    ++  +AA+M +  V 
Sbjct  240  NRLDLNKSLLDLEGVGDGEGGGGTRLSTVVPYTVLESSIFNSLTAAFRAAAAAMNMKEVA  299

Query  574  PVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDG  425
            PVAPFEVCF       +  G  VP++E +LQSEMV W++   NSMVKV D   CLGF+DG
Sbjct  300  PVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSMVKVNDEAYCLGFVDG  359

Query  424  GLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L     CS F+
Sbjct  360  GLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRFCSEFS  405



>ref|XP_008438715.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 108/161 (67%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D+   GGT+IST+ PYT L+++IY+  + +      +  + RV  VAP
Sbjct  272  KTVPLNTTLLKIDRNGNGGTKISTIHPYTVLESSIYNALVKTITTELRN--IPRVAAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VC+         +G  +P ++ +LQ++ V WR+   NSMV+V D V+CLGF+DGG+  
Sbjct  330  FGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNDDVLCLGFVDGGVEA  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  390  RTAIVIGAHQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  430



>ref|XP_010678844.1| PREDICTED: basic 7S globulin 2-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 106/171 (62%), Gaps = 23/171 (13%)
 Frame = -3

Query  739  KLPL--NTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            K P+  ++SLL  D+   GGT+IST+ PYT L ++IY   +D ++  A +M ++RV PVA
Sbjct  259  KTPIRFSSSLLSFDKNGIGGTKISTLDPYTVLHSSIYKALIDVFVSKATAMKMTRVAPVA  318

Query  565  PFEVCFSG--------VGSDVPKVEFVL--------QSEMVKWRM---NSMVKVGDGVMC  443
            PF  CF+          G +VP ++ +L             +WR+   NSMVKV D V+C
Sbjct  319  PFGACFNAKSVVNSAKTGFNVPVIDMILDGKSSLLHNKNNARWRIYGANSMVKVSDDVLC  378

Query  442  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            LGF+DGGL    S+VIGG Q+EDNL+EF+L ++ LG TS  L  GTSCS+F
Sbjct  379  LGFVDGGLESRTSIVIGGKQMEDNLVEFDLESNKLGITSSLLRMGTSCSNF  429



>ref|XP_007144622.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
 gb|ESW16616.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
Length=435

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 113/158 (72%), Gaps = 14/158 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +NT+LL ++ +  GGT+IS+V PYT L+ +I+    +++++++A+  ++RV  VAPFEVC
Sbjct  273  VNTTLLSINSDGVGGTKISSVNPYTVLEASIFKAVTEAFVKASAARNITRVAGVAPFEVC  332

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG-VMCLGFLDGGLGQGAS  404
            FS        +G+ VP +E +LQ++ + WR+   NS+V V D  ++CLGF++GG     S
Sbjct  333  FSSENVLATRLGASVPTIELLLQNQKI-WRIFGANSVVSVNDDEILCLGFVNGGEKLRTS  391

Query  403  VVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            +VIGGYQLE+NLL+F+L TS LGF+SL+ G  T+C++F
Sbjct  392  IVIGGYQLENNLLQFDLATSRLGFSSLLFGSRTTCANF  429



>gb|KCW58886.1| hypothetical protein EUGRSUZ_H01512 [Eucalyptus grandis]
Length=351

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 17/166 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-ESAASMGLSRVDPV  569
            + +PLN +LL +D+E   GGT ISTV+PYT L+T+I+     ++  E++A+  L+ + PV
Sbjct  178  KVVPLNATLLAIDEESGRGGTLISTVLPYTALQTSIFRAVTQAFAREASAAFNLTTIQPV  237

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLD  428
             PF +C+S         G  VP ++ V+QSE V WR+   NSMV++   G    CLG +D
Sbjct  238  KPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQRKGTDAWCLGLVD  297

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            GG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  298  GGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  343



>ref|XP_007034628.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05554.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=381

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 107/162 (66%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN  LL +++E  GGT+ISTV PYT ++T+IY   ++++++  +   + RV  VAP
Sbjct  217  KAVQLNEPLLAINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIKEISK--IPRVPAVAP  274

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
               CF+        +G  VP+++ VLQS+ V WR+   NSMV+V + V+CLGF+DGGL  
Sbjct  275  LRACFNAKSFASTRLGPAVPQIDLVLQSKDVIWRIVGANSMVEVSNDVLCLGFVDGGLKP  334

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              S+VIGG Q+E+NLL+F+L T  LGF+S  L   T+CS+F 
Sbjct  335  TTSIVIGGRQIENNLLQFDLATLRLGFSSSLLFQQTTCSNFN  376



>gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia 
x hybrida]
Length=436

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 106/161 (66%), Gaps = 15/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++    + +  V  VAP
Sbjct  273  KVVPINTTLLSIDSQGVGGTKISTVNPYTILETSIYNAVTNFFVKE---LAIPTVPSVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF         VG  VP ++ VLQ+E V WR+   NSMV V + V+CLGF+DGG+  
Sbjct  330  FGVCFDSRNITSTRVGPGVPSIDLVLQNENVFWRIFGANSMVLVSENVLCLGFVDGGVNP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+ +EDNLL+F+L  S LGFTS  L   T+C++F
Sbjct  390  RTSIVIGGHTIEDNLLQFDLAASRLGFTSSILFRQTTCANF  430



>ref|XP_009773897.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=433

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 11/158 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+N  LL +D+   GGT+IST  PYT L+++IY     ++++  ++  ++RV  VAP
Sbjct  272  KSVPINKKLLSIDKRGNGGTKISTGSPYTILESSIYDAVTKAFVQELSN--VTRVAAVAP  329

Query  562  FEVCFS--GVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGAS  404
            FE CFS   +GS   VP ++ VLQS+ V WR+   NSMV+V   V+CLGF++GG+    S
Sbjct  330  FETCFSSKNIGSTRAVPAIDLVLQSKQVYWRIFGSNSMVEVSPDVICLGFVNGGIKPTTS  389

Query  403  VVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            +VIGGYQLEDNLL+F+L  S LGF+S  L    +C++F
Sbjct  390  IVIGGYQLEDNLLQFDLPRSTLGFSSSLLFRQITCANF  427



>ref|XP_010475063.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=434

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P++  LL ++    GGT+IS+V PYT ++++IY  F   ++  AA+  ++RV  V P
Sbjct  268  KTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTSEFVRQAAARNITRVASVKP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+  
Sbjct  328  FGACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRDDVICLGFVDGGVNA  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  388  RTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>ref|XP_010483190.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P++  LL ++    GGT+IS+V PYT ++++IY  F   ++  AA+  ++RV  V P
Sbjct  267  KTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTSEFVRQAAARNITRVASVKP  326

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+  
Sbjct  327  FGACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRDDVICLGFVDGGVNA  386

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  387  RTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_009118711.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=432

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 106/162 (65%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +  N +LL +D     GGT+ISTV PYT ++TTI++ F  +++++AA+M ++RV  V 
Sbjct  265  KSVTFNKTLLKIDGTTGFGGTKISTVDPYTVMETTIFNKFRMAFVKAAAAMNITRVPSVK  324

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---SMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP ++ VL S  V WR+N   SMV V   V+CLGF+DGG+ 
Sbjct  325  PFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANSMVSVSRDVICLGFVDGGVN  384

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++F
Sbjct  385  ARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCANF  426



>ref|XP_010457449.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P++  LL ++    GGT+IS+V PYT ++++IY  F   ++  AA+  ++RV  V P
Sbjct  267  KTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTSEFVRQAAARNITRVASVKP  326

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        +G  VP+++ VL S  V WR+   NSMV V D V+CLGF+DGG+  
Sbjct  327  FGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSMVSVRDDVICLGFVDGGVNA  386

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  387  RTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_004170542.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Cucumis 
sativus]
Length=432

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D    GGT+ISTV PYT L+++IY+  + +      +  + RV  VAP
Sbjct  268  KTVPINTTLLKIDSNGNGGTKISTVHPYTVLESSIYNALVKTITRELRN--IPRVAAVAP  325

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VC+         +G  +P ++ +LQ++ V WR+   NSMV+V + V+CLGF+DGG+  
Sbjct  326  FGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNEEVLCLGFVDGGVEA  385

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  386  RTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|XP_004134153.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57018.1| hypothetical protein Csa_3G149980 [Cucumis sativus]
Length=432

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D    GGT+ISTV PYT L+++IY+  + +      +  + RV  VAP
Sbjct  268  KTVPINTTLLKIDSNGNGGTKISTVHPYTVLESSIYNALVKTITRELRN--IPRVAAVAP  325

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VC+         +G  +P ++ +LQ++ V WR+   NSMV+V + V+CLGF+DGG+  
Sbjct  326  FGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVNEEVLCLGFVDGGVEA  385

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  386  RTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++  A++  +RV  VAP
Sbjct  274  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVKELANV--TRVAVVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF         VG  VP ++ VLQ+  V W +   NSMV+V + V+CLG LDGG+  
Sbjct  332  FRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVSENVLCLGVLDGGVNA  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            G S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  392  GTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  432



>dbj|BAK57511.1| extracellular dermal glycoprotein [Nicotiana benthamiana]
Length=440

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 106/157 (68%), Gaps = 14/157 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            +NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++    + ++RV  VAPF  C
Sbjct  280  INTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVKEL--VNITRVASVAPFGAC  337

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F       + VG  VP ++ VLQ+E V W +   NSMV+V + V+CLGF+DGG+    S+
Sbjct  338  FDSRNIVSTRVGPTVPPIDLVLQNENVFWTIFGANSMVQVSENVLCLGFVDGGVNPRTSI  397

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  398  VIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  434



>emb|CDY32500.1| BnaA09g50960D [Brassica napus]
Length=434

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 106/162 (65%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +  N +LL +D     GGT+ISTV PYT ++TTI++ F  +++++AA+M ++RV  V 
Sbjct  267  KSVTFNKTLLKIDGTTGFGGTKISTVDPYTVMETTIFNKFRMAFVKAAAAMNITRVPSVK  326

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---SMVKVGDGVMCLGFLDGGLG  416
            PF  CFS        VG  VP ++ VL S  V WR+N   SMV V   V+CLGF+DGG+ 
Sbjct  327  PFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANSMVSVSRDVICLGFVDGGVN  386

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++F
Sbjct  387  ARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCANF  428



>ref|XP_004486304.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=431

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +  E EGGT+IST+ PYT ++T+IY+ F+D++ +    +   +   + P
Sbjct  267  KLISLNTSLLSIGDEGEGGTKISTLNPYTIMETSIYNSFVDAFAKELEDV--PKAKAIKP  324

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++CF       + VG  VP ++F+LQ++ V WRM   NSMV+V + V CL FLDGG+  
Sbjct  325  FKLCFKLKDLGVTRVGLAVPTIDFMLQNKDVFWRMFGANSMVQVNNKVSCLAFLDGGVEV  384

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDN L+F+L  S LGF+S  L   T+C++F
Sbjct  385  TTSIVIGGYQLEDNFLQFDLVNSRLGFSSSLLFLQTTCANF  425



>ref|XP_009364261.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin, partial [Pyrus 
x bretschneideri]
Length=416

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 104/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLNTSLLV+ +   GGT+ISTV PYT L+ TIY  F+D +L+   +  + RV P  PF 
Sbjct  250  VPLNTSLLVIKEYGYGGTKISTVNPYTVLENTIYTAFVDLFLKEVPAH-IPRVAPAEPFG  308

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQG-  410
             CF+        VG  VP ++FVLQS  V WR    NSMV+V + V+CLGF+D GL    
Sbjct  309  ACFNSTHIGRTRVGPAVPTIDFVLQSGSVYWRFLGANSMVQVNEEVLCLGFVDAGLSPSN  368

Query  409  --ASVVIGGYQLEDNLLEFNLGTSMLGF-TSLMAG-TSCSHFT  293
               S+VIGG QLE+N L+F+L  S LGF  SL++G T+C+ F 
Sbjct  369  PMTSIVIGGLQLEENFLQFDLAASRLGFCNSLLSGPTTCADFN  411



>ref|XP_006345120.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=437

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 106/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N  LL +D+   GGT+IST  PY+ L+++IY+    ++++  ++   +RV  VAP
Sbjct  273  KPVTINKKLLGVDKSGNGGTKISTGSPYSMLESSIYNVVTKAFIDELSNA--TRVAAVAP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLGF++GG+ +
Sbjct  331  FETCFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLGFVNGGIKR  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             AS+VIGGYQLEDNLL F+L  S LGF+S  L   T+C++F
Sbjct  391  TASIVIGGYQLEDNLLHFDLARSTLGFSSSLLFHQTTCANF  431



>ref|XP_010026234.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=389

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 109/166 (66%), Gaps = 17/166 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-ESAASMGLSRVDPV  569
            + +PLN +LL +D+E   GGT ISTV+PYT L+T+I+     ++  E++A+  L+ + PV
Sbjct  216  KVVPLNATLLAIDEESGRGGTLISTVLPYTALQTSIFRAVTQAFAREASAAFNLTTIQPV  275

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLD  428
             PF +C+S         G  VP ++ V+QSE V WR+   NSMV++   G    CLG +D
Sbjct  276  KPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQRKGTDAWCLGLVD  335

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            GG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  336  GGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  381



>gb|KDO74797.1| hypothetical protein CISIN_1g044303mg [Citrus sinensis]
Length=428

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 104/160 (65%), Gaps = 14/160 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ ++++S ++  + RV P+APF 
Sbjct  266  VPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFIKSYSN--IPRVKPMAPFG  323

Query  556  VCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGA  407
             CF+        VG+  P++   +      W++   +SMV+VG   MCL F+DGG+    
Sbjct  324  ACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGAHSMVRVGKHAMCLAFVDGGVNPTT  383

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  384  SIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>gb|ACM68431.1| xyloglucan-specific endoglucanase inhibitor protein [Capsicum 
annuum]
Length=437

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++  A++  +RV  VAP
Sbjct  273  KVVPINTTLLSIDNQGVGGTKISTVNPYTVLETSLYNAITNFFVKELANV--TRVASVAP  330

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + VG  VP+++ VLQ+E V W +   NSMV+V + V+CLGF+DGG+  
Sbjct  331  FGACFDSRNIGSTRVGPAVPQIDLVLQNENVIWTIFGANSMVQVSENVLCLGFVDGGVNS  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+ +EDNLL+ ++  S LGFTS  L   T+C++F
Sbjct  391  RTSIVIGGHTIEDNLLQLDIARSRLGFTSSILFRQTTCANF  431



>ref|XP_009356759.1| PREDICTED: basic 7S globulin [Pyrus x bretschneideri]
Length=439

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 102/161 (63%), Gaps = 12/161 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + + T+LL +D E  GGT+ISTV PYT L+ +I+    + ++  A +M +++     P
Sbjct  273  KAVAIQTTLLSIDGEGVGGTKISTVNPYTVLEVSIFKAVTEMFISEAKAMNITQTGATGP  332

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        VG  VP ++FV Q+    WR+   NSMV+V D V+CLG ++GG   
Sbjct  333  FEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSMVQVNDNVLCLGIVNGGENP  392

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG QLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  393  RTSIVIGGLQLENNLLQFDLATSRLGFSSSLLFTQTTCANF  433



>ref|XP_009757289.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=437

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++    + ++RV  VAP
Sbjct  273  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVKEL--VNITRVASVAP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         VG  VP ++ VLQ+E V W +   NSMV+V + V+CLGF+DGG+  
Sbjct  331  FGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWTIFGANSMVQVSENVLCLGFVDGGVNT  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGY +EDNLL+F+L  S LGF S  L   T+C  F
Sbjct  391  RTSIVIGGYTIEDNLLQFDLARSRLGFISSILFRQTTCPDF  431



>ref|NP_001055496.1| Os05g0402900 [Oryza sativa Japonica Group]
 dbj|BAF17410.1| Os05g0402900 [Oryza sativa Japonica Group]
Length=437

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  276  RAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--AAETSMIPRVPAVAP  333

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE V QSE   W +   NSMV    G +CLG +DGG+  
Sbjct  334  FKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCLGVVDGGVAS  393

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  394  ETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>gb|EEE63670.1| hypothetical protein OsJ_18488 [Oryza sativa Japonica Group]
Length=419

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  258  RAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--AAETSMIPRVPAVAP  315

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE V QSE   W +   NSMV    G +CLG +DGG+  
Sbjct  316  FKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCLGVVDGGVAS  375

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  376  ETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  416



>ref|XP_008355568.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=439

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 103/167 (62%), Gaps = 12/167 (7%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +NT+LL +D E  GGT+ISTV PYT L+ +I+    + ++  A +  +++     P
Sbjct  273  KPVAINTTLLSIDGEGVGGTKISTVNPYTVLEASIFKAVTEMFISEAKARNITQTGATGP  332

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FEVCFS        VG  VP ++FV Q+    WR+   NSMV+V D V+CLG ++GG   
Sbjct  333  FEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSMVQVNDNVLCLGIVNGGENP  392

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSME  278
              S+VIGG QLEDNLL+F+L  S LGF+S  L   T+C++F   S+ 
Sbjct  393  RTSIVIGGLQLEDNLLQFDLAKSRLGFSSSLLFTQTTCANFNFTSIN  439



>gb|KCW84282.1| hypothetical protein EUGRSUZ_B01133 [Eucalyptus grandis]
Length=437

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN SLL +++E +GGT+IST  PYT ++ +I+   L  ++E   + G++RV  V P
Sbjct  273  RAVPLNMSLLHINEEGKGGTKISTFDPYTVMERSIFMAVLKVFMEE--TKGVTRVPSVKP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+ C S        VG  VP ++  L  + V WR+   NSMV++ D V+CLGF+DGGL  
Sbjct  331  FQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLKDDVLCLGFVDGGLNP  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F 
Sbjct  391  RTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNFN  432



>ref|XP_007222421.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
 gb|EMJ23620.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
Length=429

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 18/158 (11%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTSLL +D E  GGT+ISTV PYT L+T+IY+  +D+++++ A   + RV  VAP
Sbjct  275  KAVALNTSLLKIDSEGYGGTKISTVNPYTVLETSIYNAVVDAFVKTVAE--IPRVKAVAP  332

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRMNSMVKVGDGVMCLGFLDGGLGQGAS  404
            F  CF         VG  VP ++ VLQ+       NSMV V D V+CLGF+DGG     S
Sbjct  333  FGACFDSKNIGSTRVGPAVPAIDLVLQT-------NSMVAVSDDVLCLGFVDGGERPRTS  385

Query  403  VVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            +VIGG+QLEDNLL+F+L  S LGF+S      T+C++F
Sbjct  386  IVIGGHQLEDNLLQFDLAASRLGFSSSLFFRRTTCANF  423



>gb|KDP40110.1| hypothetical protein JCGZ_02108 [Jatropha curcas]
Length=437

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 105/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNT+LL ++ E  GGT +STV PYT ++TTIY+  L+++++  A +   RV  VAP
Sbjct  273  KTVSLNTTLLKINSEGSGGTMLSTVRPYTVMETTIYNAVLNAFVKELAHV--PRVASVAP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF         +G  VP ++ +LQS  V WR+   NSMV+V   V+CLGF+DGG+  
Sbjct  331  FGACFDASKIASTRLGPAVPSIDLMLQSNNVVWRIIGANSMVQVNRDVLCLGFVDGGVDA  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S++IGG+QLEDN L+F+L  S LGF+S  L   T+C++F
Sbjct  391  RTSIIIGGHQLEDNFLQFDLAASRLGFSSSLLSRQTTCANF  431



>ref|XP_006489307.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 13/161 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D +  GGT+ S  VPYT L+T+ Y   L +++  A    ++RV PVAP
Sbjct  258  KAIPLNTTLLSIDSDGIGGTKFSASVPYTALETSFYKALLQAFVN-AMPTKVTRVAPVAP  316

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       S +G  VP+++ VLQ+  V W +   NS+V+V + V CLGF+DGG+  
Sbjct  317  FGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVSNDVSCLGFVDGGVTP  376

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  377  KTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>ref|XP_010045852.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=456

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN SLL +++E +GGT+IST  PYT ++ +I+   L  ++E   + G++RV  V P
Sbjct  292  RAVPLNMSLLHINEEGKGGTKISTFDPYTVMERSIFMAVLKVFMEE--TKGVTRVPSVKP  349

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+ C S        VG  VP ++  L  + V WR+   NSMV++ D V+CLGF+DGGL  
Sbjct  350  FQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLKDDVLCLGFVDGGLNP  409

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F
Sbjct  410  RTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNF  450



>ref|XP_006345119.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=436

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 106/166 (64%), Gaps = 14/166 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N  LL +D+  +GGT+IST  PY+ L+T+IY     ++++  ++   +RV  VAP
Sbjct  272  KTVTINRKLLGIDKRGDGGTKISTGTPYSILETSIYDVVTKAFIDELSNA--TRVAAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE CFS        VG  VP ++ VLQ+  V WR+   NSMVKV   V+CLGF++GG+  
Sbjct  330  FETCFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGANSMVKVSQDVICLGFVNGGIKP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  281
              S+VIGGYQL DNLL+F+L  S LGF+S  L   T+C++F   +M
Sbjct  390  TTSIVIGGYQLADNLLQFDLAKSTLGFSSSLLFHQTTCANFNFTTM  435



>gb|EAY97992.1| hypothetical protein OsI_19909 [Oryza sativa Indica Group]
Length=437

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 103/161 (64%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  +A +  + RV  VAP
Sbjct  276  RAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--AAETSMIPRVPAVAP  333

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE V QSE   W +   NSMV    G +CLG +DGG   
Sbjct  334  FKLCYDGSKVASTRVGPAVPTVELVFQSEATSWVVFGANSMVATKGGALCLGVVDGGAAP  393

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  394  ETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>ref|XP_004495219.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=440

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 12/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL ++    GGT++STV PYT L+++IY    D++++++ +  ++R D   PFE C
Sbjct  277  LNTSLLTINSNGFGGTKLSTVNPYTVLESSIYKAVTDAFVKASVARNITRTDSFEPFEFC  336

Query  550  FS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            +S        +G+ VP +E VLQ+E V W +   NSMV + D V+CLGF++GG     S+
Sbjct  337  YSFDNLSGTRLGAAVPTIELVLQNENVVWSIFGANSMVNINDDVLCLGFMNGGENVRTSI  396

Query  400  VIGGYQLEDNLLEFNLGTSMLGFT-SLMA-GTSCSHF  296
            VIGGYQL++NLL+F+L  S LGF+ S+ A  T C  F
Sbjct  397  VIGGYQLDNNLLQFDLAASRLGFSGSVFARQTDCFRF  433



>ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 108/167 (65%), Gaps = 14/167 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++  A++  +RV  VAP
Sbjct  274  KVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVKELANV--TRVAVVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCF         VG  VP ++ VLQ+  V W +   NSMV+V + V+CLG LDGG+  
Sbjct  332  FRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVSENVLCLGVLDGGVNA  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSME  278
              S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C +F   S++
Sbjct  392  RTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCDNFNFTSID  438



>gb|ACJ85243.1| unknown [Medicago truncatula]
Length=232

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN+SLL +D +  GGT+ISTV PYT L+ +IY    D++++++ +  ++  D   P
Sbjct  67   KVVSLNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTDAFVKASVARNITTEDSSPP  126

Query  562  FEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE C+S        +G+ VP +E +LQ+ ++ W M   NSMV + D V+CLGF++GG+  
Sbjct  127  FEFCYSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSMVNINDEVLCLGFVNGGVNL  185

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
              S+VIGGYQLE+NLL+F+L  S LGF++ +    T C  F 
Sbjct  186  RTSIVIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRFN  227



>gb|KJB70565.1| hypothetical protein B456_011G080800 [Gossypium raimondii]
Length=434

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 109/162 (67%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +  N +LL +++E +GGT+ISTV PYT ++T+IY   ++++++  + +  +RV  VAP
Sbjct  271  KPVSFNKTLLSINKEGQGGTKISTVTPYTVMQTSIYRAVVNAFIKQTSKV--ARVPAVAP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  C++        VG  VP+++ +L +++V WR+   NSMV+V   V+CLGF+DGGL  
Sbjct  329  FSACYNAKSLGSTRVGPAVPQIDLLLPNKVV-WRIFGANSMVQVNKDVLCLGFVDGGLEP  387

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              S+VIGG+Q+EDNLL+ +L  S LGF+S  L   T+CS+F 
Sbjct  388  TTSIVIGGHQIEDNLLQIDLAASKLGFSSSLLFRRTTCSNFN  429



>ref|XP_008222995.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=457

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 103/165 (62%), Gaps = 20/165 (12%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL++DQ   GGT+ISTV PYT L++TIY  F+D++++      + RV  V PF  C
Sbjct  287  LNTSLLMIDQNGYGGTKISTVNPYTVLESTIYKAFVDAFVKEMPGH-IKRVASVEPFGAC  345

Query  550  F-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ----  413
            F       + VG  VP ++FVLQSE V WR+   NSMV+V   V+CLGF+     Q    
Sbjct  346  FDSTHIGITRVGPAVPSIDFVLQSEGVYWRVSGANSMVQVSKDVLCLGFVAAEQRQRYSF  405

Query  412  ---GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
                 S+VIGG+QLEDNLL+F+L    LGF+S  L   TSC++F 
Sbjct  406  ESPTTSIVIGGHQLEDNLLQFDLANKRLGFSSSLLSRETSCANFN  450



>ref|XP_009595035.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+N  LL +D+   GGT+IST  PY+ L+ +IY     + ++  +++  +RV  VAP
Sbjct  272  KPVPINKKLLSIDKRGNGGTKISTGSPYSILEASIYDAVTKALVQELSNV--TRVTAVAP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            FE CFS        VG  VP ++ VLQS+ V WR+   NSMV+V   V+CLG ++GG+  
Sbjct  330  FETCFSSKNIVSAKVGQAVPAIDLVLQSKQVYWRIFGSNSMVEVSQDVICLGIVNGGIKP  389

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  390  TTSIVIGGHQLEDNLLQFDLPRSTLGFSSSLLFRQTTCANF  430



>ref|XP_007050654.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOX94811.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=441

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (67%), Gaps = 15/164 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N S L +D+   GGT++ST   YT L+T+IY+   D+++  ++++ L+  + V P
Sbjct  270  KPIQINGSSLNVDKNGFGGTKLSTSTTYTVLETSIYNALTDAFVNESSALNLTVTNAVKP  329

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-GDG--VMCLGFLDGG  422
            F VC+S        VG  VP V+ V+QS+ V WR+   NSMV++ GDG  V CLGF+DGG
Sbjct  330  FSVCYSAADIIVTRVGPGVPTVDLVMQSDDVFWRVFGSNSMVQIAGDGGDVWCLGFVDGG  389

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            +    SVVIGG+Q+EDNLL+F+L ++ LGFTS  L+ GT+C+ F
Sbjct  390  VNPRTSVVIGGHQMEDNLLQFDLDSNRLGFTSSVLLKGTTCADF  433



>ref|XP_004229432.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=441

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++S +   + RV PVAPF+
Sbjct  275  VPINTTLLNITKDGKGGTKISTVEPYTKLETSIYNALTKAFVKSISK--VPRVKPVAPFK  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVKVGDGVMCLGFLDGGL--  419
            VC+       + VG  VP +E VL+++        W +NSMV V D V+CLGF+DGG+  
Sbjct  333  VCYNRTSLGSTRVGPGVPPIELVLRNKNATTSWTIWGVNSMVAVNDDVLCLGFVDGGVEF  392

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
                S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  393  EPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>ref|XP_011079830.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=399

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 108/162 (67%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +  N +LL +D++  GGT++STV PYT+L +TIY    ++++  +A++ L+   PV P
Sbjct  227  KAVKFNQTLLSIDEKGFGGTKLSTVTPYTSLHSTIYRALTEAFVNESAALNLTITQPVKP  286

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-GDGV--MCLGFLDGG  422
            F VC++        +G  VP V+FVLQ + V WR+   NSM ++  DGV   CLGFLDGG
Sbjct  287  FNVCYNADEVMSTRIGPAVPTVDFVLQDDDVIWRIFGWNSMFRIFRDGVDLYCLGFLDGG  346

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  302
                +S+VIGG+Q++DNLL+F+L ++ LGF+S  L+ GT C+
Sbjct  347  PNPRSSIVIGGHQMDDNLLQFDLQSNRLGFSSSLLVHGTMCA  388



>ref|XP_004508379.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=448

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 106/165 (64%), Gaps = 18/165 (11%)
 Frame = -3

Query  730  LNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEV  554
             N SLL + +++  GGT++STV+P+T L T IY   L+++++ A    + RV  VAPF  
Sbjct  285  FNNSLLSIRKKLGIGGTKLSTVIPHTKLHTLIYKSLLNAFVKKAEIRKIKRVKEVAPFGA  344

Query  553  CF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ---  413
            CF       S  G +VP ++FVL+   V+WR    NSMVKVG  V+CLGF+DGG  +   
Sbjct  345  CFDSRTIGKSVTGPNVPTIDFVLKGG-VEWRFYGANSMVKVGRNVLCLGFVDGGNEEVGP  403

Query  412  -GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRF  287
               S+VIGG+QLEDNLLEF+L +S LGF+S  L+   SCSHF  F
Sbjct  404  WDTSIVIGGHQLEDNLLEFDLVSSKLGFSSSLLLNKASCSHFKGF  448



>ref|XP_007162407.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
 gb|ESW34401.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
Length=452

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 109/165 (66%), Gaps = 15/165 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + LP+N S+L +D+   GGT+IST  PYT L+++IY  F+  ++  +++  L+  + V P
Sbjct  279  KALPINGSILTVDETGFGGTKISTAEPYTVLESSIYKLFVQFFVNESSAFNLTVTEGVEP  338

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG---VMCLGFLDGG  422
            F VC+         VG  VP V+ V+QSE V WR+   NSMV++  G   V CLGF+DGG
Sbjct  339  FGVCYPAGDLTETRVGPAVPTVDLVMQSEEVFWRIFGGNSMVRIEKGGVDVWCLGFVDGG  398

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              + ++VVIGG+QLEDN++EF++ ++  GFTS  L+ GT+C++ T
Sbjct  399  SRRRSAVVIGGHQLEDNVVEFDVDSNRFGFTSSLLLQGTNCANLT  443



>gb|KDO74789.1| hypothetical protein CISIN_1g014679mg [Citrus sinensis]
Length=420

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 108/166 (65%), Gaps = 15/166 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++A   ++RV PVAP
Sbjct  257  KAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--ASAMPKVARVAPVAP  314

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + +G  VP+++ VLQ++ V W +   NSMV++G   +CLGF+DGG+  
Sbjct  315  FGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWSIHGQNSMVQIGGDALCLGFVDGGVNP  374

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  284
              S+VIG  QLE+NLL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  375  RTSIVIGARQLENNLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>ref|XP_002517167.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45330.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=435

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 107/167 (64%), Gaps = 14/167 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++  N +LL +D E +GGTRISTV PYT L T+IY   + ++ +    + +    P+AP
Sbjct  270  KEIKFNKTLLSIDNEGKGGTRISTVHPYTLLHTSIYKAVIKAFAKQMKFL-IEVNPPIAP  328

Query  562  FEVCFSGVGSD-------VPKVEFVLQSE-MVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            F +C+     D       VP ++ VL+S+  V WR+   NSMVK+   VMCLGF+DGGL 
Sbjct  329  FGLCYQSAAMDINEYGPVVPFIDLVLESQGSVYWRIWGANSMVKISSYVMCLGFVDGGLK  388

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFSM  281
              +S++IGG QLEDNLL+F+L ++ LGFTS  L+  T+CS+F   S+
Sbjct  389  PDSSIIIGGRQLEDNLLQFDLASARLGFTSSLLVRNTTCSNFNSKSV  435



>ref|XP_002272199.2| PREDICTED: basic 7S globulin 2-like [Vitis vinifera]
Length=457

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 102/161 (63%), Gaps = 15/161 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN +LL +D    GGT+ISTV PYT L+++IY     +++  +A + L+   PV PF VC
Sbjct  289  LNPALLTVDLNGNGGTKISTVAPYTVLESSIYEALTHAFIAESAGLNLTVHYPVKPFRVC  348

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLDGGLGQG  410
            F         VG  VP V+ V+QS+ V WR+   NSMV++   G  V CLGF+DGG+   
Sbjct  349  FPADDVMETTVGPAVPTVDLVMQSDDVFWRIFGRNSMVRILEEGVDVWCLGFVDGGVRPR  408

Query  409  ASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
             S+VIGG+Q+EDNLL+F+LG   LGF+S  L+  T C++F 
Sbjct  409  TSIVIGGHQMEDNLLQFDLGLKRLGFSSSVLVHHTMCANFN  449



>ref|XP_007224945.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
 gb|EMJ26144.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
Length=457

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 100/165 (61%), Gaps = 20/165 (12%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LNTSLL +DQ   GGT+ISTV PYT L++TIY  F+D++++        RV  V PF  C
Sbjct  287  LNTSLLAIDQNGYGGTKISTVNPYTVLESTIYKAFVDAFVKEMPGHS-KRVASVEPFGAC  345

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ----  413
            F         VG  VP ++FVLQSE V WR+   NSMV+V   V+CLGF+     Q    
Sbjct  346  FDSTHIGITRVGPAVPSIDFVLQSEGVYWRVSGGNSMVQVSKDVLCLGFVGAEQRQRYSF  405

Query  412  ---GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
                 S+VIGG+QLEDNLL+F+L    LGF+S  L   TSC++F 
Sbjct  406  ESPTTSIVIGGHQLEDNLLQFDLANKRLGFSSSLLSRETSCANFN  450



>gb|ADD71505.1| xyloglucanase inhibitor 3 [Humulus lupulus]
Length=441

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 102/156 (65%), Gaps = 19/156 (12%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + +N+SLL  D +  GGT+ISTV PYTTL+T+IY+  +++++ + A   + +V  VAP
Sbjct  264  KPVSVNSSLLSFDVDGNGGTKISTVDPYTTLETSIYNTVVNAFVNALAVRNVHKVAAVAP  323

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGG---  422
            F  CF       S  G  VP +EFVLQSE V WR+   NSMV+V + V+CLGF+DGG   
Sbjct  324  FSACFNAKDIGLSRAGPIVPPIEFVLQSEKVVWRVTGANSMVRVSNEVLCLGFVDGGPLH  383

Query  421  -LGQG-----ASVVIGGYQLEDNLLEFNLGTSMLGF  332
             +  G      ++VIGG Q+EDNLL+F+L TS LGF
Sbjct  384  FVDWGIKFTPTAIVIGGRQIEDNLLQFDLATSRLGF  419



>ref|XP_008649625.1| PREDICTED: basic 7S globulin-like [Zea mays]
 gb|AFW77950.1| hypothetical protein ZEAMMB73_390094 [Zea mays]
Length=438

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 102/161 (63%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN +LL +D++  GGT++STV PYT L+++IY    D++  +A +  + R  P+AP
Sbjct  277  RAVPLNATLLAIDRKGVGGTKLSTVAPYTVLQSSIYKAVTDAF--AAETAMIPRAPPLAP  334

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP +E VL +E   W +   NSMV    G +CLG +DGG   
Sbjct  335  FKLCYDGSKVGSTRVGPAVPTIELVLGNEATSWVVFGANSMVATEGGALCLGVVDGGKAP  394

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  395  RTSVVIGGHMMEDNLLQFDLEASRLGFSSSLLFRQTNCNNF  435



>ref|XP_006366973.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=361

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 104/160 (65%), Gaps = 15/160 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN ++  ++ +  GGT++ST+ PYTTL++ IY+ F ++++  +A + L+  +PV PF+VC
Sbjct  193  LNQNISAVNHQGFGGTKLSTITPYTTLQSNIYNAFTETFVNESAKLNLTVTNPVEPFKVC  252

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG---VMCLGFLDGGLGQG  410
            ++        VG  VP V+ V+ +  V WR+   NSMV++      V CLGFLDGG+   
Sbjct  253  YNADEVLDTKVGPTVPTVDLVMDNHDVFWRIFGSNSMVRIARNDVDVWCLGFLDGGIKTE  312

Query  409  ASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             S++IGG+Q+E+NLL+F+L    LGF+S  L   TSCS+F
Sbjct  313  TSIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSCSNF  352



>ref|XP_006654378.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=436

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 102/161 (63%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLNT+LL + ++  GGT++STV PYT L+T+I+   +D++  +A +  + R   VAP
Sbjct  275  RAVPLNTTLLSISKKGVGGTKLSTVSPYTVLETSIHKAVIDAF--AAETSMIPRAPAVAP  332

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP VE V QSE   W +   NSMV    G +CLG +DGG   
Sbjct  333  FKLCYDGSKVGSTRVGPAVPTVELVFQSEAASWVVFGANSMVATKGGALCLGVVDGGATP  392

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  393  ETSVVIGGHMMEDNLLEFDLEGSRLGFSSSLLFRQTTCNNF  433



>gb|KCW58887.1| hypothetical protein EUGRSUZ_H01513, partial [Eucalyptus grandis]
Length=414

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 108/167 (65%), Gaps = 17/167 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-ESAASMGLSRVDPV  569
            + +PLN +LL +DQ+   GGT IST+VPYTT++T+IY     ++  E++A+  L+   PV
Sbjct  241  KAVPLNATLLAIDQKSGHGGTLISTLVPYTTVQTSIYGAVARAFAREASAAFNLTATQPV  300

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLD  428
             PF +C+S         G  VP ++ V+  E   WR+   NSMV++   G    CLGF+D
Sbjct  301  KPFGLCYSARHVNITRAGPAVPAIDLVMHGEDAVWRLFGANSMVRIQRNGTDAWCLGFVD  360

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GG G  A++++GG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F 
Sbjct  361  GGAGFRAAILMGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANFN  407



>ref|XP_010024401.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=441

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 96/155 (62%), Gaps = 13/155 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
              +S+L +D+   GGT+I T+ PYT L + I+ P ++ + + A    + +  PVAPF VC
Sbjct  285  FKSSILAIDKNGIGGTKIGTLTPYTVLHSAIFRPLVNEFTKKAMDRKIKKASPVAPFGVC  344

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            F          G DVP +  VLQ   V+WRM   NSMV+V   VMCLGF+DGG     +V
Sbjct  345  FDAKMVRSGKAGPDVPAIVLVLQGN-VQWRMEGANSMVRVSKDVMCLGFVDGGSKPRTAV  403

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  302
            VIG +Q+EDNL+EF++G+S  GF++  L+  +SCS
Sbjct  404  VIGAHQMEDNLVEFDVGSSTFGFSNSLLLQNSSCS  438



>gb|EEE63672.1| hypothetical protein OsJ_18490 [Oryza sativa Japonica Group]
Length=400

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN +LL + +   GGT++S + PYT L+T+IY    D++  +A +  + RV  VAP
Sbjct  239  RAVPLNATLLAIAKSGVGGTKLSMLSPYTVLETSIYKAVTDAF--AAETAMIPRVPAVAP  296

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G        G  VP VE VLQS+ V W +   NSMV   DG +C G +DGG+  
Sbjct  297  FKLCYDGTMVGSTRAGPAVPTVELVLQSKAVSWVVFGANSMVATKDGALCFGVVDGGVAP  356

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGFTS +    T+C+ F
Sbjct  357  ETSVVIGGHMMEDNLLEFDLEGSRLGFTSYLPLLQTTCNSF  397



>ref|NP_001174419.1| Os05g0403000 [Oryza sativa Japonica Group]
 gb|AAT85210.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE63671.1| hypothetical protein OsJ_18489 [Oryza sativa Japonica Group]
 dbj|BAH93147.1| Os05g0403000 [Oryza sativa Japonica Group]
Length=437

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 100/162 (62%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN +LL +D+   GGT +ST  PYT L+T+IY   +D++    A+  + RV  VAP
Sbjct  275  RDVPLNATLLAIDKNGVGGTTLSTASPYTVLETSIYKAVIDAFAAETAT--IPRVPAVAP  332

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG-  416
            FE+C+ G        G  VP +E VLQ E V W M   NSMV    G +CLG +DGG   
Sbjct  333  FELCYDGRKVGSTRAGPAVPTIELVLQREAVSWIMYGANSMVPAKGGALCLGVVDGGPAL  392

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  296
              +SVVIGG+ +EDNLLEF+L  S LGF+S +    T+C++F
Sbjct  393  YPSSVVIGGHMMEDNLLEFDLEGSRLGFSSYLPLRQTTCNNF  434



>ref|XP_009773278.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=459

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 104/160 (65%), Gaps = 15/160 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            L+  +L +D+   GGT++STV PYT L ++IY  F +++++ +  + L+  +PV PF+VC
Sbjct  291  LSRKILAVDEHGFGGTKLSTVTPYTLLHSSIYKAFTETFVDQSTKLNLTVTNPVEPFKVC  350

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLDGGLGQG  410
            ++        VG  VP V+ V+Q + V WR+   NSMV++   G  V CLGFLDGG+   
Sbjct  351  YNADEVMETRVGPAVPTVDLVMQGDDVFWRIFGSNSMVRIFRDGVDVWCLGFLDGGVKTK  410

Query  409  ASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             S++IGG+Q+EDNLL+F+L    LGF+S  L   T+CS+F
Sbjct  411  TSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLAYNTTCSNF  450



>ref|XP_010026235.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=455

 Score =   131 bits (330),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 108/167 (65%), Gaps = 17/167 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-ESAASMGLSRVDPV  569
            + +PLN +LL +DQ+   GGT IST+VPYTT++T+IY     ++  E++A+  L+   PV
Sbjct  282  KAVPLNATLLAIDQKSGHGGTLISTLVPYTTVQTSIYGAVARAFAREASAAFNLTATQPV  341

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLD  428
             PF +C+S         G  VP ++ V+  E   WR+   NSMV++   G    CLGF+D
Sbjct  342  KPFGLCYSARHVNITRAGPAVPAIDLVMHGEDAVWRLFGANSMVRIQRNGTDAWCLGFVD  401

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            GG G  A++++GG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F 
Sbjct  402  GGAGFRAAILMGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANFN  448



>gb|AAT85211.1| hypothetical protein [Oryza sativa Japonica Group]
Length=435

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN +LL + +   GGT++S + PYT L+T+IY    D++  +A +  + RV  VAP
Sbjct  274  RAVPLNATLLAIAKSGVGGTKLSMLSPYTVLETSIYKAVTDAF--AAETAMIPRVPAVAP  331

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G        G  VP VE VLQS+ V W +   NSMV   DG +C G +DGG+  
Sbjct  332  FKLCYDGTMVGSTRAGPAVPTVELVLQSKAVSWVVFGANSMVATKDGALCFGVVDGGVAP  391

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGFTS +    T+C+ F
Sbjct  392  ETSVVIGGHMMEDNLLEFDLEGSRLGFTSYLPLLQTTCNSF  432



>ref|XP_006419826.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
 gb|ESR33066.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
Length=419

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ ++++S ++  + RV P+APF 
Sbjct  266  VPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFIKSYSN--IPRVKPMAPFG  323

Query  556  VCFSGVGSDVPKVEFVLQSEMVKWRMNSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLE  377
             CF+        V+       +    NSMV+VG   MCL F+DGG+    S+VIG YQLE
Sbjct  324  ACFNSSFIGCTHVDAAAPEIHLYMPANSMVRVGKHAMCLAFVDGGVNPTTSIVIGAYQLE  383

Query  376  DNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
            DNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  384  DNLLQFDLAKSRLGFSSSLLARQTTCSNLT  413



>gb|KCW58889.1| hypothetical protein EUGRSUZ_H015141, partial [Eucalyptus grandis]
Length=212

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 105/166 (63%), Gaps = 17/166 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-ESAASMGLSRVDPV  569
            + +PLN +LL +DQ+   GGT IST+VPYTTL+T+IY     ++  E++ +  L+   PV
Sbjct  39   KAVPLNATLLAIDQKSGHGGTIISTLVPYTTLQTSIYGAVARAFAQEASTAFNLTATQPV  98

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLD  428
             PF +C+S         G  VP ++ V+  +   WR+   NSMV++   G    CLG +D
Sbjct  99   KPFGLCYSARLVNITRAGPAVPAIDLVMHGQDAVWRLFGANSMVRIQRNGTDAWCLGLVD  158

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            GG    A+++IGG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F
Sbjct  159  GGAEFRAAILIGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANF  204



>gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena]
Length=437

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 107/161 (66%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +P+NT+LL +D +  GGT++STV PYT ++T++Y+   + +++  A++  +RV PV P
Sbjct  273  KVVPINTTLLSIDNQGVGGTKLSTVNPYTVMETSLYNAITNFFVKELANV--TRVAPVTP  330

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + VG  VP ++ VLQ++ V W +   NSMV+V + V+CLG +DGG+  
Sbjct  331  FGACFDSRNIGSTRVGPAVPWIDLVLQNQNVVWTIFGANSMVQVSENVLCLGIVDGGVNA  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  391  RTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>ref|XP_004247154.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=431

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 102/159 (64%), Gaps = 15/159 (9%)
 Frame = -3

Query  727  NTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF  548
            + ++  LDQ+  G T++STV PYTTL + IY PF ++++  +  + L+  +PV PF+VC+
Sbjct  264  HNNISALDQQGFGLTKLSTVTPYTTLHSNIYKPFTETFINESTKLNLTVTNPVEPFKVCY  323

Query  547  SG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLDGGLGQGA  407
            +        VG  VP V+ V+ S+ V WR+   NSMV++   G  V CLGFLDGG     
Sbjct  324  NADEVLDTKVGPTVPTVDLVMDSDDVFWRIFGSNSMVRIARNGVDVWCLGFLDGGSKTET  383

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S++IGG+Q+E+NLL+F+L    LGF+S  L   TSCS+F
Sbjct  384  SIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSCSNF  422



>gb|KCW45638.1| hypothetical protein EUGRSUZ_L005902, partial [Eucalyptus grandis]
Length=224

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 103/162 (64%), Gaps = 15/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +  +  GGT+ISTV PYT ++T+I+  F+  +   A +  L++V  V P
Sbjct  61   KAVPLNAALLKI-TDGNGGTKISTVNPYTVMETSIFKAFVKVFRHEAKN--LTKVSSVKP  117

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+ CFS        VG  VP ++ V+ +  V WR+   NSMV+V + V+CLGF+DGG   
Sbjct  118  FKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVKEDVICLGFVDGGSNP  177

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F 
Sbjct  178  RTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNFN  219



>ref|XP_009597883.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=432

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 104/161 (65%), Gaps = 16/161 (10%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + +   GGT+ISTV PYT L+T+IY+ F  ++++S A   ++RV  VAPF 
Sbjct  268  VPINTTLLTIAKNGIGGTKISTVDPYTKLETSIYNAFTKAFVKSLAK--VARVKSVAPFR  325

Query  556  VCFSG-------VGSDVPKVEFVLQSEM-----VKWRMNSMVKVGDGVMCLGFLDGGLGQ  413
            VC++        VG  VP +E VL S         W +NSMV V + V+CLGF+DGG   
Sbjct  326  VCYNSTSLGSTRVGPGVPPIELVLGSNKDAKSWTIWGVNSMVVVNNEVLCLGFVDGGFEP  385

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIG +Q+EDNLL+F++    +GF+S  L + T+C++F
Sbjct  386  TTSIVIGAHQIEDNLLQFDIANKRMGFSSSLLFSRTTCANF  426



>gb|EPS72958.1| hypothetical protein M569_01796, partial [Genlisea aurea]
Length=422

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 104/161 (65%), Gaps = 14/161 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+N SLL +D++  GGT+ISTV  YT L+T+IY     +++ ++A+ G+ RV  VAPFE
Sbjct  256  VPINGSLLKIDKKGYGGTKISTVNSYTVLETSIYRSLTSAFVRASAARGIRRVPGVAPFE  315

Query  556  VCFSG-------VGSDVPKVEFVLQ-SEMVKWRM---NSMVKV-GDGVMCLGFLDGGLGQ  413
             CFS        VG  VP +   L  ++   W +   NSMV V  D V+CLGFL+GG   
Sbjct  316  FCFSAGNIGSTRVGPAVPYINLELDGADRPIWTIFGSNSMVSVKNDAVLCLGFLNGGANP  375

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
              ++VIGGYQ+EDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  376  RTAIVIGGYQIEDNLLQFDLDRSRLGFSSTLLGRETTCANF  416



>ref|XP_006349243.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++S + +   RV PVAPFE
Sbjct  275  VPINTTLLNITKDGKGGTKISTVDPYTKLETSIYNALTKAFVKSLSKV--PRVKPVAPFE  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVKVGDGVMCLGFLDGGL--  419
            VC+       + VG  VP +E VL ++        W +NSMV V + V+CLGF+DGG+  
Sbjct  333  VCYNRTSLGSTRVGPGVPPIELVLGNKNATTSWTIWGVNSMVAVNNDVLCLGFVDGGVEF  392

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
                S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  393  EPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>ref|NP_001274964.1| xyloglucan-specific endoglucanase inhibitor 4 precursor [Solanum 
tuberosum]
 gb|ADU58605.1| xyloglucan-specific endoglucanase inhibitor 4 [Solanum tuberosum]
Length=440

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 107/163 (66%), Gaps = 18/163 (11%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++S A   + RV PVAPF+
Sbjct  274  VPINTTLLNITKDGKGGTKISTVDPYTKLETSIYNALTKAFVKSLAK--VPRVKPVAPFK  331

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVKVGDGVMCLGFLDGGL--  419
            VC+       + VG  VP +E VL ++        W +NSMV + + V+CLGFLDGG+  
Sbjct  332  VCYNRTSLGSTRVGRGVPPIELVLGNKNATTSWTIWGVNSMVAMNNDVLCLGFLDGGVEF  391

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
                S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  392  EPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  434



>ref|XP_006850763.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
 gb|ERN12344.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
Length=433

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 13/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN++LL +D E  GGT+ISTVVPYT L+T+IY     ++   A  MG+ RV  V PFEVC
Sbjct  276  LNSTLLNIDSEGNGGTKISTVVPYTMLQTSIYKAVTSAFEREATGMGMKRVAGVKPFEVC  335

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            FS        VG  VP ++ +L +    W +   NSMV   +G +CLGF+DGG+    S+
Sbjct  336  FSSKGVPSTRVGPAVPTIDLLLDNGKF-WSVFGANSMVATSNGALCLGFVDGGVSPRTSI  394

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            VIG +Q+ED+LLEF+L    LGF+S  L   T+C++F
Sbjct  395  VIGAHQIEDHLLEFDLAYYSLGFSSSLLFRQTTCANF  431



>ref|XP_009625778.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=439

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 102/160 (64%), Gaps = 15/160 (9%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN  +L +D+   GGT++STV PYT L ++IY    ++++  +  + L+  +PV PF+VC
Sbjct  271  LNRKILAVDEHGFGGTKLSTVTPYTLLHSSIYKALTETFVNQSTKLNLTVTNPVEPFKVC  330

Query  550  FSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV---GDGVMCLGFLDGGLGQG  410
            ++        VG  VP V+ V+  + V WR+   NSMV++   G  V CLGFLDGG+   
Sbjct  331  YNADEVMETRVGPAVPTVDLVMHGDDVFWRIFGSNSMVRIFRDGVNVWCLGFLDGGVKTK  390

Query  409  ASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             S++IGG+Q+EDNLL+F+L    LGF+S  L+  T+CS+F
Sbjct  391  TSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLVYNTTCSNF  430



>ref|XP_006472113.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=273

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 14/163 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            +++P+N SLL  +     GGT+IST+ PYT L+ +IY  F   +L S          PVA
Sbjct  107  KQVPINASLLKFNVNAGTGGTKISTIKPYTVLEHSIYQSF-TRFLTSQLPGIPQLAKPVA  165

Query  565  PFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   GV CL F+DGG+ 
Sbjct  166  PFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARRGVTCLAFVDGGVR  225

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
              AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F 
Sbjct  226  PRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNFN  268



>emb|CDY15455.1| BnaA08g27390D [Brassica napus]
Length=432

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+NTSLL ++     GGT++STV PYT L+T+I+     +++  A +  ++RV  V 
Sbjct  265  KTVPINTSLLKINGTTGLGGTKLSTVNPYTVLETSIFKAVTSAFVREATARNITRVPSVK  324

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  C S        +G  VP+++ VLQS+ V WR+   NSMV V   V+CLGF+DGG+ 
Sbjct  325  PFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSMVSVHSDVICLGFVDGGVN  384

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SV+IGG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  385  AETSVIIGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  426



>ref|XP_009342159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=440

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 102/161 (63%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LNTS+L ++ E  GGT+IS V  Y  L+ +IY+  ++++++  A   + RV PV P
Sbjct  276  KVVALNTSMLAINNEGYGGTKISMVNLYKVLEISIYNVVVNTFVKEVA--NIPRVKPVMP  333

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CFS        VG  VP+++ VLQSE V W M   NSMV V + V+CLGF+DGG   
Sbjct  334  FGACFSSKNIDVTRVGPAVPQIDLVLQSENVYWTMFGANSMVYVSNDVLCLGFVDGGERP  393

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
               +VIGG  LEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  394  MTXIVIGGNXLEDNLLQFDLATSKLGFSSSLLFRRTTCANF  434



>ref|XP_004229434.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=437

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 105/159 (66%), Gaps = 14/159 (9%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++S +   + RV P+APFE
Sbjct  275  VPINTTLLDITKDGKGGTKISTVDPYTKLETSIYNALTKAFVKSLSK--VPRVKPLAPFE  332

Query  556  VCF-------SGVGSDVPKVEFVLQSEMVK-WRMNSMVKVGDGVMCLGFLDGGL--GQGA  407
            VC+       + VG  VP +E VL +     W  NSMV V D V+CLGF+DGG+      
Sbjct  333  VCYNRSSLGSTRVGPGVPPIELVLGTTSWNIWGSNSMVAVNDDVLCLGFVDGGVEFEPTT  392

Query  406  SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            S+VIG +Q+EDN L+F++    LGFTS  L + T+C++F
Sbjct  393  SIVIGAHQIEDNFLQFDIANKRLGFTSSLLFSQTTCANF  431



>ref|XP_004962140.1| PREDICTED: basic 7S globulin-like [Setaria italica]
Length=434

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 14/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            R +PLN +LL +D++  GGT++STV PYT L+++IY     ++  +A +  + R   +AP
Sbjct  273  RAVPLNATLLAIDKKGVGGTKLSTVAPYTVLESSIYKAVTGAF--AAETAAIPRAPAMAP  330

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F++C+ G       VG  VP +E VL ++   W +   NSMV V  G +CLG +DGG   
Sbjct  331  FQLCYDGSKVGSTRVGPAVPTIELVLGTDATSWVVFGANSMVAVKGGALCLGVVDGGEAP  390

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  391  RTSVVIGGHMMEDNLLEFDLEASRLGFSSSLLFRQTNCNNF  431



>ref|XP_006489313.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=420

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 107/166 (64%), Gaps = 15/166 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++A   ++RV PVAP
Sbjct  257  KAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--ASAMPKVARVAPVAP  314

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + +G  VP+++ VLQ++ V W +   NSMV++G   +CLGF+DGG+  
Sbjct  315  FGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWSIHGQNSMVQIGGDALCLGFVDGGVNP  374

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  284
              S+VIG  QLE+ LL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  375  RTSIVIGARQLENYLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>gb|AES60912.2| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=451

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 13/157 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN+SLL +D +  GGT+ISTV PYT L+ +IY    D++++++ +  ++  D   PFE C
Sbjct  290  LNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTDAFVKASVARNITTEDSSPPFEFC  349

Query  550  FS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            +S        +G+ VP +E +LQ+ ++ W M   NSMV + D V+CLGF++GG+    S+
Sbjct  350  YSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSMVNINDEVLCLGFVNGGVNLRTSI  408

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
            VIGGYQLE+NLL+F+L  S LGF++ +    T C  F
Sbjct  409  VIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRF  445



>ref|XP_006419832.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
 gb|ESR33072.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
Length=420

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 107/166 (64%), Gaps = 15/166 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++A   ++RV PVAP
Sbjct  257  KAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--ASAMPKVARVAPVAP  314

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F  CF       + +G  VP+++ VLQ++ V W +   NSMV++G   +CLGF+DGG+  
Sbjct  315  FGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWTIHGQNSMVQIGGDALCLGFVDGGVNP  374

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  284
              S+VIG  QLE+ LL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  375  RTSIVIGARQLENYLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>ref|XP_003590661.1| Basic 7S globulin [Medicago truncatula]
Length=500

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 102/158 (65%), Gaps = 13/158 (8%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVC  551
            LN+SLL +D +  GGT+ISTV PYT L+ +IY    D++++++ +  ++  D   PFE C
Sbjct  282  LNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTDAFVKASVARNITTEDSSPPFEFC  341

Query  550  FS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASV  401
            +S        +G+ VP +E +LQ+ ++ W M   NSMV + D V+CLGF++GG+    S+
Sbjct  342  YSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSMVNINDEVLCLGFVNGGVNLRTSI  400

Query  400  VIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHFT  293
            VIGGYQLE+NLL+F+L  S LGF++ +    T C  F 
Sbjct  401  VIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRFN  438



>ref|XP_009111160.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=455

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 104/162 (64%), Gaps = 13/162 (8%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +P+NTSLL ++     GGT++STV PYT L+T+I+     +++  A +  ++RV  V 
Sbjct  288  KTVPINTSLLKINGTTGLGGTKLSTVNPYTVLETSIFKAVTSAFVREATARNITRVPSVK  347

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  C S        +G  VP+++ VLQS+ V WR+   NSMV V   V+CLGF+DGG+ 
Sbjct  348  PFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSMVSVHSDVICLGFVDGGVN  407

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  296
               SVV+GG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  408  AETSVVVGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  449



>gb|KDP40111.1| hypothetical protein JCGZ_02109 [Jatropha curcas]
Length=307

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++ ++  LL +DQ+ E GT+ISTV PYT L+++IY  F  ++++      + RV  V P
Sbjct  144  KRVKIDKKLLSIDQDGEVGTKISTVDPYTVLQSSIYKAFTKTFIKLLKK--VPRVKAVKP  201

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+VCF         VG   P V+FVLQ+    WR+   NSMV V +  +CL F+DGG   
Sbjct  202  FDVCFDAKSFSSTRVGPGEPPVDFVLQNNETVWRIWGANSMVYVNEKTLCLAFIDGGAEP  261

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  299
              S+VIGGYQLE+NLL+F+L +  LGF+   L + T+CS+
Sbjct  262  RTSIVIGGYQLENNLLQFDLASKRLGFSGSLLFSQTTCSN  301



>gb|KDP25943.1| hypothetical protein JCGZ_22848 [Jatropha curcas]
Length=434

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (63%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            +++ +N  LL + +E +GGT+ISTV PYT L+T+IY     +++++ + +   RV  VAP
Sbjct  271  KQVKINKKLLSITEEGKGGTKISTVNPYTVLETSIYKAVTKAFVKALSKV--PRVKAVAP  328

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F VCFS        VG  VP ++ VLQ+    WR+   NSMV + D  +CL F+DGG   
Sbjct  329  FGVCFSAKHIGVTRVGPAVPTIDLVLQNNGTVWRIWGTNSMVNINDNALCLAFVDGGADA  388

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHFT  293
              S+VIGG+QLE+NLL+F+ G+  LGF+  +    T+C++F 
Sbjct  389  ETSIVIGGHQLEENLLQFDFGSKTLGFSGPLPFWRTTCANFN  430



>ref|XP_006419822.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
 gb|ESR33062.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
Length=422

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   A   ++RV PVAP
Sbjct  259  KAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--AMPNVTRVAPVAP  316

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG-VMCLGFLDGGLG  416
               CF       S  G  VP ++ VLQ+  V W +   NS+V+V +  V CLGF+DGG+ 
Sbjct  317  LGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNNDVSCLGFVDGGVR  375

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
               S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F 
Sbjct  376  PMTSIVIGGHQLENNLLQFDLASSRLGFSNSLLFQRTVCDNFN  418



>gb|KDO74800.1| hypothetical protein CISIN_1g036447mg, partial [Citrus sinensis]
Length=338

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   A   ++RV PVAP
Sbjct  175  KAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--AMPNVTRVAPVAP  232

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG-VMCLGFLDGGLG  416
               CF       S  G  VP ++ VLQ+  V W +   NS+V+V +  V CLGF+DGG+ 
Sbjct  233  LGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNNDVSCLGFVDGGVR  291

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
               S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F 
Sbjct  292  PMTSIVIGGHQLENNLLQFDLPSSRLGFSNSLLFQRTVCDNFN  334



>ref|XP_009591595.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 105/163 (64%), Gaps = 18/163 (11%)
 Frame = -3

Query  736  LPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFE  557
            +P+NT+LL + ++ +GGT+ISTV PY  L+++IY+    ++++S A   + RV PVAPF+
Sbjct  274  VPINTTLLTITKDGKGGTKISTVEPYMKLESSIYNALTKAFVKSLAK--VPRVKPVAPFK  331

Query  556  VCF-------SGVGSDVPKVEFVLQSEM-----VKWRMNSMVKVGDGVMCLGFLDGGL--  419
            VC+       + VG  VP +E VL S         W +NSMV V + V+CLGF+DGG+  
Sbjct  332  VCYNRASLGSTRVGPGVPPIELVLGSNKDAKSWTIWGVNSMVAVNNEVLCLGFVDGGIEF  391

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
                S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  392  EPTTSIVIGAHQIEDNLLQFDIANKKLGFTSSLLFGQTTCANF  434



>gb|KCW84281.1| hypothetical protein EUGRSUZ_B01132 [Eucalyptus grandis]
Length=302

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 15/161 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLN +LL +  +  GGT+ISTV PYT ++T+I+  F+  +   A +  L++V  V P
Sbjct  139  KAVPLNAALLKI-TDGNGGTKISTVNPYTVMETSIFKAFVKVFRHEAKN--LTKVSSVKP  195

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ  413
            F+ CFS        VG  VP ++ V+ +  V WR+   NSMV+V + V+CLGF+DGG   
Sbjct  196  FKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVKEDVICLGFVDGGSNP  255

Query  412  GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  256  RTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  296



>ref|XP_006433276.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
 gb|ESR46516.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
Length=422

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 14/162 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            +++P+N SLL  +     GGT+IST+ PYT L+ +IY  F   +L S          PVA
Sbjct  256  KQVPINASLLKFNVNAGTGGTKISTIKPYTVLEHSIYQSF-TRFLTSQLPGIPQLAKPVA  314

Query  565  PFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   GV CL F+DGG+ 
Sbjct  315  PFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARRGVTCLAFVDGGVR  374

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F
Sbjct  375  PRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNF  416



>gb|KDP21481.1| hypothetical protein JCGZ_21952 [Jatropha curcas]
Length=453

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 106/160 (66%), Gaps = 15/160 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + + LN+S L  D+   GGT++ST   YTTL+++IY  F+++++  +A + L+    V P
Sbjct  268  KPIQLNSSQLSFDENGFGGTKLSTDTSYTTLESSIYRAFVEAFVNESAGLNLTVTSVVKP  327

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-GDGV--MCLGFLDGG  422
            F+VC+         VG  VP V+FV++SE V WR+   NSMV +  DGV   CLGF+DGG
Sbjct  328  FDVCYQATDVISTRVGPGVPTVDFVMESEDVFWRIFGWNSMVMIERDGVDLWCLGFVDGG  387

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  308
            +   AS+VIGG+Q+EDNLLEF++ +  LGF+S  L+ GTS
Sbjct  388  VNARASIVIGGHQMEDNLLEFDMESKRLGFSSSLLLKGTS  427



>ref|XP_003520561.1| PREDICTED: basic 7S globulin-like [Glycine max]
Length=427

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 15/163 (9%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + L +N+S+L +DQ   GGT+IST  PYT L+T+IY  F+  ++  +++  L+  + V P
Sbjct  254  KPLYINSSILTVDQTGFGGTKISTAEPYTVLETSIYRLFVQRFVNESSAFNLTVTEAVEP  313

Query  562  FEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG---VMCLGFLDGG  422
            F VC+         VG  VP V+ V+ SE V WR+   NSMV+V  G   V CLGF+DGG
Sbjct  314  FGVCYPAGDLTETRVGPAVPTVDLVMHSEDVFWRIFGGNSMVRVAKGGVDVWCLGFVDGG  373

Query  421  LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  299
                  +VIGG+QLEDNL++F+L ++  GFTS  L+    CS+
Sbjct  374  TRGRTPIVIGGHQLEDNLMQFDLDSNRFGFTSTLLLQDAKCSN  416



>ref|XP_010026985.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=434

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 100/162 (62%), Gaps = 18/162 (11%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYH-----PFLDSYLESAASMGLSRVDPVA  566
             N+S+L +D++  GGT+  T+ PY+    T +H     P ++ + + A    + +  PVA
Sbjct  274  FNSSILAIDKDGAGGTKFGTLTPYSRAPYTFFHSAIFNPLVEEFTKKATDGKIKKATPVA  333

Query  565  PFEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF      SGV GSDVP +  VL+ +  +WR+   NSMV+V   VMCLGFLDGG G
Sbjct  334  PFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSMVRVSKDVMCLGFLDGGSG  392

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
             GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH 
Sbjct  393  AGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSHL  434



>gb|EYU41534.1| hypothetical protein MIMGU_mgv1a008121mg [Erythranthe guttata]
Length=384

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 7/100 (7%)
 Frame = -3

Query  601  ASMGLSRVDPVAPFEVCF--SGVGS--DVPKVEFVLQSEMVKWRM---NSMVKVGDGVMC  443
            ++M ++RV  VAPFEVCF   GVG+  DVP V+ VLQSEMV+WR+   NSMV VGDGV C
Sbjct  269  SAMNMTRVSAVAPFEVCFGSKGVGNIPDVPIVDLVLQSEMVRWRIHGRNSMVDVGDGVFC  328

Query  442  LGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSL  323
            LGFLDGGL    ++V+GGYQ+ED LLEFNLG SMLGF+SL
Sbjct  329  LGFLDGGLSPRDAIVLGGYQMEDYLLEFNLGNSMLGFSSL  368



>ref|XP_006489578.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 105/163 (64%), Gaps = 16/163 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAP  563
            + +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   A   ++RV PVAP
Sbjct  259  KAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--AMPNVTRVAPVAP  316

Query  562  FEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG-VMCLGFLDGGLG  416
               CF       S  G  VP ++ VLQ+  V W +   NS+V+V +  V CLGF+DGG+ 
Sbjct  317  LGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNNDVSCLGFVDGGVR  375

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  293
               S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F 
Sbjct  376  PMTSIVIGGHQLENNLLQFDLPSSRLGFSNSLLFQRTVCDNFN  418



>ref|XP_009787261.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=436

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 100/165 (61%), Gaps = 16/165 (10%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVA  566
            + +PLN +LL +++E   GGT+IST  PYT L+T ++    + ++  A +M L+   PV 
Sbjct  266  KSVPLNQTLLKINEENGYGGTKISTSTPYTVLQTAMFKAVTERFVAEAKAMNLTVTTPVK  325

Query  565  PFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD---GVMCLGFLDG  425
            PFEVCF         +G  VP ++ VLQ   V WR+   NSMV+V      V CLGF+DG
Sbjct  326  PFEVCFPAKAIAFTRLGPAVPTIDLVLQKPDVFWRIFGSNSMVRVKAQNVDVWCLGFVDG  385

Query  424  GLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            G     S+VIGG+Q+EDNLL+F+L     GF+S  L   T+C++F
Sbjct  386  GPEPRTSIVIGGHQIEDNLLQFDLAQKRFGFSSSLLFKSTNCANF  430



>gb|KCW60840.1| hypothetical protein EUGRSUZ_H03578 [Eucalyptus grandis]
Length=392

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 100/161 (62%), Gaps = 18/161 (11%)
 Frame = -3

Query  730  LNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYH-----PFLDSYLESAASMGLSRVDPVA  566
             N+S+L +D++  GGT+  T+ PY+    T +H     P ++ + + A    + +  PVA
Sbjct  232  FNSSILAIDKDGAGGTKFGTLTPYSRAPYTFFHSAIFNPLVEEFTKKATDGKIKKATPVA  291

Query  565  PFEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLG  416
            PF  CF      SGV GSDVP +  VL+ +  +WR+   NSMV+V   VMCLGFLDGG G
Sbjct  292  PFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSMVRVSKDVMCLGFLDGGSG  350

Query  415  QGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  299
             GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH
Sbjct  351  AGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSH  391



>ref|XP_006371344.1| hypothetical protein POPTR_0019s09280g [Populus trichocarpa]
 gb|ERP49141.1| hypothetical protein POPTR_0019s09280g [Populus trichocarpa]
Length=442

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 102/166 (61%), Gaps = 18/166 (11%)
 Frame = -3

Query  742  RKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS--MGLSRVDPV  569
            + +  N +LL  +    GGTRISTVVPYT L+++IY  F  ++L+ AAS    L+   PV
Sbjct  271  KMVAFNKALLAFNDRGYGGTRISTVVPYTKLQSSIYKAFTLAFLKEAASSAFNLTTTKPV  330

Query  568  APFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG---VMCLGFLD  428
             PF VC+         +G  VP +E VL  + V W+M   NSMV+V      V CLGF+D
Sbjct  331  KPFRVCYPAGAVKTTQMGPAVPIIELVLDRQDVVWKMFGSNSMVRVTKKSVDVWCLGFVD  390

Query  427  GGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            GG+  G S++IGG QLEDNLL+F+L +  LGF+S  L  GT+C+ +
Sbjct  391  GGI-DGPSIMIGGLQLEDNLLQFDLQSQKLGFSSSILSKGTNCADY  435



>ref|XP_006371346.1| hypothetical protein POPTR_0019s09300g [Populus trichocarpa]
 gb|ERP49143.1| hypothetical protein POPTR_0019s09300g [Populus trichocarpa]
Length=444

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 19/167 (11%)
 Frame = -3

Query  742  RKLPLNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS--MGLSRVDP  572
            + +  N +LL +D Q   GGTRISTVVPYT L+++IY  F  ++L+ AAS    L+   P
Sbjct  272  KMVAFNKALLAIDDQSGSGGTRISTVVPYTKLQSSIYKAFTLAFLKEAASSAFNLTTTKP  331

Query  571  VAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD---GVMCLGFL  431
            V PF VC+         +G  VP +E VL  + V W+M   NSMV+V      + CLGF+
Sbjct  332  VKPFRVCYPADAVKTTQMGPAVPIIELVLDRQDVVWKMFGSNSMVRVTKKSVDLWCLGFV  391

Query  430  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
            DGG+  G S++IGG QLEDNLL+F+L +  LGF+S  L  GT+C+ +
Sbjct  392  DGGI-DGPSIMIGGLQLEDNLLQFDLQSQKLGFSSSILSKGTNCADY  437



>ref|XP_011005003.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=262

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 19/163 (12%)
 Frame = -3

Query  730  LNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS--MGLSRVDPVAPF  560
             N +LL +D Q   GGTRIST+VPYT L+++IY  F  ++L+ AAS    L+   PV PF
Sbjct  94   FNKALLAIDDQSGSGGTRISTLVPYTKLQSSIYKAFTLAFLKEAASSAFNLTTTKPVKPF  153

Query  559  EVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG---VMCLGFLDGGL  419
             VC+       + +G  VP +E VL  + V W+M   NSMV+V      + CLGF+DGG+
Sbjct  154  RVCYPVGAVKTTQMGPAVPLIELVLDRQDVVWKMFGSNSMVRVTKKSVDLWCLGFVDGGI  213

Query  418  GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  296
              G S++IGG QLEDNLL+ +L +  LGF+S  L  GT C+ +
Sbjct  214  -DGPSIIIGGLQLEDNLLQIDLQSKKLGFSSSILSKGTKCADY  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420