BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006P15

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347149.1|  PREDICTED: putative PAP-specific phosphatase...  89.4    1e-18   Solanum tuberosum [potatoes]
emb|CDO99643.1|  unnamed protein product                              87.4    7e-18   Coffea canephora [robusta coffee]
ref|XP_002524696.1|  diphosphonucleoside phosphohydrolase, putative   86.7    1e-17   Ricinus communis
ref|XP_004232790.1|  PREDICTED: putative PAP-specific phosphatase...  86.7    1e-17   Solanum lycopersicum
ref|XP_009764406.1|  PREDICTED: putative PAP-specific phosphatase...  87.0    1e-17   Nicotiana sylvestris
ref|XP_009764407.1|  PREDICTED: putative PAP-specific phosphatase...  86.3    2e-17   Nicotiana sylvestris
ref|XP_009612768.1|  PREDICTED: putative PAP-specific phosphatase...  86.3    2e-17   Nicotiana tomentosiformis
ref|XP_009629474.1|  PREDICTED: putative PAP-specific phosphatase...  84.3    5e-17   Nicotiana tomentosiformis
ref|XP_009612769.1|  PREDICTED: putative PAP-specific phosphatase...  84.0    7e-17   Nicotiana tomentosiformis
ref|XP_004232791.1|  PREDICTED: putative PAP-specific phosphatase...  84.7    7e-17   Solanum lycopersicum
ref|XP_006347146.1|  PREDICTED: putative PAP-specific phosphatase...  83.2    9e-17   
ref|XP_009789398.1|  PREDICTED: putative PAP-specific phosphatase...  83.2    1e-16   Nicotiana sylvestris
ref|XP_002305648.1|  PAP-specific phosphatase family protein          83.6    2e-16   Populus trichocarpa [western balsam poplar]
ref|NP_192418.1|  Inositol monophosphatase family protein             82.8    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001147.1|  PREDICTED: putative PAP-specific phosphatase...  82.8    4e-16   Populus euphratica
ref|XP_006467909.1|  PREDICTED: putative PAP-specific phosphatase...  82.8    4e-16   Citrus sinensis [apfelsine]
ref|XP_006449198.1|  hypothetical protein CICLE_v10015399mg           82.4    5e-16   Citrus clementina [clementine]
ref|XP_002872735.1|  inositol monophosphatase family protein          81.6    8e-16   
ref|XP_009604840.1|  PREDICTED: putative PAP-specific phosphatase...  80.5    1e-15   
gb|KDO75690.1|  hypothetical protein CISIN_1g028594mg                 78.6    1e-15   Citrus sinensis [apfelsine]
ref|XP_011096189.1|  PREDICTED: putative PAP-specific phosphatase...  80.1    2e-15   Sesamum indicum [beniseed]
ref|XP_010904818.1|  PREDICTED: putative PAP-specific phosphatase...  80.9    2e-15   Elaeis guineensis
gb|KDO75691.1|  hypothetical protein CISIN_1g028594mg                 78.6    2e-15   Citrus sinensis [apfelsine]
ref|XP_008795435.1|  PREDICTED: putative PAP-specific phosphatase...  80.1    3e-15   Phoenix dactylifera
ref|XP_008795434.1|  PREDICTED: putative PAP-specific phosphatase...  80.5    3e-15   Phoenix dactylifera
gb|EYU27887.1|  hypothetical protein MIMGU_mgv1a010581mg              79.0    4e-15   Erythranthe guttata [common monkey flower]
gb|KEH36506.1|  inositol monophosphatase family protein               79.7    4e-15   Medicago truncatula
ref|XP_003545824.1|  PREDICTED: putative PAP-specific phosphatase...  79.3    5e-15   Glycine max [soybeans]
ref|XP_007025820.1|  Inositol monophosphatase family protein isof...  79.0    9e-15   
ref|XP_004485698.1|  PREDICTED: putative PAP-specific phosphatase...  78.2    1e-14   Cicer arietinum [garbanzo]
ref|XP_010686263.1|  PREDICTED: putative PAP-specific phosphatase...  78.6    1e-14   
ref|XP_006396634.1|  hypothetical protein EUTSA_v10028719mg           78.2    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_007025821.1|  Inositol monophosphatase family protein isof...  77.8    1e-14   
ref|XP_006289674.1|  hypothetical protein CARUB_v10003240mg           78.2    2e-14   
ref|XP_010268875.1|  PREDICTED: putative PAP-specific phosphatase...  78.2    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010268876.1|  PREDICTED: putative PAP-specific phosphatase...  78.2    2e-14   Nelumbo nucifera [Indian lotus]
gb|KJB57667.1|  hypothetical protein B456_009G174400                  78.2    2e-14   Gossypium raimondii
gb|KJB57666.1|  hypothetical protein B456_009G174400                  78.2    2e-14   Gossypium raimondii
ref|XP_010268878.1|  PREDICTED: putative PAP-specific phosphatase...  77.4    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004485697.1|  PREDICTED: putative PAP-specific phosphatase...  77.8    2e-14   Cicer arietinum [garbanzo]
ref|XP_011096187.1|  PREDICTED: putative PAP-specific phosphatase...  77.8    3e-14   Sesamum indicum [beniseed]
gb|KFK32227.1|  hypothetical protein AALP_AA6G214300                  77.4    3e-14   Arabis alpina [alpine rockcress]
ref|XP_010431753.1|  PREDICTED: putative PAP-specific phosphatase...  77.4    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008358697.1|  PREDICTED: putative PAP-specific phosphatase...  77.4    4e-14   
ref|XP_010424614.1|  PREDICTED: putative PAP-specific phosphatase...  75.1    4e-14   
ref|XP_010431745.1|  PREDICTED: putative PAP-specific phosphatase...  77.0    4e-14   Camelina sativa [gold-of-pleasure]
emb|CDY44753.1|  BnaC09g22270D                                        76.6    4e-14   Brassica napus [oilseed rape]
ref|XP_009114511.1|  PREDICTED: putative PAP-specific phosphatase...  76.6    5e-14   Brassica rapa
ref|XP_010096795.1|  Putative PAP-specific phosphatase                74.3    9e-14   
ref|XP_010529389.1|  PREDICTED: putative PAP-specific phosphatase...  75.9    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_008355984.1|  PREDICTED: putative PAP-specific phosphatase...  75.9    1e-13   
ref|XP_010529390.1|  PREDICTED: putative PAP-specific phosphatase...  75.5    1e-13   Tarenaya hassleriana [spider flower]
gb|KJB69430.1|  hypothetical protein B456_011G023700                  75.5    2e-13   Gossypium raimondii
ref|XP_008439911.1|  PREDICTED: putative PAP-specific phosphatase...  75.1    2e-13   Cucumis melo [Oriental melon]
ref|XP_003635071.1|  PREDICTED: putative PAP-specific phosphatase...  74.7    3e-13   Vitis vinifera
gb|KHN08591.1|  Putative PAP-specific phosphatase, mitochondrial      73.6    3e-13   Glycine soja [wild soybean]
ref|XP_008439913.1|  PREDICTED: putative PAP-specific phosphatase...  74.3    3e-13   Cucumis melo [Oriental melon]
gb|KHG18473.1|  hypothetical protein F383_25053                       74.7    4e-13   Gossypium arboreum [tree cotton]
ref|XP_010455842.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010057757.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    5e-13   Eucalyptus grandis [rose gum]
ref|XP_006841857.1|  hypothetical protein AMTR_s00003p00271350        74.3    5e-13   
ref|XP_004155585.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    6e-13   
ref|XP_004134734.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    6e-13   Cucumis sativus [cucumbers]
ref|XP_010422381.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007211955.1|  hypothetical protein PRUPE_ppa006452mg           73.6    7e-13   Prunus persica
ref|XP_010455841.1|  PREDICTED: putative PAP-specific phosphatase...  73.6    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010468656.1|  PREDICTED: putative PAP-specific phosphatase...  73.9    8e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008224928.1|  PREDICTED: putative PAP-specific phosphatase...  73.2    1e-12   Prunus mume [ume]
ref|XP_002439309.1|  hypothetical protein SORBIDRAFT_09g004170        72.8    2e-12   Sorghum bicolor [broomcorn]
ref|XP_008439914.1|  PREDICTED: putative PAP-specific phosphatase...  72.0    2e-12   Cucumis melo [Oriental melon]
ref|XP_004958011.1|  PREDICTED: putative PAP-specific phosphatase...  72.4    3e-12   Setaria italica
gb|KHG07652.1|  hypothetical protein F383_34478                       71.6    4e-12   Gossypium arboreum [tree cotton]
ref|XP_009374521.1|  PREDICTED: putative PAP-specific phosphatase...  70.9    7e-12   
gb|ACG38535.1|  hypothetical protein                                  68.6    9e-12   Zea mays [maize]
ref|XP_011460308.1|  PREDICTED: putative PAP-specific phosphatase...  70.5    9e-12   Fragaria vesca subsp. vesca
ref|NP_001241697.1|  uncharacterized protein LOC100857094             69.7    2e-11   
tpg|DAA63106.1|  TPA: hypothetical protein ZEAMMB73_483520            69.7    2e-11   
ref|XP_003562924.1|  PREDICTED: putative PAP-specific phosphatase...  69.7    2e-11   Brachypodium distachyon [annual false brome]
tpg|DAA63105.1|  TPA: hypothetical protein ZEAMMB73_483520            68.6    2e-11   
gb|EEC82264.1|  hypothetical protein OsI_26461                        68.2    4e-11   Oryza sativa Indica Group [Indian rice]
ref|NP_001059973.1|  Os07g0558200                                     68.6    5e-11   
gb|EAZ40277.1|  hypothetical protein OsJ_24719                        68.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148252.1|  hypothetical protein PHAVU_006G192800g           68.2    7e-11   Phaseolus vulgaris [French bean]
ref|XP_006658689.1|  PREDICTED: putative PAP-specific phosphatase...  67.4    1e-10   Oryza brachyantha
gb|EMT21653.1|  Putative PAP-specific phosphatase, mitochondrial      67.0    2e-10   
dbj|BAJ91398.1|  predicted protein                                    65.1    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02076.1|  Putative PAP-specific phosphatase, mitochondrial      67.0    2e-10   
dbj|BAJ88879.1|  predicted protein                                    66.6    3e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657828.1|  PREDICTED: putative PAP-specific phosphatase...  65.9    5e-10   
gb|EMS61731.1|  Putative PAP-specific phosphatase, mitochondrial      64.7    6e-10   Triticum urartu
gb|EMS56114.1|  Putative PAP-specific phosphatase, mitochondrial      65.1    6e-10   Triticum urartu
gb|EEC82265.1|  hypothetical protein OsI_26462                        62.8    5e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001059974.1|  Os07g0558300                                     62.8    6e-09   
ref|XP_009592888.1|  PREDICTED: uncharacterized protein LOC104089648  55.1    6e-07   
ref|XP_009412947.1|  PREDICTED: putative PAP-specific phosphatase...  55.5    2e-06   
gb|ADE76034.1|  unknown                                               54.3    4e-06   Picea sitchensis
gb|EPS68945.1|  hypothetical protein M569_05822                       50.1    2e-05   Genlisea aurea
ref|XP_010468220.1|  PREDICTED: putative PAP-specific phosphatase...  50.8    4e-05   Camelina sativa [gold-of-pleasure]



>ref|XP_006347149.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=408

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G+ +DFA D+ ERRLIFPSGG LVTN SLH  I+GMI
Sbjct  348  VGIICVHEAGGKVTDWEGSSLDFAADQTERRLIFPSGGVLVTNGSLHSKIIGMI  401



>emb|CDO99643.1| unnamed protein product [Coffea canephora]
Length=413

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG+++DFA D+ +RR+IFPSGG LVTN SLH+ IL +I
Sbjct  352  VGIICVHEAGGKVTDWRGSELDFAADQVKRRIIFPSGGVLVTNDSLHRAILEII  405



>ref|XP_002524696.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
 gb|EEF37715.1| diphosphonucleoside phosphohydrolase, putative [Ricinus communis]
Length=414

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+GN +DFA D+ ERR+IFPSGG LVTN  LH  I+ MI
Sbjct  354  VGIICVHEAGGKVTDWKGNQLDFAADQVERRIIFPSGGVLVTNGKLHNQIVEMI  407



>ref|XP_004232790.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Solanum 
lycopersicum]
Length=408

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G+ +DFA D+ ERRLIFPSGG LVTN SLH  I+ MI
Sbjct  348  VGIICVHEAGGKVTDWEGSSLDFAADQTERRLIFPSGGVLVTNGSLHSKIIEMI  401



>ref|XP_009764406.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=430

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G  +D A D+ ERRLIFPSGG LVTN SLH  I+GMI
Sbjct  370  VGIICVHEAGGKVTDWAGGSLDIAADQTERRLIFPSGGVLVTNGSLHSKIIGMI  423



>ref|XP_009764407.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=408

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G  +D A D+ ERRLIFPSGG LVTN SLH  I+GMI
Sbjct  348  VGIICVHEAGGKVTDWAGGSLDIAADQTERRLIFPSGGVLVTNGSLHSKIIGMI  401



>ref|XP_009612768.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=408

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G  +D A D+ ERRLIFPSGG LVTN SLH  I+GMI
Sbjct  348  VGIICVHEAGGKVTDWAGGSLDIAADQTERRLIFPSGGVLVTNGSLHSKIIGMI  401



>ref|XP_009629474.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial, 
partial [Nicotiana tomentosiformis]
Length=351

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGG  +DW G+ IDFA D+  RR IFPSGG LVTN SLH +ILG+I
Sbjct  291  VGIICVHEAGGMVTDWEGSSIDFAADQIARRTIFPSGGFLVTNCSLHNEILGLI  344



>ref|XP_009612769.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=353

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G  +D A D+ ERRLIFPSGG LVTN SLH  I+GMI
Sbjct  293  VGIICVHEAGGKVTDWAGGSLDIAADQTERRLIFPSGGVLVTNGSLHSKIIGMI  346



>ref|XP_004232791.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Solanum 
lycopersicum]
Length=417

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G+ IDFA D+  RR IFPSGG LVTN  LH  ILG+I
Sbjct  357  VGIICVHEAGGKVTDWEGSSIDFAADQVARRTIFPSGGFLVTNYILHNQILGLI  410



>ref|XP_006347146.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Solanum tuberosum]
Length=316

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G+ IDFA D+  RR IFPSGG LVTN  LH +ILG+I
Sbjct  256  VGIICVHEAGGKVTDWEGSSIDFAADQVARRTIFPSGGFLVTNHCLHNEILGLI  309



>ref|XP_009789398.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Nicotiana 
sylvestris]
Length=316

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G+ IDFA D+  RR IFPSGG LVTN  LH +ILG+I
Sbjct  256  VGIICVHEAGGKVTDWEGSSIDFAADQIARRTIFPSGGFLVTNHRLHNEILGLI  309



>ref|XP_002305648.1| PAP-specific phosphatase family protein [Populus trichocarpa]
 gb|EEE86159.1| PAP-specific phosphatase family protein [Populus trichocarpa]
Length=411

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G+DID A D+ ERR++FPS G LVTN ++H  IL MI
Sbjct  354  VGIICVHEAGGKVTDWKGSDIDLAADQVERRILFPSMGVLVTNGTIHNQILEMI  407



>ref|NP_192418.1| Inositol monophosphatase family protein [Arabidopsis thaliana]
 sp|Q9M0Y6.1|DPNPM_ARATH RecName: Full=Putative PAP-specific phosphatase, mitochondrial; 
AltName: Full=3'(2'),5'-bisphosphate nucleotidase; AltName: 
Full=3'(2'),5-bisphosphonucleoside 3'(2')-phosphohydrolase; 
AltName: Full=DPNPase; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB81051.1| 3'(2'), 5'-BISPHOSPHATE NUCLEOTIDASE-like protein [Arabidopsis 
thaliana]
 gb|AAM62812.1| 3(2),5-BISPHOSPHATE NUCLEOTIDASE-like protein [Arabidopsis thaliana]
 dbj|BAD43064.1| 3'(2'),5'-bisphosphate nucleotidase-like protein [Arabidopsis 
thaliana]
 gb|AEE82476.1| Inositol monophosphatase family protein [Arabidopsis thaliana]
Length=397

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G++I+  ED+ ERRLIFP+GG +V+N SLH  IL MI
Sbjct  337  VGIICVHEAGGKVTDWEGDEINLEEDQSERRLIFPAGGVVVSNGSLHNQILEMI  390



>ref|XP_011001147.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Populus 
euphratica]
 ref|XP_011001148.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Populus 
euphratica]
 ref|XP_011001149.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Populus 
euphratica]
 ref|XP_011001150.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Populus 
euphratica]
Length=411

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G DID A D+ ERR++FPS G LVTN ++H  IL MI
Sbjct  354  VGIICVHEAGGKVTDWKGRDIDLAADQVERRILFPSLGVLVTNGTIHNQILEMI  407



>ref|XP_006467909.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=414

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG+ ID   D+ ERR IFPSGG LVTN +LH  I+ MI
Sbjct  354  VGIICVHEAGGKVTDWRGSPIDLDADQAERRAIFPSGGVLVTNDNLHHQIVEMI  407



>ref|XP_006449198.1| hypothetical protein CICLE_v10015399mg [Citrus clementina]
 gb|ESR62438.1| hypothetical protein CICLE_v10015399mg [Citrus clementina]
Length=414

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG+ ID   D+ ERR IFPSGG LVTN +LH  I+ MI
Sbjct  354  VGIICVHEAGGKVTDWRGSPIDLDADQAERRAIFPSGGVLVTNDNLHHQIVEMI  407



>ref|XP_002872735.1| inositol monophosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48994.1| inositol monophosphatase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G++I+  ED+ ERRLIFP+GG +V+N SLH  I+ MI
Sbjct  333  VGIICVHEAGGKVTDWEGDEINLEEDQSERRLIFPAGGVVVSNGSLHNQIIEMI  386



>ref|XP_009604840.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009604849.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Nicotiana 
tomentosiformis]
 ref|XP_009604858.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Nicotiana 
tomentosiformis]
Length=316

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEA GK +DW G+ IDF  D+  RR IFPSGG LVTN SLH +ILG+I
Sbjct  256  VGIICVHEAWGKVTDWEGSSIDFVADQIARRTIFPSGGFLVTNHSLHNEILGLI  309



>gb|KDO75690.1| hypothetical protein CISIN_1g028594mg [Citrus sinensis]
Length=177

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG+ ID   D+ ERR IFPSGG LVTN +LH  I+ MI
Sbjct  115  VGIICVHEAGGKVTDWRGSPIDLDADQAERRAIFPSGGILVTNDNLHHQIVEMI  168



>ref|XP_011096189.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X3 [Sesamum indicum]
Length=353

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVICI EAGG+ +DW+G+ +DFA D+ ERR++FPSGG LVTN  LH  IL +I
Sbjct  297  VGVICISEAGGRVTDWKGSQLDFAADQIERRVLFPSGGILVTNDRLHNQILEII  350



>ref|XP_010904818.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Elaeis 
guineensis]
Length=424

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGG+ +DW G+ +D A D+ +RR+IFPSGG LVTN +LHK +L MI
Sbjct  364  VGVICVHEAGGQVTDWNGSALDLAADQVDRRIIFPSGGVLVTNGALHKQLLEMI  417



>gb|KDO75691.1| hypothetical protein CISIN_1g028594mg [Citrus sinensis]
 gb|KDO75692.1| hypothetical protein CISIN_1g028594mg [Citrus sinensis]
 gb|KDO75693.1| hypothetical protein CISIN_1g028594mg [Citrus sinensis]
Length=207

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG+ ID   D+ ERR IFPSGG LVTN +LH  I+ MI
Sbjct  145  VGIICVHEAGGKVTDWRGSPIDLDADQAERRAIFPSGGILVTNDNLHHQIVEMI  198



>ref|XP_008795435.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Phoenix dactylifera]
Length=401

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGV+C+HEAGGK +DW G+ +D A D+ +RR+IFPSGG LVTN +LHK +L +I
Sbjct  341  VGVVCVHEAGGKVTDWNGSPLDLAADQVDRRIIFPSGGVLVTNGALHKQLLEII  394



>ref|XP_008795434.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Phoenix dactylifera]
Length=426

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGV+C+HEAGGK +DW G+ +D A D+ +RR+IFPSGG LVTN +LHK +L +I
Sbjct  366  VGVVCVHEAGGKVTDWNGSPLDLAADQVDRRIIFPSGGVLVTNGALHKQLLEII  419



>gb|EYU27887.1| hypothetical protein MIMGU_mgv1a010581mg [Erythranthe guttata]
Length=308

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVICIHEAGGK SDW G+ ++FA DE ERR++FP GG LVTN SLH  IL +I
Sbjct  252  VGVICIHEAGGKVSDWEGSQLNFAVDEIERRVLFPCGGILVTNDSLHDRILEII  305



>gb|KEH36506.1| inositol monophosphatase family protein [Medicago truncatula]
Length=411

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G +ID AED+  RR+IFPSGG LVTN +LH  I+ +I
Sbjct  352  VGMICVHEAGGKVTDWEGIEIDLAEDQPSRRIIFPSGGVLVTNGNLHDQIVQII  405



>ref|XP_003545824.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Glycine max]
Length=403

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G+DID A D   RR+IFPSGG LV N +LH  IL +I
Sbjct  344  VGIICVHEAGGKVTDWKGSDIDLAADHVGRRIIFPSGGVLVANGNLHNKILQII  397



>ref|XP_007025820.1| Inositol monophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY28442.1| Inositol monophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=419

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGGK +DW G+++D A D+ ERR I+P+GG LVTN ++H  IL MI
Sbjct  359  VGVICVHEAGGKVTDWTGSELDLAADQVERRNIYPAGGVLVTNGNIHDQILEMI  412



>ref|XP_004485698.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=396

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+ICIHEAGGK +DW G +ID A D+  RR+IFPSGG LVTN + H  IL +I
Sbjct  340  VGMICIHEAGGKVTDWNGIEIDLAADQTGRRIIFPSGGILVTNGNFHNQILHII  393



>ref|XP_010686263.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=416

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DWRG++I+ A DE  RR I PSGG +VTN +LH  ILG++
Sbjct  355  VGMICVHEAGGKVTDWRGSEINLAADEMGRRTIVPSGGVVVTNGTLHGQILGLM  408



>ref|XP_006396634.1| hypothetical protein EUTSA_v10028719mg [Eutrema salsugineum]
 gb|ESQ38087.1| hypothetical protein EUTSA_v10028719mg [Eutrema salsugineum]
Length=392

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G++I   ED+ ERRLIFP+GG +V+N SLH  IL MI
Sbjct  332  VGIICVHEAGGKVTDWEGDEISLEEDQSERRLIFPAGGVVVSNGSLHHQILEMI  385



>ref|XP_007025821.1| Inositol monophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY28443.1| Inositol monophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=361

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGGK +DW G+++D A D+ ERR I+P+GG LVTN ++H  IL MI
Sbjct  301  VGVICVHEAGGKVTDWTGSELDLAADQVERRNIYPAGGVLVTNGNIHDQILEMI  354



>ref|XP_006289674.1| hypothetical protein CARUB_v10003240mg [Capsella rubella]
 gb|EOA22572.1| hypothetical protein CARUB_v10003240mg [Capsella rubella]
Length=399

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGGK +DW G++I+  ED+ ERRLIFP+GG + +N +LH  +L M+
Sbjct  339  VGVICVHEAGGKVTDWEGDEINLEEDQSERRLIFPAGGVIASNGNLHNHLLEML  392



>ref|XP_010268875.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Nelumbo nucifera]
Length=419

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDIL  188
            VG+IC+HEAGG+ +DW+G+ +D A D+ ERR IFPSGG LVTN +LH  IL
Sbjct  359  VGMICVHEAGGQVTDWKGSQLDLAADQVERRAIFPSGGVLVTNGNLHNQIL  409



>ref|XP_010268876.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=410

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDIL  188
            VG+IC+HEAGG+ +DW+G+ +D A D+ ERR IFPSGG LVTN +LH  IL
Sbjct  359  VGMICVHEAGGQVTDWKGSQLDLAADQVERRAIFPSGGVLVTNGNLHNQIL  409



>gb|KJB57667.1| hypothetical protein B456_009G174400 [Gossypium raimondii]
Length=410

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G ++D A D+ ERR+I+P GG LVTN  +H + L MI
Sbjct  350  VGMICVHEAGGKVTDWKGRELDLAADKVERRIIYPEGGILVTNGKIHNETLEMI  403



>gb|KJB57666.1| hypothetical protein B456_009G174400 [Gossypium raimondii]
Length=418

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G ++D A D+ ERR+I+P GG LVTN  +H + L MI
Sbjct  358  VGMICVHEAGGKVTDWKGRELDLAADKVERRIIYPEGGILVTNGKIHNETLEMI  411



>ref|XP_010268878.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X3 [Nelumbo nucifera]
Length=371

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDIL  188
            VG+IC+HEAGG+ +DW+G+ +D A D+ ERR IFPSGG LVTN +LH  IL
Sbjct  311  VGMICVHEAGGQVTDWKGSQLDLAADQVERRAIFPSGGVLVTNGNLHNQIL  361



>ref|XP_004485697.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=409

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+ICIHEAGGK +DW G +ID A D+  RR+IFPSGG LVTN + H  IL +I
Sbjct  353  VGMICIHEAGGKVTDWNGIEIDLAADQTGRRIIFPSGGILVTNGNFHNQILHII  406



>ref|XP_011096187.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Sesamum indicum]
Length=409

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVICI EAGG+ +DW+G+ +DFA D+ ERR++FPSGG LVTN  LH  IL +I
Sbjct  353  VGVICISEAGGRVTDWKGSQLDFAADQIERRVLFPSGGILVTNDRLHNQILEII  406



>gb|KFK32227.1| hypothetical protein AALP_AA6G214300 [Arabis alpina]
Length=393

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+IFP+GG +V+N SLH  IL MI
Sbjct  333  VGIICVHEAGGKVTDWEGDEINLEEDQSERRIIFPAGGVVVSNGSLHHQILEMI  386



>ref|XP_010431753.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=398

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW G++I+  ED+ ERR+IFP GG LV+N SLH  +L M
Sbjct  337  IGMICVHEAGGKVTDWEGDEINLEEDQSERRVIFPGGGILVSNGSLHSQLLEM  389



>ref|XP_008358697.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Malus 
domestica]
Length=411

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGGK +DW+G++++ A DE  RR I+PSGG LVTN +LH  ++ MI
Sbjct  349  VGVICVHEAGGKVTDWKGDELNLAADEVGRRNIYPSGGILVTNSTLHNRLVEMI  402



>ref|XP_010424614.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=200

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+IFP+GG LV+N  LH  +L MI
Sbjct  131  VGMICVHEAGGKVTDWEGDEINLEEDQSERRVIFPAGGVLVSNGRLHNQLLEMI  184



>ref|XP_010431745.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=402

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+IFP+GG LV+N  LH  +L M
Sbjct  342  VGMICVHEAGGKVTDWEGDEINLEEDQSERRVIFPAGGVLVSNGRLHNQLLEM  394



>emb|CDY44753.1| BnaC09g22270D [Brassica napus]
Length=388

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G DI+  ED+ ERR+IFP+GG +V+N SLH  +L MI
Sbjct  328  VGIICVHEAGGKVTDWEGVDINLEEDQSERRIIFPAGGVVVSNGSLHHQLLEMI  381



>ref|XP_009114511.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Brassica rapa]
 emb|CDY16618.1| BnaA09g19960D [Brassica napus]
Length=388

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW G DI+  ED+ ERR+IFP+GG +V+N SLH  +L MI
Sbjct  328  VGIICVHEAGGKVTDWEGVDINLEEDQSERRIIFPAGGVVVSNGSLHHQLLEMI  381



>ref|XP_010096795.1| Putative PAP-specific phosphatase [Morus notabilis]
 gb|EXB66018.1| Putative PAP-specific phosphatase [Morus notabilis]
Length=235

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G+ ID   DE  RR+I+PSGG LVTN +LH  I+ +I
Sbjct  176  VGMICVHEAGGKVTDWKGSHIDLTADESGRRIIYPSGGVLVTNGNLHNRIIELI  229



>ref|XP_010529389.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=410

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG++C+HEAGGK +DW G++I+  ED+ ERR+IFP+GG +V+N  LH  IL MI
Sbjct  348  VGIVCVHEAGGKVTDWEGDEINLEEDQAERRIIFPAGGVIVSNGRLHNQILDMI  401



>ref|XP_008355984.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Malus 
domestica]
Length=407

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G++++ A DE  RR I+PSGG L TN +LH  +L MI
Sbjct  346  VGIICVHEAGGKVTDWKGDELNLAADEVGRRNIYPSGGILATNGTLHNRLLEMI  399



>ref|XP_010529390.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=399

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG++C+HEAGGK +DW G++I+  ED+ ERR+IFP+GG +V+N  LH  IL MI
Sbjct  337  VGIVCVHEAGGKVTDWEGDEINLEEDQAERRIIFPAGGVIVSNGRLHNQILDMI  390



>gb|KJB69430.1| hypothetical protein B456_011G023700 [Gossypium raimondii]
Length=415

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+HEAGGK +DW G+++D A D+ +RR+I+P+GG LVTN  +H+ I+ MI
Sbjct  354  GMICVHEAGGKVTDWEGSELDLAADQVKRRIIYPAGGVLVTNGKIHQQIVEMI  406



>ref|XP_008439911.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Cucumis melo]
 ref|XP_008439912.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Cucumis melo]
Length=411

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW+GNDID A D+  RR++ PSGG LV+N  LH  I+ M
Sbjct  351  IGMICVHEAGGKVTDWKGNDIDLAADQAGRRILSPSGGVLVSNGHLHDLIIEM  403



>ref|XP_003635071.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Vitis 
vinifera]
 emb|CBI40861.3| unnamed protein product [Vitis vinifera]
Length=437

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+HEAGGK +DW G+ +D   D+ ERR+IFPSGG LV+N +LH  IL MI
Sbjct  377  VGVICVHEAGGKVTDWNGSQLDIEVDQVERRVIFPSGGILVSNGNLHDRILEMI  430



>gb|KHN08591.1| Putative PAP-specific phosphatase, mitochondrial [Glycine soja]
Length=328

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+HEAGGK +DW+G+DID A     RR+IFP GG LVTN +LH  IL +I
Sbjct  269  VGIICVHEAGGKVTDWQGSDIDLAVGHVGRRIIFPYGGVLVTNSNLHDKILQII  322



>ref|XP_008439913.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X2 [Cucumis melo]
Length=371

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW+GNDID A D+  RR++ PSGG LV+N  LH  I+ M
Sbjct  311  IGMICVHEAGGKVTDWKGNDIDLAADQAGRRILSPSGGVLVSNGHLHDLIIEM  363



>gb|KHG18473.1| hypothetical protein F383_25053 [Gossypium arboreum]
Length=434

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+HEAGGK +DW+G+++D A D+ +RR+I P+GG LVTN  +H+ I+ MI
Sbjct  373  GMICVHEAGGKVTDWKGSELDLAADQFKRRIICPAGGVLVTNGKIHQQIVEMI  425



>ref|XP_010455842.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=397

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+IFP+GG LV+N  LH  +L M
Sbjct  337  VGMICVHEAGGKVTDWEGDEINLEEDQSERRVIFPAGGVLVSNGRLHNQLLEM  389



>ref|XP_010057757.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW75042.1| hypothetical protein EUGRSUZ_E03818 [Eucalyptus grandis]
Length=407

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            VG+IC+HEAGGK +DW G+ ID A D  ERR++FP  G +V+N  LH  IL M
Sbjct  346  VGMICVHEAGGKVTDWEGSQIDLAADATERRIVFPKSGVIVSNGKLHNKILDM  398



>ref|XP_006841857.1| hypothetical protein AMTR_s00003p00271350 [Amborella trichopoda]
 gb|ERN03532.1| hypothetical protein AMTR_s00003p00271350 [Amborella trichopoda]
Length=435

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+ EAGG+ +DW+G+D++ A D+ +RR+IFP GG LVTN +LH  IL MI
Sbjct  376  GMICVSEAGGRVTDWKGSDLELAADKLQRRVIFPVGGILVTNGALHNHILQMI  428



>ref|XP_004155585.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Cucumis sativus]
Length=411

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            G+IC+HEAGGK +DW+GNDID A D+  RR++ PSGG LV+N  LH  I+ M
Sbjct  352  GMICVHEAGGKVTDWKGNDIDLAADQAGRRILSPSGGILVSNGHLHDLIIEM  403



>ref|XP_004134734.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN49178.1| hypothetical protein Csa_6G516860 [Cucumis sativus]
Length=411

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            G+IC+HEAGGK +DW+GNDID A D+  RR++ PSGG LV+N  LH  I+ M
Sbjct  352  GMICVHEAGGKVTDWKGNDIDLAADQAGRRILSPSGGILVSNGHLHDLIIEM  403



>ref|XP_010422381.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=397

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW G++I   ED+ ERR+IFP GG LV+N SLH  +L M
Sbjct  337  IGMICVHEAGGKVTDWEGDEISLEEDQSERRVIFPGGGILVSNGSLHSQLLEM  389



>ref|XP_007211955.1| hypothetical protein PRUPE_ppa006452mg [Prunus persica]
 gb|EMJ13154.1| hypothetical protein PRUPE_ppa006452mg [Prunus persica]
Length=411

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+HEAGGK +DW+G+ I+ A D+  RR I+PSGG LVTN +LH  ++ MI
Sbjct  350  GIICVHEAGGKVTDWKGDQINLAADQLGRRNIYPSGGILVTNGNLHNRLVEMI  402



>ref|XP_010455841.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=397

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW G +I+  ED+ ERR+IFP GG LV+N SLH  +L M
Sbjct  337  IGMICVHEAGGKVTDWEGGEINLEEDQSERRVIFPGGGILVSNGSLHNQLLEM  389



>ref|XP_010468656.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Camelina 
sativa]
Length=472

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+IFP+GG LV+N  LH  +L M
Sbjct  384  VGMICVHEAGGKVTDWEGDEINLEEDQSERRIIFPAGGVLVSNGRLHNQLLEM  436



>ref|XP_008224928.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Prunus 
mume]
Length=411

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+HEAGGK +DW+G+ I+ A D+  RR I+PSGG LVTN +LH  ++ MI
Sbjct  350  GIICVHEAGGKVTDWKGDQINLAADQIGRRNIYPSGGILVTNGNLHNRLVEMI  402



>ref|XP_002439309.1| hypothetical protein SORBIDRAFT_09g004170 [Sorghum bicolor]
 gb|EES17739.1| hypothetical protein SORBIDRAFT_09g004170 [Sorghum bicolor]
Length=439

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+  DWRG  +DFA D+  RR+I+P GG L TN +LH +++ MI
Sbjct  381  VGVICVQEAGGQTCDWRGEPLDFAADQTGRRIIYPWGGVLATNCALHDELVEMI  434



>ref|XP_008439914.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X3 [Cucumis melo]
Length=346

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGM  182
            +G+IC+HEAGGK +DW+GNDID A D+  RR++ PSGG LV+N  LH  I+ M
Sbjct  286  IGMICVHEAGGKVTDWKGNDIDLAADQAGRRILSPSGGVLVSNGHLHDLIIEM  338



>ref|XP_004958011.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Setaria italica]
Length=432

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR+I+PSGG LVTN +LH  ++ MI
Sbjct  374  VGVICVQEAGGQISDWSGKPLDLAADLTSRRIIYPSGGVLVTNGALHDKLVEMI  427



>gb|KHG07652.1| hypothetical protein F383_34478 [Gossypium arboreum]
Length=451

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 12/66 (18%)
 Frame = -1

Query  340  VGVICIHEAGGK------------XSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHK  197
            VG+IC+HEAGGK             +DW+G ++D A D+ ERR+I+P GG LVTN  +H 
Sbjct  379  VGMICVHEAGGKLPSLPFLYQANDVTDWKGRELDLAADKVERRIIYPEGGILVTNGKIHN  438

Query  196  DILGMI  179
            +IL MI
Sbjct  439  EILEMI  444



>ref|XP_009374521.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Pyrus 
x bretschneideri]
Length=428

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDIL  188
            VG+IC+HEAGGK +DW+G++++ A DE  RR I+PSGG + +N +LH  +L
Sbjct  366  VGIICVHEAGGKVTDWKGDELNLAADEVGRRNIYPSGGIIASNGTLHNRLL  416



>gb|ACG38535.1| hypothetical protein [Zea mays]
Length=203

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR+I+P GG LVTN +LH  ++ MI
Sbjct  145  VGVICVQEAGGQTSDWSGEPLDLAADLTSRRIIYPRGGVLVTNGALHDKLVEMI  198



>ref|XP_011460308.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=432

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+ EAGG  +DW GN +D A DE  RR+I+P GG LV+N  +H  +L +I
Sbjct  367  VGIICVLEAGGTATDWEGNQVDLAADEVGRRIIYPQGGFLVSNGKIHNQLLELI  420



>ref|NP_001241697.1| uncharacterized protein LOC100857094 [Zea mays]
 gb|ACG34913.1| hypothetical protein [Zea mays]
Length=411

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR+I+P GG LVTN +LH  ++ MI
Sbjct  353  VGVICVQEAGGQTSDWSGEPLDLAADLTSRRIIYPRGGVLVTNGALHDKLVEMI  406



>tpg|DAA63106.1| TPA: hypothetical protein ZEAMMB73_483520 [Zea mays]
Length=431

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR+I+P GG LVTN +LH  ++ MI
Sbjct  373  VGVICVQEAGGQTSDWSGEPLDLAADLTSRRIIYPRGGVLVTNGALHDKLVEMI  426



>ref|XP_003562924.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial isoform 
X1 [Brachypodium distachyon]
Length=424

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGV+C+ EAGG+ SDW G  +DF+ D   RR+I+P GG LVTN +LH  ++ MI
Sbjct  366  VGVVCVQEAGGQISDWSGKPLDFSADLTGRRIIYPWGGVLVTNGALHDQLVEMI  419



>tpg|DAA63105.1| TPA: hypothetical protein ZEAMMB73_483520 [Zea mays]
Length=327

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR+I+P GG LVTN +LH  ++ MI
Sbjct  269  VGVICVQEAGGQTSDWSGEPLDLAADLTSRRIIYPRGGVLVTNGALHDKLVEMI  322



>gb|EEC82264.1| hypothetical protein OsI_26461 [Oryza sativa Indica Group]
Length=369

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR I+PSGG LVTN +LH  ++ MI
Sbjct  311  VGVICVQEAGGQISDWSGKPLDLAADLTGRRDIYPSGGVLVTNGALHGKLVEMI  364



>ref|NP_001059973.1| Os07g0558200 [Oryza sativa Japonica Group]
 dbj|BAC84031.1| putative 3(2),5-bisphosphate nucleotidase [Oryza sativa Japonica 
Group]
 dbj|BAF21887.1| Os07g0558200 [Oryza sativa Japonica Group]
Length=431

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR I+PSGG LVTN +LH  ++ MI
Sbjct  373  VGVICVQEAGGQISDWSGKPLDLAADLTGRRDIYPSGGVLVTNGALHGKLVEMI  426



>gb|EAZ40277.1| hypothetical protein OsJ_24719 [Oryza sativa Japonica Group]
Length=431

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR I+PSGG LVTN +LH  ++ MI
Sbjct  373  VGVICVQEAGGQISDWSGKPLDLAADLTGRRDIYPSGGVLVTNGALHGKLVEMI  426



>ref|XP_007148252.1| hypothetical protein PHAVU_006G192800g [Phaseolus vulgaris]
 gb|ESW20246.1| hypothetical protein PHAVU_006G192800g [Phaseolus vulgaris]
Length=429

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  337  GVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            G+IC+HEAGGK +DW G++ID A D   RR+I+PS G L TN  +H  +L +I
Sbjct  371  GLICVHEAGGKVTDWNGSEIDLAADVDGRRIIYPSDGILATNGLIHNQVLQII  423



>ref|XP_006658689.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Oryza brachyantha]
Length=400

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ SDW G  +D A D   RR I+PSGG LVTN +LH  ++ MI
Sbjct  342  VGVICVQEAGGQISDWTGKPLDLAADLTGRRDIYPSGGVLVTNGALHGKLVEMI  395



>gb|EMT21653.1| Putative PAP-specific phosphatase, mitochondrial [Aegilops tauschii]
Length=424

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+ EAGG+ SDW G  +D A D   RR+++PSGG LVTN +LH  ++ +I
Sbjct  366  VGMICVQEAGGQISDWSGEPLDLAADLTGRRILYPSGGVLVTNGALHDKLVELI  419



>dbj|BAJ91398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+  DW G  +DF  D   RR+I+PSGG L TN +LH  +  M+
Sbjct  160  VGVICVEEAGGQTCDWSGKPLDFGADLTGRRIIYPSGGVLATNGALHDKLAEMV  213



>gb|EMT02076.1| Putative PAP-specific phosphatase, mitochondrial [Aegilops tauschii]
Length=448

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+  DW G  +DF  D   RR+I+PSGG L TN +LH  ++ M+
Sbjct  390  VGVICVEEAGGQTCDWSGKPLDFGADLTGRRIIYPSGGVLATNGALHDKLVEMV  443



>dbj|BAJ88879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+  DW G  +DF  D   RR+I+PSGG L TN +LH  +  M+
Sbjct  372  VGVICVEEAGGQTCDWSGKPLDFGADLTGRRIIYPSGGVLATNGALHDKLAEMV  425



>ref|XP_006657828.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial-like 
[Oryza brachyantha]
Length=437

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ +DWRG  +D   D   RR I+P GG L+TN  LH ++L +I
Sbjct  379  VGVICVQEAGGQITDWRGEPLDLEADLTGRRDIYPYGGILITNGVLHSNLLELI  432



>gb|EMS61731.1| Putative PAP-specific phosphatase, mitochondrial [Triticum urartu]
Length=318

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VG+IC+ EAGG+ SDW G  +D A D   RR+++PSGG LVTN ++H +++ +I
Sbjct  260  VGMICVQEAGGQISDWSGKPLDLAADLTGRRILYPSGGVLVTNGAVHDELVELI  313



>gb|EMS56114.1| Putative PAP-specific phosphatase, mitochondrial [Triticum urartu]
Length=363

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+  DW G  +DF  D    R+I+PSGG L TN +LH  ++ M+
Sbjct  300  VGVICVEEAGGQTCDWSGKPLDFGADLTGHRIIYPSGGVLATNGALHDKLVEMV  353



>gb|EEC82265.1| hypothetical protein OsI_26462 [Oryza sativa Indica Group]
Length=434

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ +DWRG  +D   D   RR I+P GG L+TN  LH  +  +I
Sbjct  377  VGVICVQEAGGQVTDWRGEPLDLEADLTGRRDIYPHGGILITNGVLHNKLAELI  430



>ref|NP_001059974.1| Os07g0558300 [Oryza sativa Japonica Group]
 dbj|BAF21888.1| Os07g0558300 [Oryza sativa Japonica Group]
 dbj|BAH00096.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67404.1| hypothetical protein OsJ_24720 [Oryza sativa Japonica Group]
Length=434

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            VGVIC+ EAGG+ +DWRG  +D   D   RR I+P GG L+TN  LH  +  +I
Sbjct  377  VGVICVQEAGGQVTDWRGEPLDLEADLTGRRDIYPHGGILITNGVLHNKLAELI  430



>ref|XP_009592888.1| PREDICTED: uncharacterized protein LOC104089648 [Nicotiana tomentosiformis]
Length=216

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  301  SDWRGNDIDFAEDEXERRLIFPSGGXLVTNQSLHKDILGMI  179
            +DW G  +D A D+ ERRLIFPSG  LVTN SLH  I+ +I
Sbjct  169  TDWAGGSLDIAADQTERRLIFPSGSVLVTNGSLHSKIIELI  209



>ref|XP_009412947.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=468

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSG  230
            VGVICI EAGGK +DW G ++D A DE  RR+I+PSG
Sbjct  431  VGVICIQEAGGKVTDWIGTELDLAADEAGRRIIYPSG  467



>gb|ADE76034.1| unknown [Picea sitchensis]
Length=413

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLIFPSGGX-LVTNQSLHKDILGMI  179
            VG+IC+ EAGG+ + W G+++  A D   RR I P GG  LVTN +LH  +L MI
Sbjct  359  VGMICVSEAGGEVTGWDGSEMFLASDGVGRRSITPGGGGILVTNGTLHNHLLDMI  413



>gb|EPS68945.1| hypothetical protein M569_05822, partial [Genlisea aurea]
Length=177

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXE-RRLIFPSGGXLVTNQSLHKD  194
            VG+IC+ EAGGK SDW+G +++ + DE   RR + P GG LV+N ++  D
Sbjct  120  VGLICVREAGGKVSDWKGGEVELSGDEVVGRRELHPWGGILVSNGTILHD  169



>ref|XP_010468220.1| PREDICTED: putative PAP-specific phosphatase, mitochondrial, 
partial [Camelina sativa]
Length=278

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  340  VGVICIHEAGGKXSDWRGNDIDFAEDEXERRLI  242
            VG+IC+HEAGGK +DW G++I+  ED+ ERR+I
Sbjct  246  VGMICVHEAGGKVTDWEGDEINLEEDQSERRII  278



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 558646673120