BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006P13

Length=260
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAL07977.1|  aquaporin                                            49.3    8e-06   Platanus x hispanica [London plane tree]
dbj|BAF32042.1|  putative aquaporin                                   50.4    2e-05   Cryptomeria japonica
dbj|BAF32141.1|  putative aquaporin                                   50.4    2e-05   Taxodium distichum [bald cypress]
emb|CAA04654.1|  major intrinsic protein PIPC                         49.3    3e-05   Craterostigma plantagineum
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg              49.7    5e-05   Erythranthe guttata [common monkey flower]
gb|ABE68718.1|  putative aquaporin                                    47.4    6e-05   Arachis hypogaea [goober]
gb|ACX37448.1|  plasma membrane intrinsic protein                     46.2    1e-04   Hevea brasiliensis [jebe]
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...  47.8    2e-04   Mesembryanthemum crystallinum
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein               48.1    2e-04   Gossypium arboreum [tree cotton]
gb|ACU87555.1|  PIP protein                                           48.1    2e-04   Gossypium hirsutum [American cotton]
gb|ACU87556.1|  PIP protein                                           48.1    2e-04   Gossypium hirsutum [American cotton]
gb|KJB12139.1|  hypothetical protein B456_002G002500                  48.1    2e-04   Gossypium raimondii
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                 48.1    2e-04   Nelumbo nucifera [Indian lotus]
gb|ABC70536.1|  aquaporin protein                                     46.2    2e-04   Vitis pseudoreticulata
gb|AFQ23181.1|  aquaporin PIP2;2                                      47.8    2e-04   Hedychium coronarium
gb|AAB18228.1|  MipE                                                  47.8    2e-04   Mesembryanthemum crystallinum
ref|XP_002322877.1|  major intrinsic protein 1                        47.8    3e-04   Populus trichocarpa [western balsam poplar]
gb|AEY75242.1|  plasma membrane intrinsic protein                     47.8    3e-04   Malus hupehensis
gb|KJB15837.1|  hypothetical protein B456_002G198900                  47.0    3e-04   Gossypium raimondii
emb|CAC82712.1|  major intrinsic protein 1                            47.4    3e-04   Populus tremula x Populus tremuloides
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                47.4    3e-04   Gossypium hirsutum [American cotton]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5             47.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2  47.4    3e-04   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1  47.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5             47.4    3e-04   Malus domestica [apple tree]
gb|ACB42440.1|  aquaporin PIP2;3                                      47.0    4e-04   Gossypium hirsutum [American cotton]
gb|ACB42441.1|  aquaporin PIP2;4                                      47.0    4e-04   Gossypium hirsutum [American cotton]
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg           47.0    5e-04   Capsella rubella
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270        47.0    5e-04   Amborella trichopoda
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                      47.0    5e-04   Camelina sativa [gold-of-pleasure]
gb|ABM54183.1|  aquaporin                                             46.6    5e-04   Jatropha curcas
gb|KDP29110.1|  hypothetical protein JCGZ_16499                       47.0    5e-04   Jatropha curcas
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921  47.8    5e-04   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                 46.6    5e-04   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                   46.6    6e-04   Vitis cinerea var. helleri x Vitis rupestris
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2      46.6    6e-04   Solanum chacoense
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                 45.8    6e-04   Citrus sinensis [apfelsine]
emb|CBI37861.3|  unnamed protein product                              45.8    6e-04   Vitis vinifera
gb|EAY92738.1|  hypothetical protein OsI_14490                        44.7    7e-04   Oryza sativa Indica Group [Indian rice]
ref|NP_001233846.1|  putative PIP-type aquaporin                      46.2    8e-04   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like        46.2    8e-04   Cicer arietinum [garbanzo]
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                      46.2    8e-04   Fragaria vesca subsp. vesca
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                 46.2    8e-04   Solanum lycopersicum
gb|EPS67791.1|  hypothetical protein M569_06982                       45.1    8e-04   Genlisea aurea
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8             46.2    8e-04   Nelumbo nucifera [Indian lotus]
dbj|BAF63508.1|  plasma membrane intrinsic protein                    46.2    8e-04   Potamogeton distinctus
gb|KJB32662.1|  hypothetical protein B456_005G254400                  46.2    9e-04   Gossypium raimondii
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                       46.2    9e-04   Helianthemum almeriense
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                 46.2    0.001   Nicotiana sylvestris
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6             46.2    0.001   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003625627.1|  Aquaporin PIP2-1                                 46.2    0.001   Medicago truncatula
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type              45.8    0.001   Atriplex canescens [shadscale]
gb|AEF32110.1|  aquaporin PIP2                                        45.8    0.001   Hedychium coronarium
gb|KDP44363.1|  hypothetical protein JCGZ_20043                       45.8    0.001   Jatropha curcas
gb|AAL49751.1|AF452013_1  aquaporin-like protein                      45.8    0.001   Petunia x hybrida [garden petunia]
gb|AEY75254.1|  aquaporin                                             45.8    0.001   Atriplex canescens [shadscale]
gb|ACB87734.1|  aquaporin                                             45.8    0.001   Manihot esculenta [manioc]



>emb|CAL07977.1| aquaporin [Platanus x acerifolia]
Length=63

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S PN
Sbjct  29   VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPN  62



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin, partial [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP LGA A A YHQ +LRA A+KAL GSF+S PNV
Sbjct  241  VGPFLGAFAAAFYHQYILRAAAIKAL-GSFRSNPNV  275



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP LGA A A YHQ +LRA A+KAL GSF+S PNV
Sbjct  240  VGPFLGAFAAAFYHQYILRAAAIKAL-GSFRSNPNV  274



>emb|CAA04654.1| major intrinsic protein PIPC [Craterostigma plantagineum]
Length=198

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTP  159
            VGP LGA+A A+YHQ +LRAQA KAL GSF+S P
Sbjct  164  VGPFLGALAAAIYHQYILRAQAAKAL-GSFRSNP  196



>gb|EYU37965.1| hypothetical protein MIMGU_mgv1a011471mg [Erythranthe guttata]
Length=280

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM GAIA A+YHQ VLRA A+KAL GSF+S P 
Sbjct  246  VGPMAGAIAAAIYHQFVLRAGAIKAL-GSFRSNPT  279



>gb|ABE68718.1| putative aquaporin [Arachis hypogaea]
Length=85

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA AVKAL GSF+S PNV
Sbjct  51   VGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSDPNV  85



>gb|ACX37448.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=75

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA AVKAL GSF+ST N+
Sbjct  41   VGPFIGAAIAAFYHQYILRAAAVKAL-GSFRSTSNI  75



>gb|AAA68701.1| similar to mipB gene product in Mesembryanthemum crystallinum, 
encoded by Genbank Accession Number L36097; MIP homolog; Method: 
conceptual translation supplied by author, partial [Mesembryanthemum 
crystallinum]
Length=252

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  218  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  251



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  244  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  244  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  244  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>gb|KJB12139.1| hypothetical protein B456_002G002500 [Gossypium raimondii]
Length=278

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  244  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  277



>ref|XP_010266027.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=280

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S PN
Sbjct  246  VGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPN  279



>gb|ABC70536.1| aquaporin protein [Vitis pseudoreticulata]
Length=159

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA A+KAL GSF+STP V
Sbjct  125  VGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSTPRV  159



>gb|AFQ23181.1| aquaporin PIP2;2 [Hedychium coronarium]
Length=282

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA+A AVYHQ VLRA A+KAL GSF+ST ++
Sbjct  248  VGPFVGALAAAVYHQFVLRATAIKAL-GSFRSTHSI  282



>gb|AAB18228.1| MipE [Mesembryanthemum crystallinum]
Length=284

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGPM+GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  250  VGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  283



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVK+L GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQFILRAAAVKSL-GSFRSSPNI  285



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA AVKAL GSF+S PNV
Sbjct  253  VGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPNV  287



>gb|KJB15837.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=211

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A+YHQ +LRA A+KAL GSF+S P 
Sbjct  177  VGPFVGALAAAIYHQYILRAAAIKAL-GSFRSNPT  210



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVK+L GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQFILRAAAVKSL-GSFRSSPNI  285



>tpg|DAA33864.1| TPA_inf: aquaporin PIP2;4 [Gossypium hirsutum]
Length=270

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A+YHQ +LRA A+KAL GSF+S P 
Sbjct  236  VGPFVGALAAAIYHQYILRATAIKAL-GSFRSNPT  269



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVKAL GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPNI  285



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVKAL GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPNI  285



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVKAL GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPNI  285



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVKAL GSF+S+PN+
Sbjct  251  VGPFIGAAIAALYHQYILRAGAVKAL-GSFRSSPNI  285



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
 gb|KJB15834.1| hypothetical protein B456_002G198900 [Gossypium raimondii]
Length=278

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A+YHQ +LRA A+KAL GSF+S P 
Sbjct  244  VGPFVGALAAAIYHQYILRAAAIKAL-GSFRSNPT  277



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A+YHQ +LRA A+KAL GSF+S P 
Sbjct  244  VGPFVGALAAAIYHQYILRAAAIKAL-GSFRSNPT  277



>ref|XP_006284279.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
 gb|EOA17177.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
Length=280

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGP LGA+A A+YHQ VLRA A+KAL GSF+S 
Sbjct  246  VGPFLGALAAAIYHQFVLRASAIKAL-GSFRSN  277



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA A+KAL GSF+S PNV
Sbjct  249  VGPFIGAAIAAAYHQYILRAAAIKAL-GSFRSNPNV  283



>ref|XP_010432340.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
 ref|XP_010437523.1| PREDICTED: aquaporin PIP2-7 isoform X1 [Camelina sativa]
 ref|XP_010437524.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010437525.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010446981.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
Length=280

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGP LGA+A A+YHQ VLRA A+KAL GSF+S 
Sbjct  246  VGPFLGALAAAIYHQFVLRASAIKAL-GSFRSN  277



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GAIA A YHQ +LRA A+KAL GSF+S P 
Sbjct  246  VGPFVGAIAAAAYHQYILRAAAIKAL-GSFRSNPT  279



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ +LRA AVKAL GSF+ST NV
Sbjct  250  VGPFIGAAIAAIYHQYILRAGAVKAL-GSFRSTSNV  284



>ref|XP_011088776.1| PREDICTED: uncharacterized protein LOC105169921 [Sesamum indicum]
Length=754

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A AVYHQ +LRA A+KAL GSF+S P 
Sbjct  720  VGPFVGALAAAVYHQYILRAAAIKAL-GSFRSNPT  753



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGPM+GA+A A+YHQ VLRA AVKAL GSF+S 
Sbjct  249  VGPMVGAMAAAIYHQFVLRAGAVKAL-GSFRSN  280



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A YHQ +LRA A+KAL GSF+STP V
Sbjct  250  VGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSTPRV  284



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGPM+GA+A A+YHQ VLRA AVKAL GSF+S 
Sbjct  249  VGPMVGAMAAAIYHQFVLRAGAVKAL-GSFRSN  280



>gb|KDO68093.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=212

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  178  VGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPS  211



>emb|CBI37861.3| unnamed protein product [Vitis vinifera]
Length=198

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  164  VGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  197



>gb|EAY92738.1| hypothetical protein OsI_14490 [Oryza sativa Indica Group]
Length=141

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 1/34 (3%)
 Frame = -1

Query  257  GPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            GP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  108  GPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  140



>ref|NP_001233846.1| putative PIP-type aquaporin [Solanum lycopersicum]
 gb|ADP23920.1| putative PIP-type aquaporin [Solanum lycopersicum]
Length=283

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGPM+GA+A A+YHQ +LRA AVKAL GSF+S 
Sbjct  249  VGPMVGAMAAAIYHQFILRAGAVKAL-GSFRSN  280



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ VLRAQA KAL GSF+S+ N+
Sbjct  253  VGPFIGAAIAAIYHQFVLRAQAAKAL-GSFKSSSNL  287



>ref|XP_004290727.1| PREDICTED: aquaporin PIP2-7 [Fragaria vesca subsp. vesca]
Length=281

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  247  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  280



>dbj|BAO18631.1| plasmamembrane intrinsic protein 2;9 [Solanum lycopersicum]
Length=283

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQST  162
            VGPM+GA+A A+YHQ +LRA AVKAL GSF+S 
Sbjct  249  VGPMVGAMAAAIYHQFILRAGAVKAL-GSFRSN  280



>gb|EPS67791.1| hypothetical protein M569_06982, partial [Genlisea aurea]
Length=182

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQS  165
            VGP++GA+A A+YHQ VLRA A+KAL GSF+S
Sbjct  152  VGPLIGALAAAIYHQFVLRAGAIKAL-GSFRS  182



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  246  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  279



>dbj|BAF63508.1| plasma membrane intrinsic protein [Potamogeton distinctus]
Length=280

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  246  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPH  279



>gb|KJB32662.1| hypothetical protein B456_005G254400 [Gossypium raimondii]
Length=278

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  244  VGPFVGAVAAAAYHQYILRAAAIKAL-GSFRSNPT  277



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  245  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPT  278



>ref|XP_009803627.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64681.1| TPA_exp: aquaporin PIP2 6b [Nicotiana tabacum]
Length=283

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+  A+YHQ VLRA AVKAL GSF+S P 
Sbjct  249  VGPFVGALIAAIYHQFVLRAGAVKAL-GSFRSNPT  282



>ref|XP_009412922.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct  248  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS  281



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP +GA   A+YHQ VLRAQA KAL GSF+S+ N+
Sbjct  253  VGPFIGAAIAAIYHQFVLRAQAAKAL-GSFRSSSNL  287



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ VLRA A+KAL GSF+S P 
Sbjct  248  VGPFVGALAAAAYHQYVLRAAAIKAL-GSFRSNPT  281



>gb|AEF32110.1| aquaporin PIP2 [Hedychium coronarium]
Length=282

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP++GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  248  VGPLVGALAAAAYHQYILRAAAIKAL-GSFRSNPT  281



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 1/36 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPNV  153
            VGP LGA   A YHQ +LRA AVKAL GSF+S P V
Sbjct  251  VGPFLGAAIAAFYHQFILRAGAVKAL-GSFRSNPTV  285



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+  A+YHQ VLRA AVKAL GSF+S P 
Sbjct  222  VGPFIGALIAALYHQFVLRAGAVKAL-GSFRSNPT  255



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ VLRA A+KAL GSF+S P 
Sbjct  248  VGPFVGALAAAAYHQYVLRAAAIKAL-GSFRSNPT  281



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = -1

Query  260  VGPMLGAIAGAVYHQLVLRAQAVKALGGSFQSTPN  156
            VGP +GA+A A YHQ +LRA A+KAL GSF+S P 
Sbjct  246  VGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPT  279



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571209109800