BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006M04

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792144.1|  PREDICTED: porphobilinogen deaminase, chloro...    129   3e-33   Nicotiana sylvestris
ref|XP_009610066.1|  PREDICTED: porphobilinogen deaminase, chloro...    128   8e-33   Nicotiana tomentosiformis
ref|XP_009767215.1|  PREDICTED: porphobilinogen deaminase, chloro...    128   8e-33   Nicotiana sylvestris
ref|XP_009602647.1|  PREDICTED: porphobilinogen deaminase, chloro...    127   1e-32   Nicotiana tomentosiformis
ref|XP_004243981.1|  PREDICTED: porphobilinogen deaminase, chloro...    125   5e-32   Solanum lycopersicum
ref|XP_006346038.1|  PREDICTED: porphobilinogen deaminase, chloro...    125   6e-32   Solanum tuberosum [potatoes]
ref|XP_002520359.1|  porphobilinogen deaminase, putative                124   2e-31   Ricinus communis
ref|XP_011022037.1|  PREDICTED: porphobilinogen deaminase, chloro...    119   2e-29   Populus euphratica
ref|XP_010046969.1|  PREDICTED: porphobilinogen deaminase, chloro...    118   3e-29   Eucalyptus grandis [rose gum]
ref|XP_002310073.2|  hypothetical protein POPTR_0007s07680g             118   3e-29   
dbj|BAD94270.1|  hydroxymethylbilane synthase                           112   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KJB31849.1|  hypothetical protein B456_005G211000                    117   7e-29   Gossypium raimondii
ref|XP_011006773.1|  PREDICTED: porphobilinogen deaminase, chloro...    117   1e-28   Populus euphratica
ref|XP_008461840.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   2e-28   Cucumis melo [Oriental melon]
ref|XP_010452807.1|  PREDICTED: porphobilinogen deaminase, chloro...    110   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010647324.1|  PREDICTED: porphobilinogen deaminase, chloro...    115   5e-28   Vitis vinifera
emb|CDP13602.1|  unnamed protein product                                115   5e-28   Coffea canephora [robusta coffee]
gb|KGN58555.1|  hypothetical protein Csa_3G682170                       114   5e-28   Cucumis sativus [cucumbers]
ref|XP_009125721.1|  PREDICTED: porphobilinogen deaminase, chloro...    115   6e-28   Brassica rapa
ref|XP_009131051.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   6e-28   
ref|NP_196445.1|  Porphobilinogen deaminase                             114   7e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361909.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   7e-28   Malus domestica [apple tree]
gb|AAM64573.1|  hydroxymethylbilane synthase                            114   8e-28   Arabidopsis thaliana [mouse-ear cress]
pdb|4HTG|A  Chain A, Porphobilinogen Deaminase From Arabidopsis T...    114   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873350.1|  hypothetical protein ARALYDRAFT_908776             114   8e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_004149732.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   8e-28   Cucumis sativus [cucumbers]
ref|XP_009351734.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   9e-28   Pyrus x bretschneideri [bai li]
emb|CDX81090.1|  BnaC03g03440D                                          114   1e-27   
ref|XP_006287933.1|  hypothetical protein CARUB_v10001168mg             114   1e-27   Capsella rubella
emb|CBI18797.3|  unnamed protein product                                113   1e-27   Vitis vinifera
ref|XP_010423118.1|  PREDICTED: porphobilinogen deaminase, chloro...    114   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDY44763.1|  BnaC02g01240D                                          114   1e-27   Brassica napus [oilseed rape]
gb|KJB77369.1|  hypothetical protein B456_012G134300                    113   2e-27   Gossypium raimondii
emb|CDX78330.1|  BnaA03g02420D                                          113   2e-27   
ref|XP_006437594.1|  hypothetical protein CICLE_v10031858mg             113   3e-27   Citrus clementina [clementine]
ref|XP_010547710.1|  PREDICTED: LOW QUALITY PROTEIN: porphobilino...    112   3e-27   Tarenaya hassleriana [spider flower]
emb|CDX69959.1|  BnaA10g23080D                                          112   4e-27   
ref|XP_009122439.1|  PREDICTED: porphobilinogen deaminase, chloro...    112   4e-27   Brassica rapa
ref|XP_010491454.1|  PREDICTED: porphobilinogen deaminase, chloro...    112   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004172759.1|  PREDICTED: porphobilinogen deaminase, chloro...    112   4e-27   
ref|XP_010112535.1|  Porphobilinogen deaminase                          112   5e-27   Morus notabilis
ref|XP_007225744.1|  hypothetical protein PRUPE_ppa007124mg             112   6e-27   Prunus persica
emb|CDY21529.1|  BnaC09g47630D                                          112   6e-27   Brassica napus [oilseed rape]
emb|CDY40758.1|  BnaAnng06210D                                          112   7e-27   Brassica napus [oilseed rape]
ref|XP_006399317.1|  hypothetical protein EUTSA_v10013814mg             111   8e-27   Eutrema salsugineum [saltwater cress]
ref|NP_001240888.1|  uncharacterized protein LOC100779132               111   1e-26   Glycine max [soybeans]
ref|XP_002306378.2|  hypothetical protein POPTR_0005s09400g             110   2e-26   
ref|XP_004505653.1|  PREDICTED: porphobilinogen deaminase, chloro...    109   4e-26   Cicer arietinum [garbanzo]
ref|XP_010522127.1|  PREDICTED: porphobilinogen deaminase, chloro...    109   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_007156992.1|  hypothetical protein PHAVU_002G034500g             108   7e-26   Phaseolus vulgaris [French bean]
ref|XP_010941629.1|  PREDICTED: porphobilinogen deaminase, chloro...    108   8e-26   Elaeis guineensis
ref|XP_007043280.1|  Hydroxymethylbilane synthase isoform 2             107   1e-25   
gb|KHG03036.1|  Porphobilinogen deaminase, chloroplastic                108   1e-25   Gossypium arboreum [tree cotton]
ref|XP_004297733.1|  PREDICTED: porphobilinogen deaminase, chloro...    108   1e-25   Fragaria vesca subsp. vesca
ref|XP_008793590.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   1e-25   Phoenix dactylifera
gb|KDP37560.1|  hypothetical protein JCGZ_05999                         108   1e-25   Jatropha curcas
ref|XP_003607332.1|  Porphobilinogen deaminase                          106   2e-25   
ref|XP_008221067.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   2e-25   Prunus mume [ume]
ref|XP_007043279.1|  Hydroxymethylbilane synthase isoform 1             107   2e-25   
ref|XP_011097642.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   2e-25   Sesamum indicum [beniseed]
ref|XP_008793588.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   3e-25   Phoenix dactylifera
ref|XP_008793587.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   3e-25   Phoenix dactylifera
ref|XP_008793589.1|  PREDICTED: porphobilinogen deaminase, chloro...    107   3e-25   
ref|NP_001242644.1|  uncharacterized protein LOC100812733               107   4e-25   
gb|KHN20627.1|  Porphobilinogen deaminase, chloroplastic                107   4e-25   Glycine soja [wild soybean]
ref|XP_003607331.1|  Porphobilinogen deaminase                          107   4e-25   Medicago truncatula
ref|XP_003537739.1|  PREDICTED: porphobilinogen deaminase, chloro...    105   8e-25   Glycine max [soybeans]
ref|XP_006853343.1|  hypothetical protein AMTR_s00032p00091590          106   1e-24   
gb|EYU27543.1|  hypothetical protein MIMGU_mgv1a008527mg                105   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_008813288.1|  PREDICTED: porphobilinogen deaminase, chloro...    104   2e-24   Phoenix dactylifera
ref|XP_008813290.1|  PREDICTED: porphobilinogen deaminase, chloro...    103   3e-24   Phoenix dactylifera
ref|XP_010927101.1|  PREDICTED: LOW QUALITY PROTEIN: porphobilino...    104   3e-24   
sp|Q43082.1|HEM3_PEA  RecName: Full=Porphobilinogen deaminase, ch...    104   3e-24   Pisum sativum [garden pea]
gb|ACU17610.1|  unknown                                                 103   4e-24   Glycine max [soybeans]
ref|XP_009414508.1|  PREDICTED: porphobilinogen deaminase, chloro...    103   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007133420.1|  hypothetical protein PHAVU_011G1771000g            102   1e-23   Phaseolus vulgaris [French bean]
ref|XP_010670537.1|  PREDICTED: porphobilinogen deaminase, chloro...    102   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004306458.1|  PREDICTED: porphobilinogen deaminase, chloro...    102   2e-23   Fragaria vesca subsp. vesca
gb|EPS63046.1|  hypothetical protein M569_11740                         102   2e-23   Genlisea aurea
gb|ABB03720.1|  putative porphobilinogen deaminase                    96.3    5e-23   Sorghum bicolor [broomcorn]
gb|EYU33770.1|  hypothetical protein MIMGU_mgv1a008233mg                100   6e-23   Erythranthe guttata [common monkey flower]
gb|AFW66381.1|  hypothetical protein ZEAMMB73_808224                  97.1    6e-23   
gb|ABK26871.1|  unknown                                                 100   9e-23   Picea sitchensis
gb|ABR17705.1|  unknown                                                 100   1e-22   Picea sitchensis
ref|XP_004951778.1|  PREDICTED: porphobilinogen deaminase, chloro...  98.6    4e-22   Setaria italica
gb|AFW70271.1|  camouflage1                                           98.6    4e-22   
ref|XP_008677338.1|  PREDICTED: LOC100284619 isoform X1               98.2    4e-22   Zea mays [maize]
ref|XP_010276153.1|  PREDICTED: porphobilinogen deaminase, chloro...  97.4    7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010276152.1|  PREDICTED: porphobilinogen deaminase, chloro...  97.4    9e-22   Nelumbo nucifera [Indian lotus]
gb|ABF70028.1|  porphobilinogen deaminase, chloroplast (hydroxyme...  97.8    1e-21   Musa acuminata [banana]
ref|XP_002451614.1|  hypothetical protein SORBIDRAFT_04g004640        97.1    1e-21   
ref|XP_008677339.1|  PREDICTED: LOC100284619 isoform X2               96.7    1e-21   Zea mays [maize]
ref|XP_008680937.1|  PREDICTED: uncharacterized protein LOC100191...  96.7    2e-21   
gb|AFW66382.1|  porphobilinogen deaminase                             96.7    2e-21   
ref|XP_002451613.1|  hypothetical protein SORBIDRAFT_04g004630        96.7    2e-21   Sorghum bicolor [broomcorn]
gb|ABF70029.1|  porphobilinogen deaminase, chloroplast (hydroxyme...  95.1    5e-21   Musa acuminata [banana]
ref|NP_001150986.1|  LOC100284619                                     94.4    1e-20   Zea mays [maize]
gb|EMT29771.1|  Porphobilinogen deaminase, chloroplastic              93.6    2e-20   
dbj|BAD25718.1|  putative porphobilinogen deaminase                   92.8    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046017.1|  Os02g0168800                                     93.2    3e-20   
ref|XP_003570067.1|  PREDICTED: porphobilinogen deaminase, chloro...  92.8    4e-20   Brachypodium distachyon [annual false brome]
gb|AAL12220.1|  porphobilinogen deaminase                             92.4    4e-20   Triticum aestivum [Canadian hard winter wheat]
gb|EEC72572.1|  hypothetical protein OsI_06012                        90.1    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006648352.1|  PREDICTED: porphobilinogen deaminase, chloro...  89.0    9e-19   
gb|KHN35094.1|  Porphobilinogen deaminase, chloroplastic              86.7    4e-18   Glycine soja [wild soybean]
emb|CDY05678.1|  BnaC02g38590D                                        82.8    5e-18   
ref|XP_001769569.1|  predicted protein                                87.0    5e-18   
ref|XP_002961888.1|  hypothetical protein SELMODRAFT_164683           86.7    6e-18   Selaginella moellendorffii
ref|XP_006591520.1|  PREDICTED: porphobilinogen deaminase, chloro...  85.9    7e-18   
ref|XP_002990245.1|  hypothetical protein SELMODRAFT_447969           85.1    2e-17   Selaginella moellendorffii
ref|XP_001780954.1|  predicted protein                                84.0    5e-17   
gb|ACJ83604.1|  unknown                                               83.2    5e-17   Medicago truncatula
ref|NP_001130048.1|  uncharacterized protein LOC100191140             84.3    7e-17   
emb|CDY25014.1|  BnaC02g39940D                                        82.4    3e-16   Brassica napus [oilseed rape]
ref|XP_001781636.1|  predicted protein                                82.4    4e-16   
ref|XP_005649123.1|  porphobilinogen deaminase                        79.7    3e-15   Coccomyxa subellipsoidea C-169
gb|KIZ01397.1|  hypothetical protein MNEG_6565                        79.0    7e-15   Monoraphidium neglectum
ref|XP_002950840.1|  hypothetical protein VOLCADRAFT_85406            72.4    1e-12   Volvox carteri f. nagariensis
ref|XP_011396337.1|  Porphobilinogen deaminase, chloroplastic         72.0    2e-12   Auxenochlorella protothecoides
ref|XP_001701485.1|  porphobilinogen deaminase                        71.6    2e-12   Chlamydomonas reinhardtii
emb|CCQ75376.1|  Porphobilinogen deaminase                            70.9    3e-12   Magnetospira sp. QH-2
ref|XP_002507564.1|  hydroxymethylbilane synthase                     66.2    2e-10   Micromonas commoda
ref|XP_007509251.1|  porphobilinogen deaminase                        66.2    2e-10   Bathycoccus prasinos
gb|AEN75260.1|  porphobilinogen deaminase                             63.2    6e-10   Chromerida sp. RM11
ref|WP_024351921.1|  porphobilinogen deaminase                        64.3    7e-10   Aurantimonas coralicida
ref|XP_005843555.1|  hypothetical protein CHLNCDRAFT_33052            64.3    1e-09   Chlorella variabilis
ref|WP_008616862.1|  porphobilinogen deaminase                        63.2    2e-09   Magnetospirillum caucaseum
gb|EWM30321.1|  porphobilinogen deaminase                             63.5    2e-09   Nannochloropsis gaditana
ref|WP_009869955.1|  COG0181: Porphobilinogen deaminase               62.8    2e-09   Magnetospirillum magnetotacticum
ref|WP_009211454.1|  porphobilinogen deaminase                        62.4    3e-09   Aurantimonas manganoxydans
dbj|BAE53224.1|  Porphobilinogen deaminase                            61.6    3e-09   Magnetospirillum magneticum AMB-1
ref|WP_014415752.1|  porphobilinogen deaminase                        62.4    4e-09   Pararhodospirillum photometricum
ref|XP_003056550.1|  porphobilinogen deaminase, chloroplast precu...  62.8    4e-09   Micromonas pusilla CCMP1545
ref|WP_043745666.1|  porphobilinogen deaminase                        62.0    5e-09   Magnetospirillum magneticum
gb|KAI96092.1|  porphobilinogen deaminase                             61.6    6e-09   Rhodomicrobium udaipurense JA643
ref|WP_037233090.1|  porphobilinogen deaminase                        61.6    6e-09   Rhodomicrobium udaipurense
ref|WP_013419820.1|  porphobilinogen deaminase                        61.6    6e-09   Rhodomicrobium vannielii
ref|XP_010456444.1|  PREDICTED: porphobilinogen deaminase, chloro...  60.8    1e-08   
ref|WP_011391315.1|  porphobilinogen deaminase                        60.1    2e-08   Rhodospirillum rubrum
ref|WP_021132426.1|  porphobilinogen deaminase                        60.1    2e-08   Phaeospirillum fulvum
gb|ABD51930.1|  chloroplast hydroxymethylbilane synthase              59.7    4e-08   Guillardia theta
ref|XP_005704560.1|  hydroxymethylbilane synthase                     59.7    4e-08   Galdieria sulphuraria
ref|XP_005834478.1|  hypothetical protein GUITHDRAFT_162740           59.7    4e-08   Guillardia theta CCMP2712
ref|XP_001417948.1|  predicted protein                                58.9    6e-08   Ostreococcus lucimarinus CCE9901
ref|WP_020699129.1|  hypothetical protein                             58.5    7e-08   Reyranella massiliensis
ref|WP_024079153.1|  hydroxymethylbilane synthase                     58.5    8e-08   Magnetospirillum gryphiswaldense
emb|CEF97893.1|  Porphobilinogen deaminase, C-terminal                58.5    9e-08   Ostreococcus tauri
emb|CBJ30046.1|  hydroxymethylbilane synthase, putative chloropla...  58.5    1e-07   Ectocarpus siliculosus
ref|WP_002729267.1|  porphobilinogen deaminase                        58.2    1e-07   Phaeospirillum molischianum
ref|WP_026615491.1|  porphobilinogen deaminase                        57.8    1e-07   Ensifer aridi
ref|XP_003079219.1|  putative porphobilinogen deaminase (ISS)         58.2    2e-07   
ref|XP_002292986.1|  porphobilinogen deaminase                        57.8    2e-07   Thalassiosira pseudonana CCMP1335
ref|WP_036346454.1|  porphobilinogen deaminase                        57.4    2e-07   Microvirga sp. BSC39
ref|XP_005782931.1|  hypothetical protein EMIHUDRAFT_423968           57.4    3e-07   Emiliania huxleyi CCMP1516
ref|XP_005714552.1|  unnamed protein product                          54.3    4e-07   Chondrus crispus [carageen]
ref|WP_009539461.1|  Porphobilinogen deaminase                        56.6    4e-07   Caenispirillum salinarum
ref|WP_028957118.1|  porphobilinogen deaminase                        56.2    6e-07   Sulfitobacter sp. 20_GPM-1509m
ref|WP_027301693.1|  porphobilinogen deaminase                        55.8    6e-07   Rhodospirillales bacterium URHD0088
ref|WP_029349283.1|  porphobilinogen deaminase                        55.8    7e-07   Mesorhizobium ciceri
ref|WP_019404925.1|  hypothetical protein                             55.8    7e-07   Chelatococcus
gb|EEB86449.1|  porphobilinogen deaminase                             55.5    9e-07   Roseobacter sp. GAI101
ref|WP_029058080.1|  porphobilinogen deaminase                        55.5    9e-07   Stappia stellulata
ref|WP_037228429.1|  porphobilinogen deaminase                        55.5    1e-06   Roseobacter sp. GAI101
gb|EJK45103.1|  hypothetical protein THAOC_36301                      55.5    1e-06   Thalassiosira oceanica
ref|WP_012110243.1|  porphobilinogen deaminase                        55.1    1e-06   Parvibaculum lavamentivorans
ref|WP_029353509.1|  porphobilinogen deaminase                        55.1    2e-06   Bosea sp. 117
ref|WP_024923093.1|  MULTISPECIES: porphobilinogen deaminase          54.7    2e-06   Mesorhizobium
ref|WP_026620063.1|  porphobilinogen deaminase                        54.7    2e-06   Ensifer sp. WSM1721
ref|WP_037451402.1|  porphobilinogen deaminase                        54.7    2e-06   
ref|WP_008873487.1|  hydroxymethylbilane synthase                     54.3    2e-06   Mesorhizobium metallidurans
ref|WP_022708022.1|  porphobilinogen deaminase                        54.3    3e-06   Paracoccus zeaxanthinifaciens
ref|WP_028737157.1|  porphobilinogen deaminase                        53.9    3e-06   Rhizobium
ref|WP_023760927.1|  porphobilinogen deaminase                        53.9    3e-06   Mesorhizobium sp. LNHC252B00
ref|WP_036485948.1|  porphobilinogen deaminase                        53.9    4e-06   Nitratireductor basaltis
ref|WP_039188124.1|  porphobilinogen deaminase                        53.5    4e-06   Aureimonas altamirensis
ref|WP_007067943.1|  porphobilinogen deaminase                        53.5    4e-06   Fulvimarina pelagi
gb|EMS48955.1|  Porphobilinogen deaminase, chloroplastic              53.1    5e-06   Triticum urartu
ref|WP_037927918.1|  porphobilinogen deaminase                        53.1    7e-06   Sulfitobacter pseudonitzschiae
ref|WP_005850014.1|  MULTISPECIES: porphobilinogen deaminase          52.8    7e-06   Sulfitobacter
ref|WP_039540721.1|  porphobilinogen deaminase                        52.8    8e-06   Ruegeria sp. ANG-R
ref|WP_009825369.1|  porphobilinogen deaminase                        52.8    8e-06   Sulfitobacter
ref|WP_042775898.1|  porphobilinogen deaminase                        52.8    9e-06   Sinorhizobium fredii
ref|WP_037393857.1|  porphobilinogen deaminase                        52.8    9e-06   Sinorhizobium fredii
ref|WP_037128273.1|  porphobilinogen deaminase                        52.4    1e-05   Rhizobium sp. CF097
ref|WP_037208367.1|  porphobilinogen deaminase                        52.4    1e-05   Rhizobium sp. YR295
ref|WP_013892312.1|  porphobilinogen deaminase                        52.0    1e-05   Mesorhizobium opportunistum
gb|EDQ35185.2|  porphobilinogen deaminase                             52.0    2e-05   Hoeflea phototrophica DFL-43
ref|WP_007199416.1|  porphobilinogen deaminase                        52.0    2e-05   Hoeflea phototrophica
ref|WP_028001771.1|  porphobilinogen deaminase                        52.0    2e-05   Sinorhizobium arboris
ref|WP_023784154.1|  porphobilinogen deaminase                        51.6    2e-05   Mesorhizobium sp. LNHC220B00
gb|ESR22575.1|  Porphobilinogen deaminase                             51.6    2e-05   Lutibaculum baratangense AMV1
ref|WP_044428213.1|  porphobilinogen deaminase                        51.6    2e-05   Skermanella aerolata
ref|WP_040486198.1|  porphobilinogen deaminase                        51.6    2e-05   
ref|WP_007008388.1|  porphobilinogen deaminase                        51.6    2e-05   Nitratireductor aquibiodomus
ref|WP_027316789.1|  porphobilinogen deaminase                        51.2    2e-05   Microvirga flocculans
ref|WP_041414721.1|  porphobilinogen deaminase                        51.2    3e-05   Sinorhizobium
ref|WP_043539256.1|  porphobilinogen deaminase                        51.2    3e-05   Salinarimonas rosea
gb|AFL54109.1|  porphobilinogen deaminase HemC                        51.2    3e-05   Sinorhizobium fredii USDA 257
ref|WP_020020570.1|  hypothetical protein                             51.2    3e-05   
ref|WP_006327152.1|  hydroxymethylbilane synthase                     51.2    3e-05   Mesorhizobium sp. STM 4661
ref|WP_029959243.1|  porphobilinogen deaminase                        51.2    3e-05   Ensifer sp. USDA 6670
ref|WP_018097313.1|  porphobilinogen deaminase                        51.2    3e-05   Sinorhizobium/Ensifer group
ref|WP_014330123.1|  porphobilinogen deaminase                        50.8    3e-05   Sinorhizobium fredii
ref|WP_037097330.1|  porphobilinogen deaminase                        50.8    3e-05   Rhizobium sp. OK665
ref|WP_037429512.1|  porphobilinogen deaminase                        50.8    4e-05   Sinorhizobium fredii
ref|WP_017265062.1|  porphobilinogen deaminase                        50.8    4e-05   
ref|WP_010970392.1|  porphobilinogen deaminase                        50.8    4e-05   Sinorhizobium meliloti
ref|WP_027042906.1|  porphobilinogen deaminase                        50.8    4e-05   Mesorhizobium sp. URHC0008
ref|WP_027992435.1|  porphobilinogen deaminase                        50.8    4e-05   Sinorhizobium meliloti
ref|WP_017275131.1|  porphobilinogen deaminase                        50.8    4e-05   
ref|WP_032932216.1|  porphobilinogen deaminase                        50.8    4e-05   Mesorhizobium
ref|WP_043767487.1|  porphobilinogen deaminase                        50.8    4e-05   Roseivivax isoporae
ref|WP_010912273.1|  porphobilinogen deaminase                        50.8    4e-05   Mesorhizobium japonicum
ref|WP_010657552.1|  porphobilinogen deaminase                        50.8    4e-05   Ochrobactrum
ref|WP_008384225.1|  porphobilinogen deaminase                        50.4    5e-05   Rhodovulum sp. PH10
ref|WP_018700087.1|  hypothetical protein                             50.4    5e-05   Amorphus coralli
gb|AEQ18820.1|  porphobilinogen deaminase                             50.8    5e-05   Chromera velia
ref|WP_036596440.1|  MULTISPECIES: porphobilinogen deaminase          50.4    5e-05   Ochrobactrum
ref|WP_003611366.1|  porphobilinogen deaminase                        50.4    5e-05   Methylosinus
ref|WP_011567549.1|  porphobilinogen deaminase                        50.4    5e-05   Roseobacter denitrificans
ref|WP_038012779.1|  porphobilinogen deaminase                        50.4    5e-05   Terasakiella pusilla
ref|WP_044558528.1|  porphobilinogen deaminase                        50.4    6e-05   Azospirillum sp. B4
ref|WP_019645838.1|  hypothetical protein                             50.1    6e-05   Novispirillum itersonii
ref|WP_024898562.1|  porphobilinogen deaminase                        50.1    6e-05   Ochrobactrum
ref|WP_028033627.1|  porphobilinogen deaminase                        50.1    7e-05   Chelativorans sp. J32
ref|WP_037162577.1|  porphobilinogen deaminase                        50.1    7e-05   Rhizobium sp. CF258
ref|WP_040961994.1|  porphobilinogen deaminase                        49.7    8e-05   Sinorhizobium fredii
ref|WP_023771864.1|  MULTISPECIES: porphobilinogen deaminase          49.7    9e-05   Mesorhizobium
ref|WP_039682060.1|  porphobilinogen deaminase                        49.7    9e-05   Tateyamaria sp. ANG-S1
ref|WP_026598948.1|  porphobilinogen deaminase                        49.7    9e-05   Methylocystis sp. LW5
gb|AGA64747.1|  Porphobilinogen deaminase                             49.7    9e-05   Liberibacter crescens BT-1
gb|KIX19566.1|  porphobilinogen deaminase                             49.7    9e-05   Paracoccus sp. 228
ref|WP_041770687.1|  porphobilinogen deaminase                        49.7    9e-05   Liberibacter crescens
ref|WP_018328620.1|  porphobilinogen deaminase                        49.7    1e-04   Rhizobium giardinii
ref|WP_011049329.1|  porphobilinogen deaminase                        49.7    1e-04   Ruegeria pomeroyi
ref|WP_044043118.1|  porphobilinogen deaminase                        49.7    1e-04   Octadecabacter antarcticus
gb|AGI66330.1|  porphobilinogen deaminase HemC                        49.7    1e-04   Octadecabacter antarcticus 307
ref|WP_007255416.1|  porphobilinogen deaminase                        49.3    1e-04   Oceanicola granulosus
ref|WP_034491541.1|  porphobilinogen deaminase                        49.3    1e-04   Afifella pfennigii
ref|WP_003531176.1|  porphobilinogen deaminase                        49.3    1e-04   Sinorhizobium meliloti
ref|WP_043619941.1|  porphobilinogen deaminase                        49.3    1e-04   Ensifer sp. ZNC0028
ref|WP_023730223.1|  MULTISPECIES: porphobilinogen deaminase          49.3    1e-04   Mesorhizobium
ref|WP_027059449.1|  porphobilinogen deaminase                        49.3    1e-04   Mesorhizobium loti
ref|WP_021587457.1|  porphobilinogen deaminase                        49.3    1e-04   Ochrobactrum sp. EGD-AQ16
ref|WP_006467949.1|  porphobilinogen deaminase                        49.3    1e-04   Ochrobactrum intermedium
ref|WP_023705005.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
gb|ELT50081.1|  porphobilinogen deaminase                             48.9    2e-04   Ochrobactrum intermedium M86
ref|WP_025089941.1|  porphobilinogen deaminase                        48.9    2e-04   Ochrobactrum intermedium
ref|WP_023694474.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_023747363.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_023687735.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. LSJC269B00
gb|EDM70283.1|  porphobilinogen deaminase                             48.9    2e-04   Roseobacter sp. AzwK-3b
ref|WP_023818294.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. L2C066B000
ref|WP_023683914.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|XP_002179459.1|  hydroxymethylbilane synthase                     48.9    2e-04   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_023702385.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. LSJC264A00
ref|WP_023670483.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_023824345.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. L103C565B0
ref|WP_037389845.1|  porphobilinogen deaminase                        48.9    2e-04   Sinorhizobium americanum
ref|WP_023737969.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_027050511.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. URHB0007
ref|WP_023756506.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_023726067.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. LSHC412B00
ref|WP_023710202.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_018235886.1|  porphobilinogen deaminase                        48.9    2e-04   Ensifer sp. BR816
ref|WP_023834671.1|  porphobilinogen deaminase                        48.9    2e-04   Mesorhizobium sp. L103C105A0
ref|WP_023736796.1|  MULTISPECIES: porphobilinogen deaminase          48.9    2e-04   Mesorhizobium
ref|WP_037296007.1|  porphobilinogen deaminase                        48.9    2e-04   Roseobacter sp. AzwK-3b
ref|WP_009493632.1|  porphobilinogen deaminase                        48.9    2e-04   Microvirga lotononidis
gb|ESY49618.1|  porphobilinogen deaminase                             48.9    2e-04   Mesorhizobium sp. LNJC374B00
ref|WP_012091159.1|  porphobilinogen deaminase                        48.9    2e-04   Ochrobactrum
ref|WP_023851157.1|  porphobilinogen deaminase                        48.9    2e-04   Rhodobacteraceae bacterium PD-2
ref|WP_041375316.1|  porphobilinogen deaminase                        48.5    2e-04   Polymorphum gilvum
ref|WP_023800555.1|  porphobilinogen deaminase                        48.5    2e-04   Mesorhizobium sp. L48C026A00
gb|ADZ68810.1|  Porphobilinogen deaminase                             48.5    2e-04   Polymorphum gilvum SL003B-26A1
ref|WP_028010503.1|  porphobilinogen deaminase                        48.5    2e-04   Sinorhizobium/Ensifer group
ref|WP_027053179.1|  porphobilinogen deaminase                        48.5    2e-04   Mesorhizobium erdmanii
ref|WP_034802595.1|  porphobilinogen deaminase                        48.5    2e-04   Ensifer
dbj|BAQ15843.1|  porphobilinogen deaminase                            48.1    3e-04   Methyloceanibacter caenitepidi
ref|WP_037574274.1|  porphobilinogen deaminase                        48.5    3e-04   
gb|AIJ53553.1|  porphobilinogen deaminase                             48.1    3e-04   
gb|AIJ68933.1|  porphobilinogen deaminase                             48.1    3e-04   
sp|A5VSL5.1|HEM3_BRUO2  RecName: Full=Porphobilinogen deaminase; ...  48.1    3e-04   
ref|WP_037316456.1|  porphobilinogen deaminase                        48.5    3e-04   
ref|WP_024810783.1|  porphobilinogen deaminase                        48.5    3e-04   
ref|WP_027154807.1|  porphobilinogen deaminase                        48.1    3e-04   
gb|ENQ07290.1|  porphobilinogen deaminase                             48.5    3e-04   
ref|WP_002971925.1|  porphobilinogen deaminase                        48.5    3e-04   
ref|WP_032451151.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_032449313.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_032449198.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_032449627.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_032449605.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_019443634.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_009365073.1|  porphobilinogen deaminase                        48.1    3e-04   
gb|ENX68267.1|  porphobilinogen deaminase                             48.1    3e-04   
gb|ENS01498.1|  porphobilinogen deaminase                             48.1    3e-04   
gb|ENR28814.1|  porphobilinogen deaminase                             48.1    3e-04   
gb|ENR17191.1|  porphobilinogen deaminase                             48.1    3e-04   
ref|WP_023663698.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_002964957.1|  MULTISPECIES: porphobilinogen deaminase          48.1    3e-04   
gb|ENQ58243.1|  porphobilinogen deaminase                             48.1    3e-04   
ref|WP_005979171.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_004687669.1|  MULTISPECIES: porphobilinogen deaminase          48.1    3e-04   
ref|WP_004689269.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_012567533.1|  porphobilinogen deaminase                        48.1    3e-04   
gb|EEH13961.1|  porphobilinogen deaminase                             48.1    3e-04   
gb|ADZ66952.1|  Porphobilinogen deaminase                             48.1    3e-04   
gb|KEY04865.1|  porphobilinogen deaminase                             48.1    3e-04   
ref|WP_026060125.1|  porphobilinogen deaminase                        48.1    3e-04   
gb|AAL51358.1|  porphobilinogen deaminase                             48.1    3e-04   
ref|WP_012709692.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_026987992.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_008507680.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_016921111.1|  porphobilinogen deaminase                        48.1    3e-04   
gb|AEW14381.1|  porphobilinogen deaminase                             48.1    3e-04   
ref|WP_036353217.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_012067176.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_034852992.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_021694013.1|  porphobilinogen deaminase                        48.1    3e-04   
ref|WP_028054303.1|  porphobilinogen deaminase                        47.8    4e-04   
ref|WP_038072126.1|  porphobilinogen deaminase                        47.8    4e-04   
ref|WP_019994801.1|  hypothetical protein                             47.8    4e-04   
ref|WP_006641905.1|  MULTISPECIES: porphobilinogen deaminase          47.8    4e-04   
ref|WP_006173403.1|  porphobilinogen deaminase                        47.8    4e-04   
ref|WP_024586872.1|  porphobilinogen deaminase                        47.8    4e-04   
ref|WP_010443568.1|  porphobilinogen deaminase                        47.8    4e-04   
gb|EDZ44354.1|  porphobilinogen deaminase                             47.8    4e-04   
ref|WP_038650482.1|  porphobilinogen deaminase                        47.8    4e-04   
ref|WP_023515707.1|  porphobilinogen deaminase HemC                   47.8    4e-04   
gb|AID33248.1|  porphobilinogen deaminase                             47.8    5e-04   
ref|WP_036281275.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_027037391.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_037164804.1|  MULTISPECIES: porphobilinogen deaminase          47.4    5e-04   
ref|WP_008551662.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_040777004.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_014287098.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_031257752.1|  porphobilinogen deaminase                        47.4    5e-04   
ref|WP_013963330.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_011582515.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_037282197.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_023778853.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_027134987.1|  hypothetical protein                             47.4    6e-04   
ref|WP_026227654.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_040878718.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_025425100.1|  porphobilinogen deaminase                        47.4    6e-04   
ref|WP_024310856.1|  porphobilinogen deaminase                        47.4    6e-04   
gb|EYD74496.1|  Porphobilinogen deaminase                             47.4    7e-04   
ref|WP_006201144.1|  porphobilinogen deaminase                        47.4    7e-04   
ref|WP_024324252.1|  porphobilinogen deaminase                        47.4    7e-04   
ref|WP_012457082.1|  porphobilinogen deaminase                        47.4    7e-04   
gb|AHK42657.1|  porphobilinogen deaminase                             47.0    7e-04   
ref|WP_027031858.1|  porphobilinogen deaminase                        47.0    7e-04   
ref|WP_026261137.1|  porphobilinogen deaminase                        47.0    7e-04   
ref|WP_013528908.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_025053790.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_027163059.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_024503042.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_009806314.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_026783779.1|  porphobilinogen deaminase                        47.0    8e-04   
ref|WP_028287486.1|  porphobilinogen deaminase                        47.0    9e-04   
ref|WP_020734044.1|  porphobilinogen deaminase                        46.6    9e-04   
ref|WP_027047533.1|  porphobilinogen deaminase                        46.6    9e-04   
ref|WP_043548899.1|  porphobilinogen deaminase                        47.0    9e-04   
ref|WP_028094134.1|  porphobilinogen deaminase                        46.6    0.001   
ref|WP_036561184.1|  porphobilinogen deaminase                        46.6    0.001   
ref|WP_029617466.1|  porphobilinogen deaminase                        46.6    0.001   
gb|ESY67070.1|  porphobilinogen deaminase                             47.0    0.001   



>ref|XP_009792144.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
sylvestris]
Length=365

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRVIETSRKGPYT  D + MGED GKELL
Sbjct  296  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTFEDMIRMGEDAGKELL  355

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  356  AEAGPGFFGN  365



>ref|XP_009610066.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=370

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRV+ETSRKGPYT+ D  LMGED GKELL
Sbjct  301  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVLETSRKGPYTVEDMTLMGEDAGKELL  360

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  361  SRAGPGFFGN  370



>ref|XP_009767215.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
sylvestris]
Length=370

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRV+ETSRKGPYT  D  LMGED GKELL
Sbjct  301  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVLETSRKGPYTFEDMTLMGEDAGKELL  360

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  361  SRAGPGFFGN  370



>ref|XP_009602647.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=365

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRVIETSRKGPYT  + + MGED GKELL
Sbjct  296  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTFEEMIRMGEDAGKELL  355

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  356  AEAGPGFFGN  365



>ref|XP_004243981.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Solanum 
lycopersicum]
Length=365

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRVIETSRKGPYT  D + MGED G+ELL
Sbjct  296  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTSEDMIRMGEDAGQELL  355

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  356  SKAGPGFFGN  365



>ref|XP_006346038.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Solanum 
tuberosum]
Length=365

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA RGEDGDCIFKGL ASPDGTRVIETSRKGPYT  D + MGED G+ELL
Sbjct  296  DGSCRTPIAGYACRGEDGDCIFKGLVASPDGTRVIETSRKGPYTSEDMIRMGEDAGQELL  355

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  356  SKAGPGFFGN  365



>ref|XP_002520359.1| porphobilinogen deaminase, putative [Ricinus communis]
 gb|EEF42025.1| porphobilinogen deaminase, putative [Ricinus communis]
Length=372

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+GDCIFKGL ASPDGTRV+ETSRKGPY L+D ++MG+D GKELL
Sbjct  303  DGSCRTPIAGYASKDENGDCIFKGLVASPDGTRVLETSRKGPYALDDMIMMGKDAGKELL  362

Query  148  LQAGPGFF  125
            LQAGPGFF
Sbjct  363  LQAGPGFF  370



>ref|XP_011022037.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Populus 
euphratica]
Length=426

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYARR E+GDCIFKGL ASPDGTRV++TSRKGPY  +D + MG+D G+ELL
Sbjct  357  DGSCRTPIAGYARRDENGDCIFKGLVASPDGTRVLKTSRKGPYAFDDMIAMGKDAGQELL  416

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  417  SQAGPGFF  424



>ref|XP_010046969.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW78688.1| hypothetical protein EUGRSUZ_C00142 [Eucalyptus grandis]
Length=385

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIF+GL ASPDGTRV+ETSRKGPYT  D VLMG+D GKELL
Sbjct  316  DGSCRTPIAGYASKDEDGNCIFRGLVASPDGTRVLETSRKGPYTYEDMVLMGKDAGKELL  375

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  376  SRAGPGFF  383



>ref|XP_002310073.2| hypothetical protein POPTR_0007s07680g [Populus trichocarpa]
 gb|EEE90523.2| hypothetical protein POPTR_0007s07680g [Populus trichocarpa]
Length=376

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYAR+ E+GDCIFKGL ASPDG RV+ETSRKGPY  +D + MG+D GKELL
Sbjct  307  DGSCRTPIAGYARKDENGDCIFKGLVASPDGRRVLETSRKGPYAFDDMIAMGKDAGKELL  366

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  367  SQAGPGFF  374



>dbj|BAD94270.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
Length=130

 Score =   112 bits (281),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+CIF+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  61   DGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  120

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  121  SRAGPGFFGN  130



>gb|KJB31849.1| hypothetical protein B456_005G211000 [Gossypium raimondii]
Length=376

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIFKGL ASPDGTRV+ETSRKGPY   D V+MG+D GKELL
Sbjct  307  DGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPYAFEDMVMMGKDAGKELL  366

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  367  SRAGPGFF  374



>ref|XP_011006773.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Populus 
euphratica]
Length=376

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYAR+ E+GDCIFKGL ASPDGTRV+ETSRKG Y  +D + MG+D GKELL
Sbjct  307  DGSCRTPIAGYARKDENGDCIFKGLVASPDGTRVLETSRKGLYAFDDMIAMGKDAGKELL  366

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  367  SQAGPGFF  374



>ref|XP_008461840.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Cucumis 
melo]
Length=286

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDGTRV+ETSR+GPY ++D + MG+D G+ELL
Sbjct  217  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPYAIDDMIAMGKDAGQELL  276

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  277  SRAGPGFF  284



>ref|XP_010452807.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Camelina 
sativa]
Length=130

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  61   DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  120

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  121  SRAGPGFFGN  130



>ref|XP_010647324.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Vitis vinifera]
Length=369

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   EDG+CIFKGL ASPDGT+V+ETSRKGPY L D + MG+D G+ELL
Sbjct  300  DGSCRTPIAGYASHDEDGNCIFKGLVASPDGTKVLETSRKGPYALEDMIKMGKDAGEELL  359

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  360  SRAGPGFF  367



>emb|CDP13602.1| unnamed protein product [Coffea canephora]
Length=383

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSRKG YT  + V MG+D GKELL
Sbjct  314  DGSCRTPIAGYASRDEDGNCVFRGLVASPDGTRVLETSRKGSYTFEEMVAMGKDAGKELL  373

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  374  SKAGPGFF  381



>gb|KGN58555.1| hypothetical protein Csa_3G682170 [Cucumis sativus]
Length=364

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDGTRV+ETSR+GPY + D + MG+D G+ELL
Sbjct  295  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPYAIEDMIAMGKDAGQELL  354

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  355  SRAGPGFF  362



>ref|XP_009125721.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Brassica 
rapa]
Length=380

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C+F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  311  DGSCRTPIAGYAAKDEEGNCLFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  370

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  371  SRAGPGFFGN  380



>ref|XP_009131051.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Brassica 
rapa]
Length=379

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  310  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  369

Query  148  LQAGPGFFGN  119
              AGPGFFGN
Sbjct  370  SLAGPGFFGN  379



>ref|NP_196445.1| Porphobilinogen deaminase [Arabidopsis thaliana]
 sp|Q43316.1|HEM3_ARATH RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; AltName: Full=Protein 
RUGOSA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL31946.1|AF419614_1 AT5g08280/F8L15_10 [Arabidopsis thaliana]
 emb|CAA51941.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 emb|CAA52061.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 emb|CAC08328.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AAL49926.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AAM67570.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gb|AED91277.1| Porphobilinogen deaminase [Arabidopsis thaliana]
Length=382

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+CIF+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>ref|XP_008361909.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Malus 
domestica]
Length=390

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIFKGL ASPDGTRV+ETSRKGPY   D + MG+D G+ELL
Sbjct  321  DGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPYASQDMINMGKDAGQELL  380

Query  148  LQAGPGFFG  122
             +AGPGFFG
Sbjct  381  SRAGPGFFG  389



>gb|AAM64573.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
Length=382

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+CIF+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>pdb|4HTG|A Chain A, Porphobilinogen Deaminase From Arabidopsis Thaliana
Length=320

 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+CIF+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  251  DGSCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  310

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  311  SRAGPGFFGN  320



>ref|XP_002873350.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49609.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+CIF+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYAAKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>ref|XP_004149732.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Cucumis 
sativus]
Length=375

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDGTRV+ETSR+GPY + D + MG+D G+ELL
Sbjct  306  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPYAIEDMIAMGKDAGQELL  365

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  366  SRAGPGFF  373



>ref|XP_009351734.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Pyrus x 
bretschneideri]
Length=388

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIFKGL ASPDGTRV+ETSRKGPY   D + MG+D G+ELL
Sbjct  319  DGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPYASQDMIDMGKDAGQELL  378

Query  148  LQAGPGFFG  122
             +AGPGFFG
Sbjct  379  SRAGPGFFG  387



>emb|CDX81090.1| BnaC03g03440D [Brassica napus]
Length=378

 Score =   114 bits (285),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  309  DGSCRTPIAGYAAKDEEGNCYFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  368

Query  148  LQAGPGFFGN  119
              AGPGFFGN
Sbjct  369  SLAGPGFFGN  378



>ref|XP_006287933.1| hypothetical protein CARUB_v10001168mg [Capsella rubella]
 gb|EOA20831.1| hypothetical protein CARUB_v10001168mg [Capsella rubella]
Length=382

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C+F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYAAKDEEGNCVFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>emb|CBI18797.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   EDG+CIFKGL ASPDGT+V+ETSRKGPY L D + MG+D G+ELL
Sbjct  259  DGSCRTPIAGYASHDEDGNCIFKGLVASPDGTKVLETSRKGPYALEDMIKMGKDAGEELL  318

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  319  SRAGPGFF  326



>ref|XP_010423118.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Camelina 
sativa]
Length=384

 Score =   114 bits (284),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  315  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  374

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  375  SRAGPGFFGN  384



>emb|CDY44763.1| BnaC02g01240D [Brassica napus]
Length=380

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  311  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  370

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  371  SRAGPGFFGN  380



>gb|KJB77369.1| hypothetical protein B456_012G134300 [Gossypium raimondii]
Length=371

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIFKGL ASPDGTRV+ETSRKG Y   D V MG+D GKELL
Sbjct  302  DGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGSYHFEDMVSMGKDAGKELL  361

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  362  SRAGPGFF  369



>emb|CDX78330.1| BnaA03g02420D [Brassica napus]
Length=379

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  310  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  369

Query  148  LQAGPGFFGN  119
              AGPGFFGN
Sbjct  370  SLAGPGFFGN  379



>ref|XP_006437594.1| hypothetical protein CICLE_v10031858mg [Citrus clementina]
 ref|XP_006484530.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Citrus 
sinensis]
 gb|ESR50834.1| hypothetical protein CICLE_v10031858mg [Citrus clementina]
Length=375

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+GDC+F+GL ASPDGTRV+ETSRKG YTL D + MG+D GKELL
Sbjct  306  DGSCRTPIAGYACKDENGDCVFRGLVASPDGTRVLETSRKGSYTLQDMIKMGKDAGKELL  365

Query  148  LQAGPGFF  125
             Q GPGFF
Sbjct  366  SQTGPGFF  373



>ref|XP_010547710.1| PREDICTED: LOW QUALITY PROTEIN: porphobilinogen deaminase, chloroplastic-like 
[Tarenaya hassleriana]
Length=379

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDG RV+ETSRKGPY   D V MG++ G+ELL
Sbjct  310  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGRRVLETSRKGPYAYEDMVRMGKEAGQELL  369

Query  148  LQAGPGFFG  122
             +AGPGFFG
Sbjct  370  SRAGPGFFG  378



>emb|CDX69959.1| BnaA10g23080D [Brassica napus]
Length=382

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYATKDEEGNCYFRGLVASPDGTKVLETSRKGPYVFEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>ref|XP_009122439.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Brassica 
rapa]
Length=382

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYAAKDEEGNCYFRGLVASPDGTKVLETSRKGPYVFEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>ref|XP_010491454.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Camelina 
sativa]
Length=384

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  315  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQELL  374

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  375  SRAGPGFFGN  384



>ref|XP_004172759.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Cucumis 
sativus]
Length=376

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDGTRV+ETSR+GPY + D + MG+D G+ELL
Sbjct  306  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRRGPYAIEDMIAMGKDAGQELL  365

Query  148  LQAGPGFF  125
             +AGPGF 
Sbjct  366  SRAGPGFL  373



>ref|XP_010112535.1| Porphobilinogen deaminase [Morus notabilis]
 gb|EXC33988.1| Porphobilinogen deaminase [Morus notabilis]
Length=380

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + EDG+CIFKGL ASPDGTRV+ETSRKGPY   D + MG+D G+ELL
Sbjct  311  DGSCRTPIAGYASKDEDGNCIFKGLVASPDGTRVLETSRKGPYAFEDMMKMGKDAGEELL  370

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  371  SRAGPGFF  378



>ref|XP_007225744.1| hypothetical protein PRUPE_ppa007124mg [Prunus persica]
 gb|EMJ26943.1| hypothetical protein PRUPE_ppa007124mg [Prunus persica]
Length=381

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+CIFKGL ASPDGTRV+ETSRKG Y   D + MG++ G+ELL
Sbjct  312  DGSCRTPIAGYASRDEDGNCIFKGLVASPDGTRVLETSRKGTYAFQDMINMGKEAGQELL  371

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  372  SQAGPGFF  379



>emb|CDY21529.1| BnaC09g47630D [Brassica napus]
Length=382

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G C F+GL ASPDGT+V+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYAAKDEEGSCYFRGLVASPDGTKVLETSRKGPYVFEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>emb|CDY40758.1| BnaAnng06210D [Brassica napus]
Length=380

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E+G+C F+GL ASPDG RV+ETSRKGPY   D V MG+D G+ELL
Sbjct  311  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGIRVLETSRKGPYVFEDMVKMGKDAGQELL  370

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  371  SRAGPGFFGN  380



>ref|XP_006399317.1| hypothetical protein EUTSA_v10013814mg [Eutrema salsugineum]
 gb|ESQ40770.1| hypothetical protein EUTSA_v10013814mg [Eutrema salsugineum]
Length=382

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + + G+C F+GL ASPDGTRV+ETSRKGPY   D V MG+D G+ELL
Sbjct  313  DGSCRTPIAGYAAKDDQGNCFFRGLVASPDGTRVLETSRKGPYVFEDMVKMGKDAGQELL  372

Query  148  LQAGPGFFGN  119
             +AGPGFFGN
Sbjct  373  SRAGPGFFGN  382



>ref|NP_001240888.1| uncharacterized protein LOC100779132 [Glycine max]
 gb|ACU20300.1| unknown [Glycine max]
 gb|KHN25625.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=356

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR GPY + D + MG+D GKELL
Sbjct  287  DGSCRTPIAGYACRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMGKDAGKELL  346

Query  148  LQAGPGFFGN  119
             +AGP FF +
Sbjct  347  SRAGPNFFSS  356



>ref|XP_002306378.2| hypothetical protein POPTR_0005s09400g, partial [Populus trichocarpa]
 gb|EEE93374.2| hypothetical protein POPTR_0005s09400g, partial [Populus trichocarpa]
Length=358

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYARR E+GDCIFKGL ASPDGTRV++TSRKGPY  +D + MG+D GKELL
Sbjct  235  DGSCRTPIAGYARRDENGDCIFKGLVASPDGTRVLKTSRKGPYAFDDMIAMGKDAGKELL  294

Query  148  LQA  140
             QA
Sbjct  295  SQA  297



>ref|XP_004505653.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Cicer 
arietinum]
Length=369

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR GPY   D + MG+D G+ELL
Sbjct  300  DGSCRTPIAGYASRTEDGNCLFRGLVASPDGTRVLETSRIGPYAFEDMMKMGKDAGEELL  359

Query  148  LQAGPGFFGN  119
             +AGPGFF +
Sbjct  360  SRAGPGFFNS  369



>ref|XP_010522127.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Tarenaya 
hassleriana]
Length=380

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + +DG+C+FKGL ASPDGTRV+ETSRKG Y   D V MG+D G+ELL
Sbjct  311  DGSCRTPIAGYASQDDDGNCVFKGLVASPDGTRVLETSRKGLYAFEDMVRMGKDAGQELL  370

Query  148  LQAGPGFFG  122
             +AGPGFFG
Sbjct  371  SRAGPGFFG  379



>ref|XP_007156992.1| hypothetical protein PHAVU_002G034500g [Phaseolus vulgaris]
 gb|ESW28986.1| hypothetical protein PHAVU_002G034500g [Phaseolus vulgaris]
Length=385

 Score =   108 bits (271),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGT V+ET+R GPY + D + MG+D GKELL
Sbjct  316  DGSCRTPIAGYACRNEDGNCLFRGLVASPDGTSVLETTRVGPYAVEDMIEMGKDAGKELL  375

Query  148  LQAGPGFFGN  119
             +AGP FF +
Sbjct  376  SRAGPNFFSS  385



>ref|XP_010941629.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Elaeis 
guineensis]
Length=363

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R E+G C+F+GL ASPDG+RV+ETSRKG YTL D V MG+D GKELL
Sbjct  294  DGSCRTPIAGYACRDENGYCVFRGLVASPDGSRVLETSRKGSYTLGDMVAMGKDAGKELL  353

Query  148  LQAGPGFF  125
              AGPGFF
Sbjct  354  ATAGPGFF  361



>ref|XP_007043280.1| Hydroxymethylbilane synthase isoform 2 [Theobroma cacao]
 gb|EOX99111.1| Hydroxymethylbilane synthase isoform 2 [Theobroma cacao]
Length=286

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A + EDG+C+FKGL ASPDG RV+ETSRKG Y   D V+MG+D GKELL
Sbjct  217  DGSCRTPIAGNAYKDEDGNCVFKGLVASPDGKRVLETSRKGQYAFEDMVMMGKDAGKELL  276

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  277  SRAGPGFF  284



>gb|KHG03036.1| Porphobilinogen deaminase, chloroplastic [Gossypium arboreum]
Length=371

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + +D +CIFKGL ASPDGTRV+ETSRKG Y   D V MG+D GKELL
Sbjct  302  DGSCRTPIAGYASKDKDCNCIFKGLVASPDGTRVLETSRKGSYHFEDMVSMGKDAGKELL  361

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  362  SRAGPGFF  369



>ref|XP_004297733.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA +  DG+CIFKGL ASPDGTRV+ETSRKGPYT  + + +G+D G+ELL
Sbjct  295  DGSCRTPIAGYASKDADGNCIFKGLVASPDGTRVLETSRKGPYTYKEMMEIGKDAGEELL  354

Query  148  LQAGPGFFG  122
              AGPGFFG
Sbjct  355  KLAGPGFFG  363



>ref|XP_008793590.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X4 [Phoenix dactylifera]
Length=285

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG C+F+GL ASPDGTRV+ETSRKG Y L D V +G+D GKELL
Sbjct  216  DGSCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELL  275

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  276  SRAGPGFF  283



>gb|KDP37560.1| hypothetical protein JCGZ_05999 [Jatropha curcas]
Length=382

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA + E GDC+FKGL ASPDG+RV+ETSRKG Y L D ++MG+D G ELL
Sbjct  313  DGSCRTPIAGYACKDEGGDCVFKGLVASPDGSRVLETSRKGAYALADMIMMGKDAGMELL  372

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  373  SRAGPGFF  380



>ref|XP_003607332.1| Porphobilinogen deaminase [Medicago truncatula]
Length=228

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG+C+F+GL ASPDGTRV+ETSR GPY   D + MG D G+ELL
Sbjct  159  DGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGPYAYEDMMKMGRDAGEELL  218

Query  148  LQAGPGFFGN  119
             +AGPGFF +
Sbjct  219  SRAGPGFFNS  228



>ref|XP_008221067.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Prunus mume]
Length=376

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG+CIFKGL ASPDGTRV+ETSRKG Y   D + MG+D G+ELL
Sbjct  307  DGSCRTPIAGYASRDGDGNCIFKGLVASPDGTRVLETSRKGTYAFQDMINMGKDAGQELL  366

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  367  SRAGPGFF  374



>ref|XP_007043279.1| Hydroxymethylbilane synthase isoform 1 [Theobroma cacao]
 gb|EOX99110.1| Hydroxymethylbilane synthase isoform 1 [Theobroma cacao]
Length=371

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A + EDG+C+FKGL ASPDG RV+ETSRKG Y   D V+MG+D GKELL
Sbjct  302  DGSCRTPIAGNAYKDEDGNCVFKGLVASPDGKRVLETSRKGQYAFEDMVMMGKDAGKELL  361

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  362  SRAGPGFF  369



>ref|XP_011097642.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Sesamum 
indicum]
Length=377

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYARR  DG+CIFK L ASPDGT+V+ETSR+GPY  +D + MG D G+ELL
Sbjct  308  EGSCRTPIAGYARRDADGNCIFKALVASPDGTQVLETSREGPYAYDDMIKMGVDAGEELL  367

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  368  ARAGPGFFN  376



>ref|XP_008793588.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=363

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG C+F+GL ASPDGTRV+ETSRKG Y L D V +G+D GKELL
Sbjct  294  DGSCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELL  353

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  354  SRAGPGFF  361



>ref|XP_008793587.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=363

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG C+F+GL ASPDGTRV+ETSRKG Y L D V +G+D GKELL
Sbjct  294  DGSCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELL  353

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  354  SRAGPGFF  361



>ref|XP_008793589.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=354

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG C+F+GL ASPDGTRV+ETSRKG Y L D V +G+D GKELL
Sbjct  285  DGSCRTPIAGYAYRHNDGYCVFRGLVASPDGTRVLETSRKGAYALEDMVSIGKDAGKELL  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  SRAGPGFF  352



>ref|NP_001242644.1| uncharacterized protein LOC100812733 [Glycine max]
 gb|ACU17914.1| unknown [Glycine max]
Length=350

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA R EDG+C+F+GL ASPDG RV+ETSR GPY   D + MG+D G+ELL
Sbjct  281  EGSCRTPIAGYASRNEDGNCLFRGLVASPDGIRVLETSRIGPYAFEDTIKMGKDAGEELL  340

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  341  SRAGPGFFS  349



>gb|KHN20627.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=350

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA R EDG+C+F+GL ASPDG RV+ETSR GPY   D + MG+D G+ELL
Sbjct  281  EGSCRTPIAGYASRNEDGNCLFRGLVASPDGIRVLETSRIGPYAFEDMIKMGKDAGEELL  340

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  341  SRAGPGFFS  349



>ref|XP_003607331.1| Porphobilinogen deaminase [Medicago truncatula]
 gb|AES89528.1| porphobilinogen deaminase [Medicago truncatula]
Length=369

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG+C+F+GL ASPDGTRV+ETSR GPY   D + MG D G+ELL
Sbjct  300  DGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGPYAYEDMMKMGRDAGEELL  359

Query  148  LQAGPGFFGN  119
             +AGPGFF +
Sbjct  360  SRAGPGFFNS  369



>ref|XP_003537739.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Glycine 
max]
 gb|KHN05503.1| Porphobilinogen deaminase, chloroplastic [Glycine soja]
Length=350

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR G Y   D + MG+D G+ELL
Sbjct  281  EGSCRTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRIGSYAFEDMIKMGKDAGEELL  340

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  341  SRAGPGFFS  349



>ref|XP_006853343.1| hypothetical protein AMTR_s00032p00091590 [Amborella trichopoda]
 gb|ERN14810.1| hypothetical protein AMTR_s00032p00091590 [Amborella trichopoda]
Length=442

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG CIF+GL ASPDGTRV+ETSRKG Y + D V MG+D GKELL
Sbjct  301  DGSCRTPIAGYAHRDKDGYCIFRGLVASPDGTRVLETSRKGNYDIEDMVEMGKDAGKELL  360

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  361  SRAGPSFF  368



>gb|EYU27543.1| hypothetical protein MIMGU_mgv1a008527mg [Erythranthe guttata]
Length=370

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA R E+GDC F+ L ASPDGT V+ETSRKGPY  +D + MG D G+ELL
Sbjct  301  EGSCRTPIAGYAHRDENGDCFFRALIASPDGTEVLETSRKGPYAYDDMMKMGVDAGEELL  360

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  361  SRAGPGFFN  369



>ref|XP_008813288.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=363

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG C+F+GL ASPDGTRV+E SRKG Y L + V MG+D GKELL
Sbjct  294  DGSCRTPIAGYAYRDKDGYCVFRGLVASPDGTRVLEASRKGSYALEEMVSMGKDAGKELL  353

Query  148  LQAGPGFF  125
             +AGPGF 
Sbjct  354  SRAGPGFL  361



>ref|XP_008813290.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=285

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG C+F+GL ASPDGTRV+E SRKG Y L + V MG+D GKELL
Sbjct  216  DGSCRTPIAGYAYRDKDGYCVFRGLVASPDGTRVLEASRKGSYALEEMVSMGKDAGKELL  275

Query  148  LQAGPGFF  125
             +AGPGF 
Sbjct  276  SRAGPGFL  283



>ref|XP_010927101.1| PREDICTED: LOW QUALITY PROTEIN: porphobilinogen deaminase, chloroplastic-like 
[Elaeis guineensis]
Length=365

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG C F+GL ASPDGTRV+ETSRKG Y  ++ V MG+D GKELL
Sbjct  296  DGSCRTPIAGYAYRDMDGYCAFRGLVASPDGTRVLETSRKGSYAFDEMVSMGKDAGKELL  355

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  356  SRAGPGFF  363



>sp|Q43082.1|HEM3_PEA RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; Flags: Precursor 
[Pisum sativum]
 emb|CAA51820.1| hydroxymethylbilane synthase [Pisum sativum]
Length=369

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG+C+F+GL ASPDGTRV+ETSR G YT  D + +G+D G+ELL
Sbjct  300  DGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGSYTYEDMMKIGKDAGEELL  359

Query  148  LQAGPGFFGN  119
             +AGPGFF +
Sbjct  360  SRAGPGFFNS  369



>gb|ACU17610.1| unknown [Glycine max]
Length=350

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSC TPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR G Y   D + MG+D G+ELL
Sbjct  281  EGSCHTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRIGSYAFEDMIKMGKDAGEELL  340

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  341  SRAGPGFFS  349



>ref|XP_009414508.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R  DG+C+ + L ASPDGTRV+ETSRKG Y L+D V MG+D GKELL
Sbjct  296  DGSCRTPIAGYAYRDSDGNCVLRCLVASPDGTRVLETSRKGLYALDDMVAMGKDAGKELL  355

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  356  SKAGPSFF  363



>ref|XP_007133420.1| hypothetical protein PHAVU_011G1771000g, partial [Phaseolus vulgaris]
 gb|ESW05414.1| hypothetical protein PHAVU_011G1771000g, partial [Phaseolus vulgaris]
Length=335

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA R  DG+C F+GL ASPDGTRV+ETSR G Y   D + MG+D G+ELL
Sbjct  266  EGSCRTPIAGYASRNMDGNCFFRGLVASPDGTRVLETSRIGSYVAEDMIKMGKDAGEELL  325

Query  148  LQAGPGFFGN  119
             +AGPGFF +
Sbjct  326  SRAGPGFFSS  335



>ref|XP_010670537.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=366

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R E+GDC F+GL AS DG +VIETSR+G Y  +D V MG+D GKELL
Sbjct  296  DGSCRTPIAGYACRDENGDCFFRGLVASTDGKQVIETSRRGSYAFDDMVSMGKDAGKELL  355

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  356  SRAGPGFF  363



>ref|XP_004306458.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA +  DG+CIFKGL ASP+GTRV+ETSRKG Y   + + +G+D G+ELL
Sbjct  304  DGSCRTPIAGYASKDADGNCIFKGLVASPNGTRVLETSRKGRYAYKEMMEIGKDAGQELL  363

Query  148  LQAGPGFFG  122
              AGPGFFG
Sbjct  364  KLAGPGFFG  372



>gb|EPS63046.1| hypothetical protein M569_11740, partial [Genlisea aurea]
Length=354

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYA+R  DG+CIFK L ASPDG +V+ET R+GPY  +D V MG D G+ELL
Sbjct  287  EGSCRTPIAGYAQRDADGNCIFKALVASPDGAKVLETYREGPYAYDDMVKMGVDAGEELL  346

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  347  SRAGPGFF  354



>gb|ABB03720.1| putative porphobilinogen deaminase [Sorghum bicolor]
Length=98

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG++V ET+R GPY+ +D V +G+D G EL 
Sbjct  27   DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELK  86

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  87   AKAGPGFF  94



>gb|EYU33770.1| hypothetical protein MIMGU_mgv1a008233mg [Erythranthe guttata]
Length=380

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            +GSCRTPIAGYARR  DG+CIFK L ASPDGT V+ET R+G Y   D + MG D G+ELL
Sbjct  311  EGSCRTPIAGYARRDADGNCIFKALIASPDGTEVLETYREGQYVYEDMMKMGVDAGEELL  370

Query  148  LQAGPGFFG  122
             +AGPGFF 
Sbjct  371  TRAGPGFFN  379



>gb|AFW66381.1| hypothetical protein ZEAMMB73_808224 [Zea mays]
Length=132

 Score = 97.1 bits (240),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R  DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  61   DGNCRTPIAAYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELK  120

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  121  AKAGPGFF  128



>gb|ABK26871.1| unknown [Picea sitchensis]
Length=373

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG C F+GL ASPDGTRV+ETSRKG YT  D V MG D GKEL 
Sbjct  304  DGSCRTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYTYEDMVSMGVDAGKELK  363

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  364  ERAGPAFF  371



>gb|ABR17705.1| unknown [Picea sitchensis]
Length=373

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA R +DG C F+GL ASPDGTRV+ETSRKG YT  D V MG D GKEL 
Sbjct  304  DGSCRTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYTHEDMVSMGVDAGKELK  363

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  364  ERAGPAFF  371



>ref|XP_004951778.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Setaria 
italica]
Length=356

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDGT V ET+R GPY+ +D V MG+D G EL 
Sbjct  285  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGTTVYETTRSGPYSFDDMVAMGKDAGHELK  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  AKAGPGFF  352



>gb|AFW70271.1| camouflage1 [Zea mays]
Length=353

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  282  DGNCRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHELK  341

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  342  AKAGPGFF  349



>ref|XP_008677338.1| PREDICTED: LOC100284619 isoform X1 [Zea mays]
Length=353

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R  DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  282  DGNCRTPIAAYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELK  341

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  342  AKAGPGFF  349



>ref|XP_010276153.1| PREDICTED: porphobilinogen deaminase, chloroplastic isoform X2 
[Nelumbo nucifera]
Length=292

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC+TPIAGYA +  +G CIF+GL ASPDGT+V ETSRKG Y L D + MG+D GKELL
Sbjct  217  DGSCQTPIAGYACKDNEGYCIFRGLVASPDGTQVFETSRKGLYILEDMIAMGKDAGKELL  276

Query  148  LQAGPGFFGN  119
             +AG  FF N
Sbjct  277  SRAGSSFFDN  286



>ref|XP_010276152.1| PREDICTED: porphobilinogen deaminase, chloroplastic isoform X1 
[Nelumbo nucifera]
Length=374

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC+TPIAGYA +  +G CIF+GL ASPDGT+V ETSRKG Y L D + MG+D GKELL
Sbjct  299  DGSCQTPIAGYACKDNEGYCIFRGLVASPDGTQVFETSRKGLYILEDMIAMGKDAGKELL  358

Query  148  LQAGPGFFGN  119
             +AG  FF N
Sbjct  359  SRAGSSFFDN  368



>gb|ABF70028.1| porphobilinogen deaminase, chloroplast (hydroxymethylbilane synthase) 
(pre-uroporphyrinogen synthase), putative [Musa acuminata]
Length=426

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R EDG+C F+GL ASPDG++V ET+R GPY+ +D V +G+D G EL 
Sbjct  355  DGNCRTPIAAYAYRDEDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELK  414

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  415  AKAGPGFF  422



>ref|XP_002451614.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
 gb|EES04590.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
Length=340

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG C F+GL ASPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  271  DGNCRTPIAAYAHRDKDGSCSFRGLLASPDGSKVYETTRIGPYSFDDMVEMGKDAGHELK  330

Query  148  LQAGPGFF  125
             +AGPGF+
Sbjct  331  AKAGPGFY  338



>ref|XP_008677339.1| PREDICTED: LOC100284619 isoform X2 [Zea mays]
Length=320

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R  DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  249  DGNCRTPIAAYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELK  308

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  309  AKAGPGFF  316



>ref|XP_008680937.1| PREDICTED: uncharacterized protein LOC100191140 isoform X1 [Zea 
mays]
 gb|ACF87707.1| unknown [Zea mays]
 gb|ACN28053.1| unknown [Zea mays]
 gb|AFW70270.1| camouflage1 [Zea mays]
Length=356

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  285  DGNCRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHELK  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  AKAGPGFF  352



>gb|AFW66382.1| porphobilinogen deaminase [Zea mays]
Length=356

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R  DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  285  DGNCRTPIAAYAYRDNDGNCSFRGLLSSPDGSKVFETTRSGPYSFDDMVEMGKDAGHELK  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  AKAGPGFF  352



>ref|XP_002451613.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
 gb|EES04589.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
Length=356

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG++V ET+R GPY+ +D V +G+D G EL 
Sbjct  285  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELK  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  AKAGPGFF  352



>gb|ABF70029.1| porphobilinogen deaminase, chloroplast (hydroxymethylbilane synthase) 
(pre-uroporphyrinogen synthase), putative [Musa acuminata]
Length=328

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG C F+GL ASPDG++V ET+R GPY+ +D V MG+D G EL 
Sbjct  259  DGNCRTPIAAYAHRDKDGSCSFRGLLASPDGSKVYETTRIGPYSFDDMVEMGKDAGHELK  318

Query  148  LQAGPGFF  125
             +AGPGF+
Sbjct  319  AKAGPGFY  326



>ref|NP_001150986.1| LOC100284619 [Zea mays]
 gb|ACG41173.1| porphobilinogen deaminase [Zea mays]
Length=356

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R  DG+C F+GL ASP G++V ET+R GPY+ +D V MG+D G EL 
Sbjct  285  DGNCRTPIAAYAYRDNDGNCSFRGLLASPGGSKVFETTRSGPYSFDDMVEMGKDAGHELK  344

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  345  AKAGPGFF  352



>gb|EMT29771.1| Porphobilinogen deaminase, chloroplastic [Aegilops tauschii]
Length=334

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR G Y+L+D V +G+D G EL 
Sbjct  263  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYSLDDMVAIGQDAGHELK  322

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  323  SKAGPGFF  330



>dbj|BAD25718.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 dbj|BAG87614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95470.1| unnamed protein product [Oryza sativa Japonica Group]
Length=264

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR GPY  +  V MG+D G EL 
Sbjct  193  DGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEMGKDAGHELK  252

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  253  AKAGPGFF  260



>ref|NP_001046017.1| Os02g0168800 [Oryza sativa Japonica Group]
 sp|Q6H6D2.1|HEM3_ORYSJ RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG; 
AltName: Full=Hydroxymethylbilane synthase; Short=HMBS; 
AltName: Full=Pre-uroporphyrinogen synthase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD25717.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 dbj|BAF07931.1| Os02g0168800 [Oryza sativa Japonica Group]
 gb|EEE56391.1| hypothetical protein OsJ_05540 [Oryza sativa Japonica Group]
Length=358

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR GPY  +  V MG+D G EL 
Sbjct  287  DGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEMGKDAGHELK  346

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  347  AKAGPGFF  354



>ref|XP_003570067.1| PREDICTED: porphobilinogen deaminase, chloroplastic [Brachypodium 
distachyon]
Length=357

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR G YT +D V +G+D G EL 
Sbjct  286  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYTFDDMVALGQDAGYELK  345

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  346  SKAGPGFF  353



>gb|AAL12220.1| porphobilinogen deaminase [Triticum aestivum]
Length=308

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR G Y+ +D V +G+D G EL 
Sbjct  237  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYSFDDMVALGQDAGHELK  296

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  297  SKAGPGFF  304



>gb|EEC72572.1| hypothetical protein OsI_06012 [Oryza sativa Indica Group]
Length=358

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR G Y  +  V MG+D G EL 
Sbjct  287  DGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGSYDFDIMVEMGKDAGHELK  346

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  347  AKAGPGFF  354



>ref|XP_006648352.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like, partial 
[Oryza brachyantha]
Length=353

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIA YA R +DG+C F+GL ASPDG+ V ETSR GPY  +  V MG+D G EL 
Sbjct  282  DGNCRTPIAAYASRDKDGNCSFRGLLASPDGSIVYETSRTGPYDFDVMVEMGKDAGHELK  341

Query  148  LQAGPGFF  125
             +AG GFF
Sbjct  342  AKAGSGFF  349



>gb|KHN35094.1| Porphobilinogen deaminase, chloroplastic, partial [Glycine soja]
Length=242

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMG  173
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR GPY + D + MG
Sbjct  189  DGSCRTPIAGYACRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMG  240



>emb|CDY05678.1| BnaC02g38590D [Brassica napus]
Length=75

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = -2

Query  328  DGSCR-TPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCR TPIAGYA + E+G+C  +GL ASPD   V++TSRKGPY   D V MG+D G+EL
Sbjct  3    DGSCRSTPIAGYAAKDEEGNCYLRGLVASPD---VLDTSRKGPYVFEDMVKMGKDAGQEL  59

Query  151  LLQAGPGFFGNXIILQ  104
            L +AG  +     I++
Sbjct  60   LSRAGQAYLATKAIVK  75



>ref|XP_001769569.1| predicted protein [Physcomitrella patens]
 gb|EDQ65562.1| predicted protein [Physcomitrella patens]
Length=361

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 1/68 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A+R EDG C+F+GL A+ DG +V+ETSR G ++ +D + + +D G+EL+
Sbjct  293  DGSCRTPIAGLAQRTEDG-CLFRGLVATTDGKQVLETSRTGSFSYDDMIALAQDAGQELI  351

Query  148  LQAGPGFF  125
             +AGPGFF
Sbjct  352  SRAGPGFF  359



>ref|XP_002961888.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
 gb|EFJ37148.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
Length=353

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA R +  D C F+GL ASPDGT+V+ET+R G Y L++ V MG+D  KEL
Sbjct  282  DGSCRTPIAGYAHRDKLTDECKFRGLVASPDGTQVLETTRSGQYNLDEMVAMGKDAAKEL  341

Query  151  LLQAGPGFFG  122
            L ++GP    
Sbjct  342  LSKSGPSLLN  351



>ref|XP_006591520.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Glycine 
max]
Length=259

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMG  173
            DGSCRTPIAGYA R EDG+C+F+GL ASPDGTRV+ETSR GPY + D + MG
Sbjct  206  DGSCRTPIAGYACRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMG  257



>ref|XP_002990245.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
 gb|EFJ08660.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
Length=353

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA R +  D C F+GL ASPDGT+V+ET+R G Y  ++ V MG+D  KEL
Sbjct  282  DGSCRTPIAGYAHRDKLTDECKFRGLVASPDGTQVLETTRSGQYNFDEMVAMGKDAAKEL  341

Query  151  LLQAGPGFFG  122
            L ++GP    
Sbjct  342  LSKSGPSLLN  351



>ref|XP_001780954.1| predicted protein [Physcomitrella patens]
 gb|EDQ54214.1| predicted protein, partial [Physcomitrella patens]
Length=299

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A R EDG C F+GL A+ DG +V+ETSRKG ++ +D + + +D G EL+
Sbjct  231  DGSCRTPIAGLAERTEDG-CSFRGLVATTDGKQVLETSRKGSFSYDDMIALAQDAGAELI  289

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  290  SRAGPDFF  297



>gb|ACJ83604.1| unknown [Medicago truncatula]
 gb|AFK37427.1| unknown [Medicago truncatula]
Length=214

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXG  161
            DGSCRTPIAGYA R +DG+C+F+GL ASPDGTRV+ETSR GPY   D + MG   G
Sbjct  159  DGSCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGPYAYEDMMKMGRGCG  214



>ref|NP_001130048.1| uncharacterized protein LOC100191140 [Zea mays]
 gb|ACF78164.1| unknown [Zea mays]
 gb|AFW70269.1| LOW QUALITY PROTEIN: camouflage1 [Zea mays]
Length=394

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DG+CRTPIA YA R +DG+C F+GL +SPDG++V ET+R GPY+ +D V MG+D G EL
Sbjct  285  DGNCRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHEL  343



>emb|CDY25014.1| BnaC02g39940D [Brassica napus]
Length=387

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = -2

Query  328  DGSCR-TPIAGYARRGEDGDCIFKGLXASPDGTR----VIETSRKGPYTLNDXVLMGEDX  164
            DGSCR TPI GY+ + E+G+C  +GL ASPD T+     +    KGPY   D V MG+D 
Sbjct  313  DGSCRSTPIDGYSAKDEEGNCYLRGLVASPDDTQDMKVFLSIPIKGPYVFEDMVKMGKDA  372

Query  163  GKELLLQAGPGFFGN  119
            G+ LLL+AGPG FGN
Sbjct  373  GQVLLLRAGPGLFGN  387



>ref|XP_001781636.1| predicted protein [Physcomitrella patens]
 gb|EDQ53592.1| predicted protein [Physcomitrella patens]
Length=393

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A+R +DG C F+GL A+ DG +V+ETSRKG +  +D + + +D G+EL+
Sbjct  325  DGSCRTPIAGLAQRTDDG-CSFRGLVATTDGKQVLETSRKGSFFYDDMIALAQDAGQELI  383

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  384  SRAGPDFF  391



>ref|XP_005649123.1| porphobilinogen deaminase [Coccomyxa subellipsoidea C-169]
 gb|EIE24579.1| porphobilinogen deaminase [Coccomyxa subellipsoidea C-169]
Length=359

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A+R   G   F+GL ASPDG ++ ETSR+G YT  + V +G + G+EL 
Sbjct  288  DGSCRTPIAGLAQRNASGGLSFRGLIASPDGAKIFETSREGNYTEEEMVRLGREAGEELK  347

Query  148  LQAGPGFFG  122
             QAGP F  
Sbjct  348  AQAGPEFLS  356



>gb|KIZ01397.1| hypothetical protein MNEG_6565 [Monoraphidium neglectum]
Length=417

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA +G DG   F+GL ASP+G+++ ET+R G +   +   +G + G+EL 
Sbjct  348  DGSCRTPIAGYAHKGADGQLHFRGLVASPNGSKIFETTRVGAFDAEEGARLGREAGEELK  407

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  408  AKAGPDFF  415



>ref|XP_002950840.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f. nagariensis]
 gb|EFJ48155.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f. nagariensis]
Length=355

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA +G DG   F GL A+PDG +++ TSR   +T  D V  GED G+EL
Sbjct  286  DGSCRTPIAGYAHKGSDGQLHFSGLVATPDGKQMMRTSRVASFTDADAVKAGEDAGREL  344



>ref|XP_011396337.1| Porphobilinogen deaminase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23465.1| Porphobilinogen deaminase, chloroplastic [Auxenochlorella protothecoides]
Length=367

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A++  DG   F+GL A  +G ++ +T+R+GP T  D V MG+D G +L 
Sbjct  298  DGSCRTPIAGLAQKTADGRLSFRGLVADTEGKQLFQTTREGPATEEDAVAMGKDAGAQLK  357

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  358  REAGADFF  365



>ref|XP_001701485.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
 gb|EDO97482.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
Length=349

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA +G DG   F GL A+PDG +++  SR  P+T  D V  GE+ GKEL
Sbjct  280  DGSCRTPIAGYAHKGADGMLHFSGLVATPDGKQIMRASRVVPFTEADAVKCGEEAGKEL  338



>emb|CCQ75376.1| Porphobilinogen deaminase [Magnetospira sp. QH-2]
Length=314

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  A    DG    +GL A PDG+ V+ETSR+GP  ++    MG D G+EL 
Sbjct  244  DGSCRTPIAALAEIESDGQMFLRGLVARPDGSEVLETSRRGP--ISQAYDMGADAGRELK  301

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  302  DRAGPDFF  309



>ref|XP_002507564.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
 gb|ACO68822.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
Length=353

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+AR+  DGD + F GL A+ DG+ ++ETSR   ++  D +  G++ G EL
Sbjct  277  DGSCRTPIAGFARK--DGDNLRFNGLVAALDGSEILETSRVTKWSYADAIAAGKEAGAEL  334

Query  151  LLQAGPGFFGNXI  113
              +A   FF N I
Sbjct  335  KKKAPAEFFANLI  347



>ref|XP_007509251.1| porphobilinogen deaminase [Bathycoccus prasinos]
 emb|CCO19708.1| porphobilinogen deaminase [Bathycoccus prasinos]
Length=376

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR   +G  +F GL AS DGT ++ TSR+G ++ +D +  G D G EL 
Sbjct  296  DGSCRTPIAANARMV-NGHLVFDGLIASLDGTEILRTSREGSWSADDVLAAGTDAGDELK  354

Query  148  LQAGPGFFGNXIILQ  104
             +A   FF N   +Q
Sbjct  355  AKAPKDFFANVPEMQ  369



>gb|AEN75260.1| porphobilinogen deaminase [Chromerida sp. RM11]
Length=218

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIAG AR   DG   F+GL ASPDG R+I   ++GP    D V +G+  G+EL 
Sbjct  130  DGNCRTPIAGQARVEPDGRLKFRGLIASPDGKRIINVDKEGPA--QDAVNIGKQAGEELR  187

Query  148  LQAGPGFFGNXIILQIGSQHLMS  80
               G  F    I  Q+G   L +
Sbjct  188  ATCGEEFL-KEIQEQVGQAFLKT  209



>ref|WP_024351921.1| porphobilinogen deaminase [Aurantimonas coralicida]
Length=311

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA +A   EDG     G+  +PDG+R+ ET R G  T  D   +G   G+++L
Sbjct  241  DGSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTGIAT--DAEALGRLAGRDVL  298

Query  148  LQAGPGFF  125
              AGPGFF
Sbjct  299  DAAGPGFF  306



>ref|XP_005843555.1| hypothetical protein CHLNCDRAFT_33052 [Chlorella variabilis]
 gb|EFN51453.1| hypothetical protein CHLNCDRAFT_33052 [Chlorella variabilis]
Length=361

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A +  DG   F+GL ++PDG ++ ET+R G  T ++   +G+D G EL 
Sbjct  291  DGSCRTPIAGWAHKA-DGQLAFRGLVSTPDGKKMYETTRTGSLTEDEARAIGQDAGTELK  349

Query  148  LQA  140
             QA
Sbjct  350  QQA  352



>ref|WP_008616862.1| porphobilinogen deaminase [Magnetospirillum sp. SO-1]
 gb|EME70191.1| porphobilinogen deaminase [Magnetospirillum sp. SO-1]
Length=315

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD + F+GL  SPDGT++   SR G     D   MG+D  +EL
Sbjct  245  DGSCRTPIAALA--TLDGDRLSFRGLIVSPDGTKIHAASRTGSRA--DAEAMGKDAAEEL  300

Query  151  LLQAGPGFF  125
            + QAGPGFF
Sbjct  301  IGQAGPGFF  309



>gb|EWM30321.1| porphobilinogen deaminase [Nannochloropsis gaditana]
Length=364

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+C+TPIAG AR  ED    FKGL A PDGT++ ET + G   L D V +G + G++L 
Sbjct  283  DGNCKTPIAGQARVIED-KLHFKGLVAMPDGTQMFETEKVG--ALADAVKIGREAGEDLK  339

Query  148  LQAGPGFF  125
             QAGP FF
Sbjct  340  EQAGPEFF  347



>ref|WP_009869955.1| COG0181: Porphobilinogen deaminase [Magnetospirillum magnetotacticum]
 gb|KIL97980.1| Porphobilinogen deaminase [Magnetospirillum magnetotacticum MS-1]
Length=315

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD + F+GL  SPDGT +  TSR G  + +D   MG+D  +EL
Sbjct  245  DGSCRTPIAALAVL--DGDHLSFRGLIVSPDGTAIHATSRSG--SRSDAEAMGKDAAEEL  300

Query  151  LLQAGPGFF  125
            +  AGPGFF
Sbjct  301  IKVAGPGFF  309



>ref|WP_009211454.1| porphobilinogen deaminase [Aurantimonas manganoxydans]
 gb|EAS48485.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
Length=311

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA +A   EDG     G+  +PDG+R+ ET R G     D   +G   G+++L
Sbjct  241  DGSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTG--IAADAEALGRLAGRDVL  298

Query  148  LQAGPGFF  125
              AGPGFF
Sbjct  299  DAAGPGFF  306



>dbj|BAE53224.1| Porphobilinogen deaminase [Magnetospirillum magneticum AMB-1]
Length=262

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD + F+GL  SPDGT V  T+R G     D   MG+D  +EL
Sbjct  192  DGSCRTPIAALAEL--DGDRLSFRGLIVSPDGTTVHATARSGSRA--DAEAMGKDAAEEL  247

Query  151  LLQAGPGFF  125
            +  AGPGFF
Sbjct  248  IKVAGPGFF  256



>ref|WP_014415752.1| porphobilinogen deaminase [Rhodospirillum photometricum]
 emb|CCG09121.1| Porphobilinogen deaminase [Rhodospirillum photometricum DSM 122]
Length=318

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD----CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXG  161
            DGSCRTPI G AR  + G       F+G+  SPDG  + +T+R+G  ++ + V +G+D G
Sbjct  244  DGSCRTPIGGLARVSDFGTDQARVFFRGMIISPDGKVIHQTTREG--SVAEAVALGDDAG  301

Query  160  KELLLQAGPGFF  125
             ELL +AGP FF
Sbjct  302  AELLAKAGPNFF  313



>ref|XP_003056550.1| porphobilinogen deaminase, chloroplast precursor [Micromonas 
pusilla CCMP1545]
 gb|EEH59926.1| porphobilinogen deaminase, chloroplast precursor [Micromonas 
pusilla CCMP1545]
Length=376

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA +  + +  F+GL AS DG +++ET+R   ++  D +  G+D G EL 
Sbjct  300  DGSCRTPIAGYAYKSGN-NLEFRGLVASLDGKQILETTRSSNWSFTDAIDAGKDAGNELK  358

Query  148  LQAGPGFFGNXI  113
              A   FF N +
Sbjct  359  ALAPSEFFENLL  370



>ref|WP_043745666.1| porphobilinogen deaminase [Magnetospirillum magneticum]
Length=315

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD + F+GL  SPDGT V  T+R G     D   MG+D  +EL
Sbjct  245  DGSCRTPIAALAEL--DGDRLSFRGLIVSPDGTTVHATARSGSRA--DAEAMGKDAAEEL  300

Query  151  LLQAGPGFF  125
            +  AGPGFF
Sbjct  301  IKVAGPGFF  309



>gb|KAI96092.1| porphobilinogen deaminase [Rhodomicrobium udaipurense JA643]
Length=304

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR    G   FKG   +PDG R+ ET+R+G  + ND   MG+D  +EL 
Sbjct  235  DGSCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELY  292

Query  148  LQAGPGFF  125
             + G   F
Sbjct  293  ARGGKDVF  300



>ref|WP_037233090.1| porphobilinogen deaminase [Rhodomicrobium udaipurense]
Length=313

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR    G   FKG   +PDG R+ ET+R+G  + ND   MG+D  +EL 
Sbjct  244  DGSCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELY  301

Query  148  LQAGPGFF  125
             + G   F
Sbjct  302  ARGGKDVF  309



>ref|WP_013419820.1| porphobilinogen deaminase [Rhodomicrobium vannielii]
 gb|ADP71438.1| porphobilinogen deaminase [Rhodomicrobium vannielii ATCC 17100]
Length=313

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR    G   FKG   +PDG R+ ET+R+G  + ND   MG+D  +EL 
Sbjct  244  DGSCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREG--SANDAAAMGKDAAQELY  301

Query  148  LQAGPGFF  125
             + G   F
Sbjct  302  ARGGKDVF  309



>ref|XP_010456444.1| PREDICTED: porphobilinogen deaminase, chloroplastic-like [Camelina 
sativa]
Length=367

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIET  218
            DGSCRTPIAGYA + E+G+C F+GL ASPDGT+  +T
Sbjct  328  DGSCRTPIAGYAAKDEEGNCFFRGLVASPDGTKGTKT  364



>ref|WP_011391315.1| porphobilinogen deaminase [Rhodospirillum rubrum]
 ref|YP_428649.1| porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
 gb|ABC24362.1| Porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
 gb|AEO50113.1| porphobilinogen deaminase [Rhodospirillum rubrum F11]
Length=321

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 6/72 (8%)
 Frame = -2

Query  328  DGSCRTPIAGYAR--RGED--GDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXG  161
            DGSCRTPI G AR  R ED  G   F+G+    DG  + +T+R+G     D + +G+D G
Sbjct  247  DGSCRTPIGGLARLKRVEDPSGTVFFRGMIIRTDGKVIHQTTREGLAA--DGIALGDDAG  304

Query  160  KELLLQAGPGFF  125
             ELL +AGPGFF
Sbjct  305  AELLAKAGPGFF  316



>ref|WP_021132426.1| porphobilinogen deaminase [Phaeospirillum fulvum]
 gb|EPY01527.1| porphobilinogen deaminase [Phaeospirillum fulvum MGU-K5]
Length=322

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD   F+GL  SPDG  V  TSR G  T  D V M  D  +EL
Sbjct  253  DGSCRTPIAALATL--DGDQMFFRGLIVSPDGKTVHSTSRTG--TRADGVAMAIDAAEEL  308

Query  151  LLQAGPGFF  125
               AGPGFF
Sbjct  309  FKAAGPGFF  317



>gb|ABD51930.1| chloroplast hydroxymethylbilane synthase [Guillardia theta]
Length=346

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC+TPIAG AR   DG   F+GL ASPDG+++    R G   ++D + +G+D G+E+ 
Sbjct  258  DGSCKTPIAGQARII-DGKIHFRGLVASPDGSKIFRAERVG--DVSDYMKIGKDAGEEIR  314

Query  148  LQAGPGFFGNXI  113
             +AG  FF + +
Sbjct  315  KEAGEQFFADLL  326



>ref|XP_005704560.1| hydroxymethylbilane synthase [Galdieria sulphuraria]
 gb|EME28040.1| hydroxymethylbilane synthase [Galdieria sulphuraria]
Length=378

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A   +D    F+GL A PDG+ ++ET + G   L + V +G++ G+EL 
Sbjct  307  DGSCRTPIAGQAWITKDNKLHFRGLVAYPDGSSLVETFKAG--ELVNNVEIGKEAGEELR  364

Query  148  LQAGPGFF  125
             + G  FF
Sbjct  365  AKIGENFF  372



>ref|XP_005834478.1| hypothetical protein GUITHDRAFT_162740 [Guillardia theta CCMP2712]
 gb|EKX47498.1| hypothetical protein GUITHDRAFT_162740 [Guillardia theta CCMP2712]
Length=377

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC+TPIAG AR   DG   F+GL ASPDG+++    R G   ++D + +G+D G+E+ 
Sbjct  289  DGSCKTPIAGQARII-DGKIHFRGLVASPDGSKIFRAERVG--DVSDYMKIGKDAGEEIR  345

Query  148  LQAGPGFFGNXI  113
             +AG  FF + +
Sbjct  346  KEAGEQFFADLL  357



>ref|XP_001417948.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96241.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=325

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA +     DG   F+GL AS DG +V+ET+R+G +     +  G+D G EL 
Sbjct  249  DGSCRTPIAAHCHL-VDGKMQFRGLIASLDGKQVLETTREGAWDAASLLDAGKDAGAELK  307

Query  148  LQAGPGFFGNXI  113
             +A   FF N I
Sbjct  308  GKAPADFFANLI  319



>ref|WP_020699129.1| hypothetical protein [Reyranella massiliensis]
Length=308

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+A     GD +  +GL A PDG+ VI T R+G  +  D   MG D G EL
Sbjct  242  DGSCRTPIAGHAVL--TGDALHLRGLIARPDGSEVIFTERRG--SAADAQAMGRDAGHEL  297

Query  151  LLQAGPGFFGN  119
              + GP FF  
Sbjct  298  KRKGGPDFFAT  308



>ref|WP_024079153.1| hydroxymethylbilane synthase [Magnetospirillum gryphiswaldense]
 emb|CDK98120.1| hydroxymethylbilane synthase [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=315

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD + F+GL  S DG  +   SR+G  T+ D   MG D G+EL
Sbjct  247  DGSCRTPIAALAE--VDGDRLSFRGLIVSLDGRTIHAASRQG--TVGDAHAMGVDAGREL  302

Query  151  LLQAGPGFF  125
            +  AGPGFF
Sbjct  303  IQVAGPGFF  311



>emb|CEF97893.1| Porphobilinogen deaminase, C-terminal [Ostreococcus tauri]
Length=360

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA +     DG   F+GL AS DG  V+ET+R+G +     +  G D G EL 
Sbjct  284  DGSCRTPIAAHCH-NVDGKMQFRGLIASLDGKEVLETTREGAWDAASLLAAGTDAGAELK  342

Query  148  LQAGPGFFGNXI  113
             +A   FF N +
Sbjct  343  GKAPADFFANLL  354



>emb|CBJ30046.1| hydroxymethylbilane synthase, putative chloroplast precursor 
[Ectocarpus siliculosus]
Length=373

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+C+TPIAG AR  E    +F+GL ASPDG +  +T+R+G     D V MG D G EL 
Sbjct  296  DGNCKTPIAGQARM-EGEKLVFRGLIASPDGKQFYDTTREGKP--EDAVAMGHDAGMELK  352

Query  148  LQAGP  134
             +AGP
Sbjct  353  KRAGP  357



>ref|WP_002729267.1| porphobilinogen deaminase [Phaeospirillum molischianum]
 emb|CCG41842.1| Porphobilinogen deaminase, chloroplastic [Phaeospirillum molischianum 
DSM 120]
Length=322

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIF-KGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD +F +GL  SPDG  +  TSR G  +  D V M  D  +EL
Sbjct  253  DGSCRTPIAALATL--DGDTMFFRGLIVSPDGKALHSTSRTG--SRADGVAMAIDAAEEL  308

Query  151  LLQAGPGFF  125
               AGPGFF
Sbjct  309  FKAAGPGFF  317



>ref|WP_026615491.1| porphobilinogen deaminase [Ensifer sp. TW10]
Length=309

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYAR   DG  I F G+  +PDGT     + +G     D  ++G   G+E+
Sbjct  241  DGSCRTPIAGYAR--SDGTHIRFSGMILTPDGTTCHRIAIEGKAA--DATVLGRKAGEEI  296

Query  151  LLQAGPGFFGNXI  113
              +AGPGFF + I
Sbjct  297  RAKAGPGFFSSWI  309



>ref|XP_003079219.1| putative porphobilinogen deaminase (ISS) [Ostreococcus tauri]
Length=441

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA +     DG   F+GL AS DG  V+ET+R+G +     +  G D G EL 
Sbjct  284  DGSCRTPIAAHCH-NVDGKMQFRGLIASLDGKEVLETTREGAWDAASLLAAGTDAGAELK  342

Query  148  LQAGPGFFGNXI  113
             +A   FF N +
Sbjct  343  GKAPADFFANLL  354



>ref|XP_002292986.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
 gb|EED89447.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
Length=330

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+C+TPIAG AR   DG  +FKGL A PDG+   ET   G   + D V +G   G+EL 
Sbjct  249  DGNCKTPIAGQARIV-DGKIVFKGLIAMPDGSLKYETEATGE--IADAVEIGRKAGEELK  305

Query  148  LQAGPGFFGNXIILQIGSQHLM  83
             QAG  FF   +++++  Q ++
Sbjct  306  AQAGEKFF--EMMVEMSPQQVL  325



>ref|WP_036346454.1| porphobilinogen deaminase [Microvirga sp. BSC39]
 gb|KFG70632.1| porphobilinogen deaminase [Microvirga sp. BSC39]
Length=313

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+AR    G+  F+GL   PDG+  +E  R+G  +L D V +G D G EL 
Sbjct  247  DGSCRTPIAGHARL-VGGELEFRGLVLRPDGSESLEAVRRG--SLGDAVALGRDAGSELR  303

Query  148  LQAGPGFF  125
             +  P F 
Sbjct  304  ARMPPDFL  311



>ref|XP_005782931.1| hypothetical protein EMIHUDRAFT_423968 [Emiliania huxleyi CCMP1516]
 gb|EOD30502.1| hypothetical protein EMIHUDRAFT_423968 [Emiliania huxleyi CCMP1516]
Length=388

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIAG A+   DG   F+GL A  DGT V+ TSR GP  L+D   MG + G+EL 
Sbjct  277  DGNCRTPIAGQAKI-VDGQLRFEGLIAKVDGTTVLRTSRTGP--LSDAAKMGTEAGEELK  333

Query  148  LQAG---PGFFGNXIIL  107
             + G     FFG   +L
Sbjct  334  AKVGGDALAFFGEGEVL  350



>ref|XP_005714552.1| unnamed protein product [Chondrus crispus]
 emb|CDF34733.1| unnamed protein product [Chondrus crispus]
Length=114

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A   EDG   F+GL A PDG+ V ET + G     D + +G D G EL 
Sbjct  48   DGSCRTPIAGQACI-EDGVLHFRGLVAKPDGSVVFETGKSGKPA--DALAIGTDAGTELK  104

Query  148  LQAGPGFFG  122
             + G  FF 
Sbjct  105  EKMGDNFFA  113



>ref|WP_009539461.1| Porphobilinogen deaminase [Caenispirillum salinarum]
 gb|EKV32200.1| Porphobilinogen deaminase [Caenispirillum salinarum AK4]
Length=314

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPI G+ R        F GL   PDGT ++ET R+GP  +++   + +D GKEL 
Sbjct  244  DGSCRTPIGGWCRFTGPDTIRFDGLVVRPDGTGLLETFREGP--VSEAHALADDAGKELK  301

Query  148  LQAGPGFF  125
               GP +F
Sbjct  302  AHCGPEYF  309



>ref|WP_028957118.1| porphobilinogen deaminase [Sulfitobacter sp. 20_GPM-1509m]
Length=312

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+  I+ +R GP  ++D   MG D  +EL
Sbjct  245  DGSCETPIAGLALL--DGDTLSLRGEVLRPDGSEAIKGTRTGP--ISDGAAMGRDLAQEL  300

Query  151  LLQAGPGFF  125
            L +AGP FF
Sbjct  301  LAKAGPDFF  309



>ref|WP_027301693.1| porphobilinogen deaminase [Rhodospirillales bacterium URHD0088]
Length=312

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYAR-RGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A  RG  G    + +  SPDGT+   TSR G   + D V +G D G EL
Sbjct  244  DGSCRTPIAALAEIRG--GILALRAMVISPDGTQCHRTSRHG--AVGDAVALGGDAGAEL  299

Query  151  LLQAGPGFF  125
               AGPGFF
Sbjct  300  RRLAGPGFF  308



>ref|WP_029349283.1| porphobilinogen deaminase [Mesorhizobium ciceri]
Length=308

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A     G  +F GL  SPDGT+  E   +GP  + D   +GED  + + 
Sbjct  240  DGSCRTPIAGHATIS-GGTVVFAGLIISPDGTQSHEVKAEGP--VQDAAHIGEDAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_019404925.1| hypothetical protein [Chelatococcus sp. GW1]
Length=309

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG AR  E     F+G+  +PDG+  +   R GP  + + + +GED G+E++
Sbjct  243  DGSCRTPIAGLARV-EGAGLSFRGMLLAPDGSDWVAVERSGP--IAEALGLGEDAGREVV  299

Query  148  LQAGPGFFGN  119
             +A P   G 
Sbjct  300  ARARPALLGK  309



>gb|EEB86449.1| porphobilinogen deaminase [Roseobacter sp. GAI101]
Length=297

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+ VI   R GP  + D   MG D  +EL
Sbjct  225  DGSCETPIAGLATL--DGDTLHLRGEVLRPDGSEVISGDRSGP--IGDGGQMGVDLAREL  280

Query  151  LLQAGPGFF  125
            L QAGP FF
Sbjct  281  LSQAGPNFF  289



>ref|WP_029058080.1| porphobilinogen deaminase [Stappia stellulata]
Length=311

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC+TPI G A+   DGD I   GL   PDG+   ET R GP +  D   +G+D G EL
Sbjct  245  DGSCQTPIGGLAKL--DGDRIRLDGLILRPDGSEAHETFRDGPAS--DAAALGQDAGAEL  300

Query  151  LLQAGPGFF  125
              + GPGFF
Sbjct  301  KRRGGPGFF  309



>ref|WP_037228429.1| porphobilinogen deaminase [Roseobacter sp. GAI101]
Length=319

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+ VI   R GP  + D   MG D  +EL
Sbjct  247  DGSCETPIAGLATL--DGDTLHLRGEVLRPDGSEVISGDRSGP--IGDGGQMGVDLAREL  302

Query  151  LLQAGPGFF  125
            L QAGP FF
Sbjct  303  LSQAGPNFF  311



>gb|EJK45103.1| hypothetical protein THAOC_36301 [Thalassiosira oceanica]
Length=361

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+C+TPIAG AR   DG  +F+GL A PDG+   ET   G   + D V +G   G+EL 
Sbjct  280  DGNCKTPIAGQARII-DGKIVFRGLIAMPDGSEKYETEATG--AIEDAVEIGRKAGEELK  336

Query  148  LQAGPGFFGNXIILQIGSQHLM  83
             +AG  FF   +++++  Q ++
Sbjct  337  ERAGDKFF--QMMVEMSPQQVL  356



>ref|WP_012110243.1| porphobilinogen deaminase [Parvibaculum lavamentivorans]
 gb|ABS62969.1| porphobilinogen deaminase [Parvibaculum lavamentivorans DS-1]
Length=308

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A     GD +  + +  +PDG  + ET R+G     D VL+G+D G+EL
Sbjct  241  DGSCRTPIAALAEIS--GDHMRLRTMILTPDGAEIHETEREGLAA--DAVLLGQDAGEEL  296

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  297  KGRAGPHFF  305



>ref|WP_029353509.1| porphobilinogen deaminase [Bosea sp. 117]
Length=309

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A+  +D +  F+G+  + DG+   ET+R+GP    + V +G D G+E+ 
Sbjct  243  DGSCRTPIAGLAQVTDD-EISFRGMLLATDGSAAFETARRGPRA--EAVRLGADAGREVR  299

Query  148  LQAGPGFF  125
              A PG  
Sbjct  300  AAAPPGLI  307



>ref|WP_024923093.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
Length=308

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DG+  +F GL  +PDGT + E +R+G     D  L+G + G ++
Sbjct  240  DGSCRTPIAGYA--TVDGERLVFSGLILTPDGTDICEVAREG--LAADAALIGAEAGADV  295

Query  151  LLQAGPGFF  125
              +AG  FF
Sbjct  296  RARAGAEFF  304



>ref|WP_026620063.1| porphobilinogen deaminase [Ensifer sp. WSM1721]
Length=309

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 5/73 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYAR   DG  I F G+  +PDGT     + +G     +   +G   G+E+
Sbjct  241  DGSCRTPIAGYAR--SDGTHIRFSGMILTPDGTTCHRIAIEGKAA--EATELGRKAGEEI  296

Query  151  LLQAGPGFFGNXI  113
              +AGPGFF + I
Sbjct  297  RAKAGPGFFSSWI  309



>ref|WP_037451402.1| porphobilinogen deaminase [Skermanella stibiiresistens]
 gb|EWY40526.1| porphobilinogen deaminase [Skermanella stibiiresistens SB22]
Length=309

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A     G    + + A P G+RV+ T R G  +  D V MG D G+EL 
Sbjct  242  DGSCRTPIAGLAVLDAAGALSLEAMVADPAGSRVLTTKRSG--SAADAVAMGRDAGEELK  299

Query  148  LQAGPGFF  125
                P FF
Sbjct  300  SLMPPDFF  307



>ref|WP_008873487.1| hydroxymethylbilane synthase [Mesorhizobium metallidurans]
 emb|CCV04512.1| hydroxymethylbilane synthase [Mesorhizobium metallidurans STM 
2683]
Length=308

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A   E+    F GL  SPDGT   E   +GP    D  L+G D  + + 
Sbjct  240  DGSCRTPIAGHATIAEE-TVFFAGLIISPDGTDWHEVKTQGPA--GDAALIGADAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_022708022.1| porphobilinogen deaminase [Paracoccus zeaxanthinifaciens]
Length=309

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD  I +G    PDG+ V   +R+G   ++D   MG+D   EL
Sbjct  243  DGSCETPIAGLA--DLDGDRLILRGEILRPDGSEVHAATREG--AISDGAAMGQDLADEL  298

Query  151  LLQAGPGFF  125
            L +AGPGF 
Sbjct  299  LKRAGPGFL  307



>ref|WP_028737157.1| porphobilinogen deaminase [Rhizobium selenitireducens]
Length=309

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYAR   DGD + F G+  +PDG R  E    G    +D V +G   G+ +
Sbjct  241  DGSCRTPIAGYAR--CDGDKLTFSGMILTPDGARFHEIETGGAR--SDAVAVGRTAGEAI  296

Query  151  LLQAGPGFFGN  119
              +AGP FF +
Sbjct  297  RAKAGPDFFAS  307



>ref|WP_023760927.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC252B00]
 gb|ESY70688.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC252B00]
Length=308

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   EDG   F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGYATI-EDGKLSFAGLIISPDGTQSHTVELQGPA--QDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_036485948.1| porphobilinogen deaminase [Nitratireductor basaltis]
 gb|KFB08793.1| Porphobilinogen deaminase [Nitratireductor basaltis]
Length=309

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG A+  +DG   F G+  +PDG  V E +  G  +  D + +G D G  + 
Sbjct  241  DGSCRTPIAGEAKL-DDGRLNFYGMILTPDGREVHEVTGDGAAS--DAIAIGRDAGARIR  297

Query  148  LQAGPGFFGNXI  113
              AGPGFF + +
Sbjct  298  DSAGPGFFTDWV  309



>ref|WP_039188124.1| porphobilinogen deaminase [Aureimonas altamirensis]
 gb|KHJ55305.1| porphobilinogen deaminase [Aureimonas altamirensis]
Length=311

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR   DG     G+  +PDGTR+ E    GP    +  L+G+  G  LL
Sbjct  242  DGSCRTPIAALARLEGDG-LGLHGMILTPDGTRMFEGRMSGPVA--EAALVGDALGAALL  298

Query  148  LQAGPGFF  125
             +AGP FF
Sbjct  299  DRAGPDFF  306



>ref|WP_007067943.1| porphobilinogen deaminase [Fulvimarina pelagi]
 gb|EAU41568.1| porphobilinogen deaminase [Fulvimarina pelagi HTCC2506]
Length=316

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  A   + G   F G+   PDGT V E   +G    +  V +GE  G+ +L
Sbjct  243  DGSCRTPIAARAVLWDSGRIAFHGMILRPDGTEVHEVHDEGDA--DGAVALGERAGRSVL  300

Query  148  LQAGPGFF  125
              AGP FF
Sbjct  301  EAAGPHFF  308



>gb|EMS48955.1| Porphobilinogen deaminase, chloroplastic [Triticum urartu]
Length=305

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGT  233
            DG+CRTPIA YA R +DG+C F+GL ASPDG+
Sbjct  268  DGNCRTPIAAYAYRDKDGNCSFRGLLASPDGS  299



>ref|WP_037927918.1| porphobilinogen deaminase [Sulfitobacter pseudonitzschiae]
 gb|KEJ95030.1| porphobilinogen deaminase [Sulfitobacter pseudonitzschiae]
Length=312

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+ VI+ +R GP        MG D  +EL
Sbjct  245  DGSCETPIAGLAVL--DGDTLTLRGEVLRPDGSEVIKGTRTGPIAAGAD--MGRDLAQEL  300

Query  151  LLQAGPGFF  125
            L  AGP FF
Sbjct  301  LASAGPDFF  309



>ref|WP_005850014.1| MULTISPECIES: porphobilinogen deaminase [Sulfitobacter]
 gb|EAP85297.1| porphobilinogen deaminase [Sulfitobacter sp. EE-36]
 gb|KAJ29364.1| porphobilinogen deaminase [Sulfitobacter pontiacus 3SOLIMAR09]
 gb|KFC28259.1| porphobilinogen deaminase [Sulfitobacter sp. CB2047]
Length=317

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+  I   R GP        MG D  ++L
Sbjct  247  DGSCETPIAGLATL--DGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQ--MGVDLAQDL  302

Query  151  LLQAGPGFF  125
            L QAGPGFF
Sbjct  303  LAQAGPGFF  311



>ref|WP_039540721.1| porphobilinogen deaminase [Ruegeria sp. ANG-R]
 gb|KIC40148.1| porphobilinogen deaminase [Ruegeria sp. ANG-R]
Length=318

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC TPIAG A+   DG    +G    PDG+  I     GP  L D   +G+   + LL
Sbjct  251  DGSCETPIAGLAQ-VRDGQLHLRGEVLRPDGSEAISEDAAGP--LGDGAELGQSMAESLL  307

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  308  KQAGPGFF  315



>ref|WP_009825369.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
 gb|EAP82088.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
Length=317

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+  I   R GP        MG D  ++L
Sbjct  247  DGSCETPIAGLATL--DGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQ--MGVDLAQDL  302

Query  151  LLQAGPGFF  125
            L QAGPGFF
Sbjct  303  LAQAGPGFF  311



>ref|WP_042775898.1| porphobilinogen deaminase [Sinorhizobium fredii]
Length=309

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     D   +G   G+E+
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTSHRVEIDGKAA--DATELGRRAGEEI  296

Query  151  LLQAGPGFFGN  119
             ++AGPGFF +
Sbjct  297  RVKAGPGFFSS  307



>ref|WP_037393857.1| porphobilinogen deaminase [Sinorhizobium fredii]
Length=309

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     D   +G   G+E+
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTSHRVEIDGKAA--DATELGRRAGEEI  296

Query  151  LLQAGPGFFGN  119
             ++AGPGFF +
Sbjct  297  RVKAGPGFFSS  307



>ref|WP_037128273.1| porphobilinogen deaminase [Rhizobium sp. CF097]
Length=309

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DG+ I F G+  +PDG++    + +G  +  D   +G   G+++
Sbjct  241  DGSCRTPIAGYA--VSDGETIRFSGMILTPDGSQHFRVATEGKAS--DAEQLGARAGEDI  296

Query  151  LLQAGPGFFGN  119
             L+AGP FF +
Sbjct  297  RLEAGPDFFSS  307



>ref|WP_037208367.1| porphobilinogen deaminase [Rhizobium sp. YR295]
Length=309

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DGD I F G+  +PDG++    + +G     D   +G   G ++
Sbjct  241  DGSCRTPIAGYA--VSDGDTIRFSGMILTPDGSQHFRVTTEGKAV--DAEQLGAKAGDDI  296

Query  151  LLQAGPGFFGN  119
             L AGP FF +
Sbjct  297  RLDAGPDFFSS  307



>ref|WP_013892312.1| porphobilinogen deaminase [Mesorhizobium opportunistum]
 gb|AEH85573.1| porphobilinogen deaminase [Mesorhizobium opportunistum WSM2075]
Length=308

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   E G   F GL  SPDGT+      +GP    D  L+G +  + + 
Sbjct  240  DGSCRTPIAGYAAI-EGGKLSFAGLIISPDGTQSHTIDLQGPA--QDAALIGTEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>gb|EDQ35185.2| porphobilinogen deaminase [Hoeflea phototrophica DFL-43]
Length=307

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A   E+G   F G+  +PDGT   +   +GP    D   +G D G E+ 
Sbjct  239  DGSCRTPIAGHATL-ENGQVSFYGMILTPDGTTFHDIRVQGPAA--DAAQLGADAGAEVR  295

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  296  ARAGSKFF  303



>ref|WP_007199416.1| porphobilinogen deaminase [Hoeflea phototrophica]
Length=312

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A   E+G   F G+  +PDGT   +   +GP    D   +G D G E+ 
Sbjct  244  DGSCRTPIAGHATL-ENGQVSFYGMILTPDGTTFHDIRVQGPAA--DAAQLGADAGAEVR  300

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  301  ARAGSKFF  308



>ref|WP_028001771.1| porphobilinogen deaminase [Sinorhizobium arboris]
Length=309

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTCHQIEIDG--RAADAARLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_023784154.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC220B00]
 gb|ESY82591.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC220B00]
Length=308

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA  G  G   F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGYAAIGA-GKLSFAGLIISPDGTQSHTVELQGPA--QDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AEAGEKFF  304



>gb|ESR22575.1| Porphobilinogen deaminase [Lutibaculum baratangense AMV1]
Length=310

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+A    +GD I F GL  SPDG     TSR G   + +   +G+D  +E+
Sbjct  240  DGSCRTPIAGHA--TVEGDRISFSGLVISPDGRTEFATSRSG--AVGEAGALGQDAAEEI  295

Query  151  LLQAGPGFFGN  119
            + +AG  F   
Sbjct  296  IAEAGEAFLAE  306



>ref|WP_044428213.1| porphobilinogen deaminase [Skermanella aerolata]
 gb|KJB95725.1| porphobilinogen deaminase [Skermanella aerolata KACC 11604]
Length=309

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  A+    G    + L A P G+RV+ T R G  + +D   +G D G+EL 
Sbjct  242  DGSCRTPIAALAQLDGTGALTLEALVADPAGSRVLRTDRSG--SASDAEALGRDAGEELK  299

Query  148  LQAGPGFF  125
                P FF
Sbjct  300  SLMPPDFF  307



>ref|WP_040486198.1| porphobilinogen deaminase [Lutibaculum baratangense]
Length=309

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+A    +GD I F GL  SPDG     TSR G   + +   +G+D  +E+
Sbjct  239  DGSCRTPIAGHA--TVEGDRISFSGLVISPDGRTEFATSRSG--AVGEAGALGQDAAEEI  294

Query  151  LLQAGPGFFGN  119
            + +AG  F   
Sbjct  295  IAEAGEAFLAE  305



>ref|WP_007008388.1| porphobilinogen deaminase [Nitratireductor aquibiodomus]
 gb|EIM75031.1| porphobilinogen deaminase [Nitratireductor aquibiodomus RA22]
Length=309

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG AR   DGD + F GL  +PDG    E + +G   + D V +G + G E+
Sbjct  241  DGSCRTPIAGLARI--DGDTLRFSGLILTPDGRETHEIATEG--AVADAVRLGAEAGAEI  296

Query  151  LLQAGPGFF  125
              +AG  FF
Sbjct  297  REKAGTRFF  305



>ref|WP_027316789.1| porphobilinogen deaminase [Microvirga flocculans]
Length=308

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+AR   + D   +GL   PDG+  +ET R+G    +D   +G D G EL 
Sbjct  242  DGSCRTPIAGHARLIGN-DLEIRGLVLRPDGSESLETVRRGAP--DDAAALGRDAGSELR  298

Query  148  LQAGPGFF  125
             +   GF 
Sbjct  299  ARMPAGFL  306



>ref|WP_041414721.1| porphobilinogen deaminase [Sinorhizobium fredii]
Length=309

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     D   +G   G+E+
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTCHRIEIDGKAA--DATELGRRAGEEI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_043539256.1| porphobilinogen deaminase [Salinarimonas rosea]
Length=317

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 5/70 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+AR   DGD I  KGL   PDG+  +E   + P  L D   +G D G  +
Sbjct  248  DGSCRTPIAGHARL--DGDRIRLKGLVLRPDGSEAVEDEGEAP--LADAARLGADLGARI  303

Query  151  LLQAGPGFFG  122
              +   GFF 
Sbjct  304  KARLPAGFFA  313



>gb|AFL54109.1| porphobilinogen deaminase HemC [Sinorhizobium fredii USDA 257]
Length=330

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     D   +G   G+E+
Sbjct  262  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTCHRIEIDGKAA--DATELGRRAGEEI  317

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  318  RAKAGPGFFSS  328



>ref|WP_020020570.1| hypothetical protein [alpha proteobacterium SCGC AAA160-J14]
Length=304

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CR+PI+  A    D D    G  A PDG++VI++  KG     D +L+GE  GKEL+
Sbjct  237  DGTCRSPISSSAYIINDVDLFLYGAIAKPDGSKVIKSEIKGSK--KDAILLGEQLGKELI  294

Query  148  LQA  140
             ++
Sbjct  295  AKS  297



>ref|WP_006327152.1| hydroxymethylbilane synthase [Mesorhizobium sp. STM 4661]
 emb|CCV10692.1| hydroxymethylbilane synthase [Mesorhizobium sp. STM 4661]
Length=308

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A     G   F GL  SPDGT   E   +GP    D  L+G D  + + 
Sbjct  240  DGSCRTPIAGHATIS-GGTLSFAGLIISPDGTDWHEVETQGPA--GDAALIGADAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_029959243.1| porphobilinogen deaminase [Ensifer sp. USDA 6670]
Length=309

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTCHKIEIDG--RAEDAERLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_018097313.1| porphobilinogen deaminase [Sinorhizobium meliloti]
Length=309

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTCHQIEIDG--RAADAERLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_014330123.1| porphobilinogen deaminase [Sinorhizobium fredii]
 emb|CCE97726.1| hemC [Sinorhizobium fredii HH103]
Length=309

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     +   +G   G+E+
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTSHRVEIDG--KAQEATELGRKAGEEI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_037097330.1| porphobilinogen deaminase [Rhizobium sp. OK665]
Length=309

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 5/73 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DG+ I F G+  +PDG+     S +G     D   +G   G ++
Sbjct  241  DGSCRTPIAGYA--VSDGENIRFSGMVLTPDGSEYFRVSTEGKAA--DAERLGAKAGGDI  296

Query  151  LLQAGPGFFGNXI  113
             L AGP FF + +
Sbjct  297  RLDAGPDFFSSWV  309



>ref|WP_037429512.1| porphobilinogen deaminase [Sinorhizobium fredii]
Length=309

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     +   +G   G+E+
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTSHRVEIDG--KAQEATELGRKAGEEI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_017265062.1| porphobilinogen deaminase [Sinorhizobium meliloti]
Length=308

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  240  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTSHQIEIDG--RAADAERLGQEAGERI  295

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  296  RAKAGPGFFSS  306



>ref|WP_010970392.1| porphobilinogen deaminase [Sinorhizobium meliloti]
 ref|NP_387185.1| porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 sp|Q92LH7.1|HEM3_RHIME RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName: 
Full=Hydroxymethylbilane synthase; Short=HMBS; AltName: Full=Pre-uroporphyrinogen 
synthase [Sinorhizobium meliloti 1021]
 emb|CAC47658.1| Probable porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 gb|AEG05803.1| Porphobilinogen deaminase [Sinorhizobium meliloti BL225C]
 gb|AEG54839.1| Porphobilinogen deaminase [Sinorhizobium meliloti AK83]
 gb|AEH80497.1| probabable porphobilinogen deaminase protein [Sinorhizobium meliloti 
SM11]
 emb|CCM68980.1| porphobilinogen deaminase [Sinorhizobium meliloti Rm41]
 gb|AGA08106.1| porphobilinogen deaminase [Sinorhizobium meliloti GR4]
 gb|AGG75666.1| putative porphobilinogen deaminase [Sinorhizobium meliloti 2011]
 emb|CDH87220.1| putative PORPHOBILINOGEN DEAMINASE PROTEIN [Sinorhizobium meliloti 
RU11/001]
 gb|AIM01017.1| porphobilinogen deaminase [Sinorhizobium meliloti]
Length=309

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTSHQIEIDG--RAADAERLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_027042906.1| porphobilinogen deaminase [Mesorhizobium sp. URHC0008]
Length=308

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   E G   F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGYAAI-EAGKLNFAGLIISPDGTQSHTVELQGPA--QDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_027992435.1| porphobilinogen deaminase [Sinorhizobium meliloti]
Length=309

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTSHQIEIDG--RAADAERLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_017275131.1| porphobilinogen deaminase [Sinorhizobium meliloti]
Length=302

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT   +    G     D   +G++ G+ +
Sbjct  234  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGTTSHQIEIDG--RAADAERLGQEAGERI  289

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  290  RAKAGPGFFSS  300



>ref|WP_032932216.1| porphobilinogen deaminase [Mesorhizobium loti]
Length=308

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A   E G+  F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGHATI-ETGNLSFAGLIISPDGTQSHTVELQGPA--RDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGENFF  304



>ref|WP_043767487.1| porphobilinogen deaminase [Roseivivax isoporae]
 gb|ETX29859.1| porphobilinogen deaminase [Roseivivax isoporae LMG 25204]
Length=319

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD +  +G    PDG+     SR G  ++ D   MG D  +EL
Sbjct  251  DGSCETPIAGLAE--IDGDVLTLRGEVLRPDGSEAHSGSRTG--SVADGPDMGRDLAREL  306

Query  151  LLQAGPGFF  125
            L +AGPGFF
Sbjct  307  LDRAGPGFF  315



>ref|WP_010912273.1| porphobilinogen deaminase [Mesorhizobium loti]
 sp|Q98EI7.1|HEM3_RHILO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName: 
Full=Hydroxymethylbilane synthase; Short=HMBS; AltName: Full=Pre-uroporphyrinogen 
synthase [Mesorhizobium loti MAFF303099]
 dbj|BAB50931.1| hydroxymethylbilane synthase [Mesorhizobium loti MAFF303099]
Length=308

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A   E G+  F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGHATI-ETGNLSFAGLIISPDGTQSHTVELQGPA--QDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  AKAGEKFF  304



>ref|WP_010657552.1| porphobilinogen deaminase [Ochrobactrum anthropi]
 gb|EXL03833.1| porphobilinogen deaminase [Ochrobactrum anthropi]
Length=314

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    +GD + F G+   PDG+   E   +GP +  +  ++G++  + L
Sbjct  246  DGSCRTPIAGLA--TVNGDTVSFHGMILKPDGSEAHEIRTEGPAS--NAAVLGKEAAEHL  301

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  302  RAKAGPQFF  310



>ref|WP_008384225.1| porphobilinogen deaminase [Rhodovulum sp. PH10]
 gb|EJW12661.1| Porphobilinogen deaminase [Rhodovulum sp. PH10]
Length=310

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 5/70 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+A    DG+ +  +GL    DG+   ETSR G  T+ +   +G D G EL
Sbjct  244  DGSCRTPIAGHAT--VDGERLALRGLIVKTDGSVAHETSRAG--TVGEAEALGADAGAEL  299

Query  151  LLQAGPGFFG  122
              + G GFF 
Sbjct  300  KARGGAGFFA  309



>ref|WP_018700087.1| hypothetical protein [Amorphus coralli]
Length=307

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAG+A    DG     GL A+PDG RV E    G     D   +G   G+EL 
Sbjct  239  DGSCRTPIAGHATLSGDG-LSLHGLIATPDGARVEEMVLDGKAA--DAPEIGRAVGRELK  295

Query  148  LQAGPGFFGNXI  113
             + GP FF + +
Sbjct  296  ARGGPEFFVDWV  307



>gb|AEQ18820.1| porphobilinogen deaminase [Chromera velia]
Length=375

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DG+CRTPIAG+A   EDG   FKG+ +S DG+      ++G   + D   MG++   E+ 
Sbjct  288  DGNCRTPIAGHAFITEDGRLKFKGMVSSMDGSEFFYVEKEG--AVEDGPKMGKEAADEIT  345

Query  148  LQAGPGFF  125
             Q G  F 
Sbjct  346  AQCGEEFL  353



>ref|WP_036596440.1| MULTISPECIES: porphobilinogen deaminase [Ochrobactrum]
 gb|KIU69906.1| porphobilinogen deaminase [Ochrobactrum anthropi]
Length=314

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    +GD + F G+   PDG+   E   +GP +  +  ++G++  + L
Sbjct  246  DGSCRTPIAGLA--TVNGDTVSFHGMILKPDGSEAHEIRTEGPAS--NAAVLGKEAAEHL  301

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  302  RAKAGPQFF  310



>ref|WP_003611366.1| porphobilinogen deaminase [Methylosinus trichosporium]
Length=308

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 5/70 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA +AR   DGD + F GL    DG+ + E  R+G     D   +G+D   E+
Sbjct  241  DGSCRTPIAAHAR--VDGDAMEFHGLALRADGSEIYEARRRGAAI--DAARLGDDAANEI  296

Query  151  LLQAGPGFFG  122
            LL+   G  G
Sbjct  297  LLRLPHGVAG  306



>ref|WP_011567549.1| porphobilinogen deaminase [Roseobacter denitrificans]
 gb|ABG30929.1| porphobilinogen deaminase [Roseobacter denitrificans OCh 114]
Length=314

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A     GD +  +G    PDG+  +   R GP  ++D   MG D  ++L
Sbjct  247  DGSCETPIAGLAELS--GDHLRLRGEVLRPDGSEALNGERSGP--ISDGAAMGRDLAEKL  302

Query  151  LLQAGPGFF  125
            L +AGP FF
Sbjct  303  LKRAGPSFF  311



>ref|WP_038012779.1| porphobilinogen deaminase [Terasakiella pusilla]
Length=314

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIF-KGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA  A    DGD I+ +G+ A PDG+ V+    +GP T  D   +G   G+EL
Sbjct  244  DGSCRTPIAALAEI--DGDEIYLRGMLAKPDGSEVLTNEMRGPITDPDG--LGTKAGQEL  299

Query  151  LLQAGPGFFGNXI  113
              +AG  F  + +
Sbjct  300  KDRAGEDFLSDVV  312



>ref|WP_044558528.1| porphobilinogen deaminase [Azospirillum sp. B4]
Length=319

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA  AR   DG+   + +  SPDG  ++ TSR+ P      +  G D G+EL 
Sbjct  251  DGSCRTPIAALARVLPDGEMDLEAMALSPDGRTIVTTSRRFPAA--QALAAGLDAGQELK  308

Query  148  LQAGPGFF  125
             +   G F
Sbjct  309  DRLPAGIF  316



>ref|WP_019645838.1| hypothetical protein [Novispirillum itersonii]
Length=315

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DG  + F+GL A PDG+ V+  S  G    +D   +G    + L
Sbjct  244  DGSCRTPIAGLAELSADGSRLSFRGLMARPDGSEVLSDS--GDAARSDGAALGVQVAERL  301

Query  151  LLQAGPGFF  125
            L +AG  F 
Sbjct  302  LSRAGDAFL  310



>ref|WP_024898562.1| porphobilinogen deaminase [Ochrobactrum rhizosphaerae]
Length=309

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DGD + F+G+  +PDG    E + +G  + +D   +G D  K +
Sbjct  241  DGSCRTPIAGLAI--VDGDKVSFRGMILTPDGREAHEVTAEG--SASDAAALGSDAAKRV  296

Query  151  LLQAGPGFF  125
              QAG  FF
Sbjct  297  RTQAGAKFF  305



>ref|WP_028033627.1| porphobilinogen deaminase [Chelativorans sp. J32]
Length=309

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTP+AG AR   +GD I F G+  +PDG  V E   +G  T  D   +G D G+ +
Sbjct  241  DGSCRTPMAGLAR--VEGDRISFSGMILTPDGGEVHEIDGEGAVT--DAAEIGTDAGRRI  296

Query  151  LLQAGPGFF  125
              +AG GFF
Sbjct  297  RERAGAGFF  305



>ref|WP_037162577.1| porphobilinogen deaminase [Rhizobium sp. CF258]
Length=309

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DGD I F G+  +PDG++    + +G     D   +G   G ++
Sbjct  241  DGSCRTPIAGYAV--SDGDTIRFSGMILTPDGSQHFRVATEGKAV--DAEQLGAKAGDDI  296

Query  151  LLQAGPGFFGN  119
             L  GP FF +
Sbjct  297  RLDGGPDFFSS  307



>ref|WP_040961994.1| porphobilinogen deaminase [Sinorhizobium fredii]
Length=309

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDGT        G     +   +G   G+++
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFSGMILTPDGTTSHRVEIDG--KAQEATELGRKAGEQI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RAKAGPGFFSS  307



>ref|WP_023771864.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
 gb|ESY94233.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC229A00]
 gb|ESY98185.1| porphobilinogen deaminase [Mesorhizobium sp. LNHC209A00]
Length=308

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   E G   F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGYAAI-EAGKLSFAGLIISPDGTQSHTVELQGPA--QDAARIGDEAARSVR  296

Query  148  LQAGPGFF  125
              AG  FF
Sbjct  297  AGAGEKFF  304



>ref|WP_039682060.1| porphobilinogen deaminase [Tateyamaria sp. ANG-S1]
 gb|KIC51909.1| porphobilinogen deaminase [Tateyamaria sp. ANG-S1]
Length=318

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC TPIAG A   ED      G    PDG+     +R+GP  ++D   MG D  +ELL
Sbjct  251  DGSCETPIAGLATI-EDDTLTLMGEVLRPDGSDARSGTRQGP--VSDGAAMGTDLAQELL  307

Query  148  LQAGPGFF  125
              AG GFF
Sbjct  308  KTAGKGFF  315



>ref|WP_026598948.1| porphobilinogen deaminase [Methylocystis sp. LW5]
Length=308

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 5/70 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIA +A+   DG+ I F G+    DG++V E  R+GP    D  L+G+    E+
Sbjct  241  DGSCRTPIAAHAKL--DGEEIEFHGMALRADGSQVYEARRRGPSM--DAALIGDAAANEI  296

Query  151  LLQAGPGFFG  122
            LL+   G  G
Sbjct  297  LLRLPNGVAG  306



>gb|AGA64747.1| Porphobilinogen deaminase [Liberibacter crescens BT-1]
Length=311

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA YA   +D D  F G+  +PDGT   +  R G     + + +G +  +EL 
Sbjct  243  DGSCRTPIAAYA-SCKDEDISFFGMILTPDGTIFHKIHRNGKR--YNAIHIGHEAAEELR  299

Query  148  LQAGPGFF  125
              AG  FF
Sbjct  300  FMAGKQFF  307



>gb|KIX19566.1| porphobilinogen deaminase [Paracoccus sp. 361]
Length=309

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGD-CIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC+TPIAG A    DGD    +G    PDG+ V+   R G    +D   MG D  +EL
Sbjct  243  DGSCQTPIAGLA--TLDGDRMTLRGEILRPDGSEVVAGVRDG--LASDGAAMGTDLAEEL  298

Query  151  LLQAGPGFF  125
            L +AGPGF 
Sbjct  299  LSRAGPGFL  307



>ref|WP_041770687.1| porphobilinogen deaminase [Liberibacter crescens]
Length=309

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIA YA   +D D  F G+  +PDGT   +  R G     + + +G +  +EL 
Sbjct  241  DGSCRTPIAAYA-SCKDEDISFFGMILTPDGTIFHKIHRNGKR--YNAIHIGHEAAEELR  297

Query  148  LQAGPGFF  125
              AG  FF
Sbjct  298  FMAGKQFF  305



>ref|WP_018328620.1| porphobilinogen deaminase [Rhizobium giardinii]
Length=309

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA    DG+ I F G+  +PDG++    + +G     +   +G   G+++
Sbjct  241  DGSCRTPIAGYAV--SDGEAIRFSGMVLTPDGSQHFRVATEGKAV--NAGQLGAKAGEDI  296

Query  151  LLQAGPGFF  125
             L+AGP FF
Sbjct  297  RLEAGPDFF  305



>ref|WP_011049329.1| porphobilinogen deaminase [Ruegeria pomeroyi]
 gb|AAV96872.1| porphobilinogen deaminase [Ruegeria pomeroyi DSS-3]
Length=319

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DG  +  +G    PDG+  I   R G   + D   +G +  +EL
Sbjct  251  DGSCETPIAGLAEL--DGTTLRLRGEVLRPDGSEAITLDRSG--DVADGPALGTEMAREL  306

Query  151  LLQAGPGFF  125
            L QAGPGFF
Sbjct  307  LAQAGPGFF  315



>ref|WP_044043118.1| porphobilinogen deaminase [Octadecabacter antarcticus]
Length=321

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIF-KGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD ++ +G    PDG++V    R+G  T  +   MG++  +EL
Sbjct  251  DGSCETPIAGLAMI--DGDNMWLRGEILKPDGSQVFTGERRGLVT--EGRAMGKELAQEL  306

Query  151  LLQAGPGFF  125
            L QAGP FF
Sbjct  307  LGQAGPDFF  315



>gb|AGI66330.1| porphobilinogen deaminase HemC [Octadecabacter antarcticus 307]
Length=317

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIF-KGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSC TPIAG A    DGD ++ +G    PDG++V    R+G  T  +   MG++  +EL
Sbjct  247  DGSCETPIAGLAMI--DGDNMWLRGEILKPDGSQVFTGERRGLVT--EGRAMGKELAQEL  302

Query  151  LLQAGPGFF  125
            L QAGP FF
Sbjct  303  LGQAGPDFF  311



>ref|WP_007255416.1| porphobilinogen deaminase [Oceanicola granulosus]
 gb|EAR50818.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
Length=313

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSC TPIAG A    DG    +G   + DG+R +  + +    + D   +G D  + LL
Sbjct  246  DGSCETPIAGLAELIGDGRLRLRGEILAHDGSRCL--ADEAEAQIADGAALGTDMARRLL  303

Query  148  LQAGPGFF  125
             QAGPGFF
Sbjct  304  AQAGPGFF  311



>ref|WP_034491541.1| porphobilinogen deaminase [Afifella pfennigii]
Length=308

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG+A+  EDG   F+GL  SPDGT V+E +  G     + +  G D G+++
Sbjct  238  DGSCRTPIAGWAQI-EDGALSFRGLLLSPDGTEVVEGAGNGDAASAEEI--GRDIGRDV  293



>ref|WP_003531176.1| porphobilinogen deaminase [Sinorhizobium meliloti]
 gb|EHK76221.1| porphobilinogen deaminase [Sinorhizobium meliloti CCNWSX0020]
Length=309

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAGYA+   DG  I F G+  +PDG    +    G     D   +G++ G+ +
Sbjct  241  DGSCRTPIAGYAQ--SDGTHIRFAGMILTPDGATSHQIEIDG--RAADAERLGQEAGERI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RTKAGPGFFSS  307



>ref|WP_043619941.1| porphobilinogen deaminase [Ensifer sp. ZNC0028]
Length=309

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DG  + F G+  +PDG      + +G  T  D   +G+  G+E+
Sbjct  241  DGSCRTPIAGLA--TSDGTHLSFSGMILTPDGQTHHRVTIEGKAT--DAEALGQKAGEEI  296

Query  151  LLQAGPGFFGN  119
              +AGPGFF +
Sbjct  297  RTKAGPGFFAS  307



>ref|WP_023730223.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
 gb|ESX97817.1| porphobilinogen deaminase [Mesorhizobium sp. LNJC405B00]
 gb|ESZ03386.1| porphobilinogen deaminase [Mesorhizobium sp. L2C089B000]
Length=307

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA     G  +F GL  SPDGT+  E   +G     D   +G D  + + 
Sbjct  239  DGSCRTPIAGYAMIS-GGRLVFAGLIISPDGTQSHEVKAEGLAL--DAADIGTDAARMVR  295

Query  148  LQAGPGFF  125
            ++AG  FF
Sbjct  296  VKAGETFF  303



>ref|WP_027059449.1| porphobilinogen deaminase [Mesorhizobium loti]
Length=308

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA   + G   F GL  SPDGT+      +GP    D   +G++  + + 
Sbjct  240  DGSCRTPIAGYAAI-DAGKLSFAGLIISPDGTQSHTIELQGPA--QDAARIGDEAARTVR  296

Query  148  LQAGPGFF  125
             +AG  FF
Sbjct  297  ARAGEKFF  304



>ref|WP_021587457.1| porphobilinogen deaminase [Ochrobactrum sp. EGD-AQ16]
 gb|ERI12845.1| porphobilinogen deaminase [Ochrobactrum sp. EGD-AQ16]
Length=314

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DGD + F G+   PDG+   E   +GP  +++   +G +  + +
Sbjct  246  DGSCRTPIAGLA--TVDGDRVSFHGMILKPDGSEAHEIRAEGP--VSNAAALGREAAERI  301

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  302  RAKAGPQFF  310



>ref|WP_006467949.1| porphobilinogen deaminase [Ochrobactrum intermedium]
 gb|EEQ96846.1| porphobilinogen deaminase [Ochrobactrum intermedium LMG 3301]
 gb|ERM02223.1| porphobilinogen deaminase [Ochrobactrum intermedium 229E]
Length=314

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DGD + F G+   PDG+   E   +GP  +++   +G +  + +
Sbjct  246  DGSCRTPIAGLA--TVDGDRVSFHGMILKPDGSEAHEIRAEGP--VSNAAALGREAAERI  301

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  302  RAKAGPQFF  310



>ref|WP_023705005.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
 gb|ESX18682.1| porphobilinogen deaminase [Mesorhizobium sp. LSJC255A00]
 gb|ESX22291.1| porphobilinogen deaminase [Mesorhizobium sp. LSHC440B00]
 gb|ESX33274.1| porphobilinogen deaminase [Mesorhizobium sp. LSHC440A00]
 gb|ESX34255.1| porphobilinogen deaminase [Mesorhizobium sp. LSHC432A00]
 gb|ESX70226.1| porphobilinogen deaminase [Mesorhizobium sp. LSHC414A00]
 gb|ESY41167.1| porphobilinogen deaminase [Mesorhizobium sp. LNJC384A00]
Length=307

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA     G  +F GL  SPDGT+  E   +G     D   +G D  + + 
Sbjct  239  DGSCRTPIAGYATIS-GGRLVFAGLIISPDGTQSHEVKAEGLAL--DAADIGTDAARMVR  295

Query  148  LQAGPGFF  125
            ++AG  FF
Sbjct  296  VKAGETFF  303



>gb|ELT50081.1| porphobilinogen deaminase [Ochrobactrum intermedium M86]
Length=309

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DGD + F G+   PDG+   E   +GP  +++   +G +  + +
Sbjct  241  DGSCRTPIAGLA--TVDGDRVSFHGMILKPDGSEAHEIRAEGP--VSNAAALGREAAERI  296

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  297  RAKAGPQFF  305



>ref|WP_025089941.1| porphobilinogen deaminase [Ochrobactrum intermedium]
Length=314

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCI-FKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKEL  152
            DGSCRTPIAG A    DGD + F G+   PDG+   E   +GP  +++   +G +  + +
Sbjct  246  DGSCRTPIAGLA--TVDGDRVSFHGMILKPDGSEAHEIRAEGP--VSNAAALGREAAERI  301

Query  151  LLQAGPGFF  125
              +AGP FF
Sbjct  302  RAKAGPQFF  310



>ref|WP_023694474.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
 gb|ESW95303.1| porphobilinogen deaminase [Mesorhizobium sp. LSJC268A00]
 gb|ESZ14103.1| porphobilinogen deaminase [Mesorhizobium sp. L2C085B000]
Length=307

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA     G  +F GL  SPDGT+  E   +G     D   +G D  + + 
Sbjct  239  DGSCRTPIAGYATI-SGGRLVFAGLIISPDGTQSHEVKAEGLAL--DAADIGTDAARMVR  295

Query  148  LQAGPGFF  125
            ++AG  FF
Sbjct  296  VKAGETFF  303



>ref|WP_023747363.1| MULTISPECIES: porphobilinogen deaminase [Mesorhizobium]
 gb|ESY30451.1| porphobilinogen deaminase [Mesorhizobium sp. LNJC391B00]
 gb|ESZ57649.1| porphobilinogen deaminase [Mesorhizobium sp. L103C131B0]
Length=307

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = -2

Query  328  DGSCRTPIAGYARRGEDGDCIFKGLXASPDGTRVIETSRKGPYTLNDXVLMGEDXGKELL  149
            DGSCRTPIAGYA     G  +F GL  SPDGT+  E   +G     D   +G D  + + 
Sbjct  239  DGSCRTPIAGYATI-SGGRLVFAGLIISPDGTQSHEVKAEGLAL--DAADIGTDAARMVR  295

Query  148  LQAGPGFF  125
            ++AG  FF
Sbjct  296  VKAGETFF  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566749560160