BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006L15

Length=325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18097.1|  putative serine/threonine protein kinase             65.1    1e-10   Ipomoea batatas [batate]
dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase             65.1    1e-09   Ipomoea batatas [batate]
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  59.7    7e-08   Solanum tuberosum [potatoes]
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      59.7    7e-08   
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      59.3    9e-08   Nicotiana sylvestris
gb|KDP26621.1|  hypothetical protein JCGZ_17779                       57.8    3e-07   Jatropha curcas
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                 57.8    4e-07   Morus notabilis
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  57.4    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  57.4    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007044709.1|  Nsp-interacting kinase 3 isoform 2               57.0    4e-07   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      57.0    6e-07   Nelumbo nucifera [Indian lotus]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase         56.6    7e-07   Medicago truncatula
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      56.6    7e-07   
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  56.6    8e-07   Cicer arietinum [garbanzo]
ref|XP_004159592.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  54.7    8e-07   
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1               56.6    9e-07   Theobroma cacao [chocolate]
ref|XP_002312685.1|  leucine-rich repeat family protein               56.2    9e-07   
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  56.2    9e-07   Cucumis melo [Oriental melon]
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g           56.2    1e-06   
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  56.2    1e-06   Solanum lycopersicum
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  56.2    1e-06   Cucumis sativus [cucumbers]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  56.2    1e-06   Solanum lycopersicum
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  56.2    1e-06   Cucumis melo [Oriental melon]
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  55.8    1e-06   
emb|CDP13189.1|  unnamed protein product                              55.5    2e-06   Coffea canephora [robusta coffee]
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g           55.5    2e-06   
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g           55.5    2e-06   
ref|XP_011045286.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      55.1    2e-06   Populus euphratica
gb|KJB61045.1|  hypothetical protein B456_009G337000                  55.1    2e-06   Gossypium raimondii
gb|KJB61041.1|  hypothetical protein B456_009G337000                  55.1    3e-06   Gossypium raimondii
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  55.1    3e-06   Fragaria vesca subsp. vesca
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  55.1    3e-06   Fragaria vesca subsp. vesca
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      55.1    3e-06   Vitis vinifera
emb|CAN75190.1|  hypothetical protein VITISV_035381                   54.7    3e-06   Vitis vinifera
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  53.1    1e-05   Populus euphratica
gb|AGC92177.1|  myeloblastosis protein                                51.6    1e-05   Hibiscus sabdariffa [red-sorrel]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  53.1    1e-05   Populus euphratica
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              52.8    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      52.4    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3      51.6    3e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                 51.6    4e-05   Citrus sinensis [apfelsine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  51.6    4e-05   Citrus sinensis [apfelsine]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg           51.6    4e-05   Citrus clementina [clementine]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  51.2    5e-05   Prunus mume [ume]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  51.2    5e-05   Prunus mume [ume]
ref|XP_008221853.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  50.8    6e-05   Prunus mume [ume]
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.4    7e-05   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.4    8e-05   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.4    8e-05   Malus domestica [apple tree]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                      50.1    1e-04   Glycine soja [wild soybean]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g           50.1    1e-04   Phaseolus vulgaris [French bean]
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  50.1    1e-04   Glycine max [soybeans]
ref|XP_007222912.1|  hypothetical protein PRUPE_ppa003642mg           49.3    2e-04   
ref|XP_007222911.1|  hypothetical protein PRUPE_ppa003642mg           49.3    2e-04   
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                      49.3    2e-04   Glycine soja [wild soybean]
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  49.3    2e-04   Glycine max [soybeans]
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  48.5    4e-04   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  48.5    4e-04   
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  48.5    4e-04   
ref|XP_006841062.1|  hypothetical protein AMTR_s00085p00173590        48.1    5e-04   Amborella trichopoda



>dbj|BAD18097.1| putative serine/threonine protein kinase [Ipomoea batatas]
Length=232

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  203  RTHENTPQRYSDFIEESSLIVEAMELSGPR  232



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/30 (100%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RTHENTPQRYSDFIEESSLIVEAMELSGPR
Sbjct  598  RTHENTPQRYSDFIEESSLIVEAMELSGPR  627



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  593  RTSENTPKRYSDYIEESSLVVEAMELSGPR  622



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  597  RTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RT ENTP+RYSD+IEESSL+VEAMELSGPR
Sbjct  597  RTSENTPKRYSDYIEESSLVVEAMELSGPR  626



>gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSDFIEESSL+VEAMELSGPR
Sbjct  597  RSCENHPQRYSDFIEESSLVVEAMELSGPR  626



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSDFIEESSL++EAMELSGPR
Sbjct  608  RSCENPPQRYSDFIEESSLVIEAMELSGPR  637



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  553  RSSENLPQRYSDYIEESSLVVEAMELSGPR  582



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  597  RSSENLPQRYSDYIEESSLVVEAMELSGPR  626



>ref|XP_007044709.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
 gb|EOY00541.1| Nsp-interacting kinase 3 isoform 2 [Theobroma cacao]
Length=451

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  422  RSCDNPPQRYSDFIEESSLVIEAMELSGPR  451



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E  PQRYSDFIEESSL+VEAMELSGPR
Sbjct  599  RSSETMPQRYSDFIEESSLVVEAMELSGPR  628



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  596  RFCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  596  RSFEHPPQRYSDFIEESSLVVEAMELSGPR  625



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSDFIEESSLIVEAMELSGPR
Sbjct  596  RLCENPPQRYSDFIEESSLIVEAMELSGPR  625



>ref|XP_004159592.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like, partial [Cucumis 
sativus]
Length=235

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  206  RPCENPPQRYSDYIEESSLIVEAMELSGPR  235



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ +N PQRYSDFIEESSL++EAMELSGPR
Sbjct  597  RSCDNPPQRYSDFIEESSLVIEAMELSGPR  626



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  596  RSCENPPQKYSDFIEESSLVVEAMELSGPR  625



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  592  RPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQ+YSDFIEESSL+VEAMELSGPR
Sbjct  593  RSCENPPQKYSDFIEESSLVVEAMELSGPR  622



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  322  THENTPQRYSDFIEESSLIVEAMELSGPR  236
            T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  595  TSENTPKRYSDYIQESSLVVEAMELSGPR  623



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cucumis sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  592  RPCENPPQRYSDYIEESSLIVEAMELSGPR  621



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  322  THENTPQRYSDFIEESSLIVEAMELSGPR  236
            T ENTP+RYSD+I+ESSL+VEAMELSGPR
Sbjct  547  TSENTPKRYSDYIQESSLVVEAMELSGPR  575



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  EN PQRYSD+IEESSLIVEAMELSGPR
Sbjct  580  RPCENPPQRYSDYIEESSLIVEAMELSGPR  609



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+ PQRYSDFIEESSL+VEAMELSGPR
Sbjct  589  RSCESHPQRYSDFIEESSLVVEAMELSGPR  618



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RT E+ PQRYSD+IEESSL+VEAMELSGPR
Sbjct  595  RTFEHIPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  595  RSCENPPQRYSDYIEESSLVVEAMELSGPR  624



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  599  RSCENPPQRYSDYIEESSLVVEAMELSGPR  628



>ref|XP_011045286.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Populus euphratica]
Length=452

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL+VEAMELSGPR
Sbjct  423  RSCENPPQRYSDYIEESSLVVEAMELSGPR  452



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -1

Query  319  HENTPQRYSDFIEESSLIVEAMELSGPR  236
            ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  598  NDNPPQRYSDFIEESSLVLEAMELSGPR  625



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -1

Query  319  HENTPQRYSDFIEESSLIVEAMELSGPR  236
            ++N PQRYSDFIEESSL++EAMELSGPR
Sbjct  601  NDNPPQRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  597  RSCEHPPQRYSDFIDESSLVVEAMELSGPR  626



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+ PQRYSDFI+ESSL+VEAMELSGPR
Sbjct  600  RSCEHPPQRYSDFIDESSLVVEAMELSGPR  629



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  597  RSCENPPQRYSDYIEESSLVIEAMELSGPR  626



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN PQRYSD+IEESSL++EAMELSGPR
Sbjct  579  RSCENPPQRYSDYIEESSLVIEAMELSGPR  608



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  598  RSCENPAQKYSDFIEESSLVVEAMELSGPR  627



>gb|AGC92177.1| myeloblastosis protein [Hibiscus sabdariffa]
Length=229

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 1/31 (3%)
 Frame = -1

Query  325  RTHENTP-QRYSDFIEESSLIVEAMELSGPR  236
            R+ +NTP QRYSDFIEESSL++EAMELSGPR
Sbjct  199  RSCDNTPPQRYSDFIEESSLVMEAMELSGPR  229



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN  Q+YSDFIEESSL+VEAMELSGPR
Sbjct  595  RSCENPAQKYSDFIEESSLVVEAMELSGPR  624



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ +N PQRYSD+IEESSL+VE MELSGPR
Sbjct  599  RSFQNLPQRYSDYIEESSLVVEDMELSGPR  628



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ EN   RYSDFIEESSL+VEAMELSGPR
Sbjct  592  RSCENPTPRYSDFIEESSLVVEAMELSGPR  621



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+  + PQRYSD+IEESSL+VEAMELSGPR
Sbjct  592  RSRSSEPQRYSDYIEESSLVVEAMELSGPR  621



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 3/30 (10%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  597  RTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 3/30 (10%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  597  RTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 3/30 (10%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            RTHE   +RYSDFIEESSL++EAMELSGPR
Sbjct  597  RTHE---KRYSDFIEESSLVIEAMELSGPR  623



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  626  RSCEHPRQRYSDFIEESSLVLEAMELSGPR  655



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  627  RSCEHPRQRYSDFIEESSLVLEAMELSGPR  656



>ref|XP_008221853.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Prunus 
mume]
Length=560

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  531  RSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  601  RSCEHPRQRYSDFIEESSLVVEAMELSGPR  630



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  603  RSCEHPRQRYSDFIEESSLVVEAMELSGPR  632



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL+VEAMELSGPR
Sbjct  602  RSCEHPRQRYSDFIEESSLVVEAMELSGPR  631



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  307  PQRYSDFIEESSLIVEAMELSGPR  236
            PQRYSD IEESSLIVEAMELSGPR
Sbjct  600  PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  307  PQRYSDFIEESSLIVEAMELSGPR  236
            PQRYSD IEESSLIVEAMELSGPR
Sbjct  600  PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  307  PQRYSDFIEESSLIVEAMELSGPR  236
            PQRYSD IEESSLIVEAMELSGPR
Sbjct  600  PQRYSDLIEESSLIVEAMELSGPR  623



>ref|XP_007222912.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24111.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=560

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  531  RSCEHPRQRYSDFIEESSLVLEAMELSGPR  560



>ref|XP_007222911.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
 gb|EMJ24110.1| hypothetical protein PRUPE_ppa003642mg [Prunus persica]
Length=559

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R+ E+  QRYSDFIEESSL++EAMELSGPR
Sbjct  530  RSCEHPRQRYSDFIEESSLVLEAMELSGPR  559



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  307  PQRYSDFIEESSLIVEAMELSGPR  236
            PQRYSD IEESSL+VEAMELSGPR
Sbjct  601  PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  307  PQRYSDFIEESSLIVEAMELSGPR  236
            PQRYSD IEESSL+VEAMELSGPR
Sbjct  601  PQRYSDLIEESSLVVEAMELSGPR  624



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  304  QRYSDFIEESSLIVEAMELSGPR  236
            QRYSDFIEESSL++EAMELSGPR
Sbjct  606  QRYSDFIEESSLVLEAMELSGPR  628



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  304  QRYSDFIEESSLIVEAMELSGPR  236
            QRYSDFIEESSL++EAMELSGPR
Sbjct  607  QRYSDFIEESSLVLEAMELSGPR  629



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  304  QRYSDFIEESSLIVEAMELSGPR  236
            QRYSDFIEESSL++EAMELSGPR
Sbjct  608  QRYSDFIEESSLVLEAMELSGPR  630



>ref|XP_006841062.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  325  RTHENTPQRYSDFIEESSLIVEAMELSGPR  236
            R  E  P++YSD IEESSL+VEAMELSGPR
Sbjct  600  RGSEFFPRKYSDLIEESSLVVEAMELSGPR  629



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568775281920