BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006K11

Length=438
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004237736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    218   3e-64   Solanum lycopersicum
ref|XP_009763873.1|  PREDICTED: putative UDP-glucuronate:xylan al...    218   4e-64   Nicotiana sylvestris
ref|XP_009629284.1|  PREDICTED: putative UDP-glucuronate:xylan al...    217   7e-64   Nicotiana tomentosiformis
ref|XP_006356282.1|  PREDICTED: putative UDP-glucuronate:xylan al...    216   2e-63   Solanum tuberosum [potatoes]
ref|XP_006356283.1|  PREDICTED: putative UDP-glucuronate:xylan al...    216   2e-63   Solanum tuberosum [potatoes]
gb|KJB59999.1|  hypothetical protein B456_009G284700                    206   9e-60   Gossypium raimondii
gb|KJB60000.1|  hypothetical protein B456_009G284700                    206   1e-59   Gossypium raimondii
gb|KHG12057.1|  Glycogenin-2                                            206   2e-59   Gossypium arboreum [tree cotton]
ref|XP_006383614.1|  hypothetical protein POPTR_0005s21030g             202   2e-59   
ref|XP_007019401.1|  Plant glycogenin-like starch initiation prot...    204   3e-59   
ref|XP_002307480.2|  hypothetical protein POPTR_0005s21030g             204   5e-59   Populus trichocarpa [western balsam poplar]
gb|KDP43041.1|  hypothetical protein JCGZ_25227                         203   1e-58   Jatropha curcas
ref|XP_007161486.1|  hypothetical protein PHAVU_001G073100g             203   2e-58   Phaseolus vulgaris [French bean]
emb|CDP18299.1|  unnamed protein product                                202   2e-58   Coffea canephora [robusta coffee]
ref|XP_011073953.1|  PREDICTED: putative UDP-glucuronate:xylan al...    202   3e-58   Sesamum indicum [beniseed]
ref|XP_010999819.1|  PREDICTED: putative UDP-glucuronate:xylan al...    202   4e-58   Populus euphratica
ref|XP_010680014.1|  PREDICTED: putative UDP-glucuronate:xylan al...    201   9e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010110482.1|  hypothetical protein L484_003528                   201   1e-57   
ref|XP_010062155.1|  PREDICTED: putative UDP-glucuronate:xylan al...    200   1e-57   Eucalyptus grandis [rose gum]
gb|KCW69223.1|  hypothetical protein EUGRSUZ_F02737                     200   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010062154.1|  PREDICTED: putative UDP-glucuronate:xylan al...    200   2e-57   Eucalyptus grandis [rose gum]
ref|XP_007199740.1|  hypothetical protein PRUPE_ppa002697mg             198   6e-57   Prunus persica
ref|XP_008237654.1|  PREDICTED: putative UDP-glucuronate:xylan al...    197   1e-56   Prunus mume [ume]
ref|XP_004290562.1|  PREDICTED: putative UDP-glucuronate:xylan al...    197   1e-56   Fragaria vesca subsp. vesca
ref|XP_010245814.1|  PREDICTED: putative UDP-glucuronate:xylan al...    197   2e-56   Nelumbo nucifera [Indian lotus]
gb|KHN41007.1|  Glycogenin-2                                            197   3e-56   Glycine soja [wild soybean]
ref|XP_003518352.1|  PREDICTED: putative UDP-glucuronate:xylan al...    197   3e-56   Glycine max [soybeans]
gb|KHN04164.1|  Glycogenin-2                                            196   4e-56   Glycine soja [wild soybean]
gb|KDO83632.1|  hypothetical protein CISIN_1g043696mg                   194   4e-56   Citrus sinensis [apfelsine]
ref|XP_006607044.1|  PREDICTED: putative UDP-glucuronate:xylan al...    196   4e-56   
ref|XP_006472929.1|  PREDICTED: putative UDP-glucuronate:xylan al...    195   9e-56   Citrus sinensis [apfelsine]
ref|XP_006434392.1|  hypothetical protein CICLE_v10003328mg             195   9e-56   Citrus clementina [clementine]
ref|XP_006485174.1|  PREDICTED: putative UDP-glucuronate:xylan al...    195   1e-55   
gb|KHG03827.1|  Glycogenin-2                                            194   2e-55   Gossypium arboreum [tree cotton]
gb|KHG05573.1|  Glycogenin-2                                            194   2e-55   Gossypium arboreum [tree cotton]
ref|XP_004498382.1|  PREDICTED: putative UDP-glucuronate:xylan al...    194   3e-55   Cicer arietinum [garbanzo]
gb|EYU36701.1|  hypothetical protein MIMGU_mgv1a005329mg                191   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_009348499.1|  PREDICTED: putative UDP-glucuronate:xylan al...    193   5e-55   Pyrus x bretschneideri [bai li]
gb|KEH40452.1|  UDP-glucuronate:xylan alpha-glucuronosyltransferase     191   3e-54   Medicago truncatula
gb|KJB80585.1|  hypothetical protein B456_013G105100                    189   4e-54   Gossypium raimondii
ref|XP_009360737.1|  PREDICTED: putative UDP-glucuronate:xylan al...    191   4e-54   Pyrus x bretschneideri [bai li]
gb|KJB80584.1|  hypothetical protein B456_013G105100                    190   9e-54   Gossypium raimondii
emb|CBI19971.3|  unnamed protein product                                189   9e-54   Vitis vinifera
ref|XP_009149666.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   1e-53   
ref|XP_009149665.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   1e-53   Brassica rapa
ref|XP_008373924.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   1e-53   
ref|XP_008373922.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   2e-53   
gb|KFK44246.1|  hypothetical protein AALP_AA1G233800                    189   2e-53   Arabis alpina [alpine rockcress]
ref|XP_008373923.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   2e-53   
gb|KFK44245.1|  hypothetical protein AALP_AA1G233800                    189   2e-53   Arabis alpina [alpine rockcress]
ref|XP_010664887.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   2e-53   Vitis vinifera
ref|XP_010664886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   2e-53   Vitis vinifera
ref|XP_010539696.1|  PREDICTED: putative UDP-glucuronate:xylan al...    188   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_010539695.1|  PREDICTED: putative UDP-glucuronate:xylan al...    189   3e-53   Tarenaya hassleriana [spider flower]
ref|XP_006302009.1|  hypothetical protein CARUB_v10019986mg             188   3e-53   Capsella rubella
emb|CDY04633.1|  BnaC05g16710D                                          188   3e-53   
ref|XP_002526157.1|  glycogenin, putative                               188   5e-53   Ricinus communis
emb|CDY50243.1|  BnaA06g15200D                                          190   7e-53   Brassica napus [oilseed rape]
ref|XP_010244020.1|  PREDICTED: putative UDP-glucuronate:xylan al...    183   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010244025.1|  PREDICTED: putative UDP-glucuronate:xylan al...    182   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006416296.1|  hypothetical protein EUTSA_v10007050mg             182   5e-51   
emb|CDX96589.1|  BnaA08g21320D                                          181   9e-51   
ref|XP_009348497.1|  PREDICTED: putative UDP-glucuronate:xylan al...    177   3e-49   Pyrus x bretschneideri [bai li]
gb|EPS63087.1|  hypothetical protein M569_11696                         170   1e-48   Genlisea aurea
ref|XP_004166220.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    176   1e-48   
ref|XP_004148815.1|  PREDICTED: putative UDP-glucuronate:xylan al...    176   1e-48   Cucumis sativus [cucumbers]
ref|XP_008441557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    175   2e-48   Cucumis melo [Oriental melon]
ref|XP_008237655.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    175   2e-48   Prunus mume [ume]
ref|XP_008237675.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    175   5e-48   Prunus mume [ume]
emb|CDY38807.1|  BnaC08g19810D                                          172   2e-47   Brassica napus [oilseed rape]
ref|XP_007199738.1|  hypothetical protein PRUPE_ppa002694mg             172   2e-47   Prunus persica
ref|XP_008373921.1|  PREDICTED: putative UDP-glucuronate:xylan al...    171   4e-47   Malus domestica [apple tree]
ref|XP_008373920.1|  PREDICTED: putative UDP-glucuronate:xylan al...    171   5e-47   Malus domestica [apple tree]
ref|XP_006427798.1|  hypothetical protein CICLE_v10025272mg             168   3e-46   
ref|XP_006464622.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    169   3e-46   Citrus sinensis [apfelsine]
ref|XP_009392550.1|  PREDICTED: putative UDP-glucuronate:xylan al...    169   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392557.1|  PREDICTED: putative UDP-glucuronate:xylan al...    168   6e-46   
ref|XP_010911800.1|  PREDICTED: putative UDP-glucuronate:xylan al...    168   6e-46   Elaeis guineensis
gb|KDP24792.1|  hypothetical protein JCGZ_25413                         168   7e-46   Jatropha curcas
ref|XP_010911799.1|  PREDICTED: putative UDP-glucuronate:xylan al...    168   9e-46   Elaeis guineensis
ref|NP_177838.2|  putative UDP-glucuronate:xylan alpha-glucuronos...    167   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009360735.1|  PREDICTED: putative UDP-glucuronate:xylan al...    167   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_009360736.1|  PREDICTED: putative UDP-glucuronate:xylan al...    167   2e-45   Pyrus x bretschneideri [bai li]
gb|KDO58344.1|  hypothetical protein CISIN_1g006648mg                   167   2e-45   Citrus sinensis [apfelsine]
gb|KHN31133.1|  Glycogenin-2                                            166   4e-45   Glycine soja [wild soybean]
ref|XP_006578795.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    166   4e-45   Glycine max [soybeans]
ref|XP_003525117.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    166   4e-45   Glycine max [soybeans]
gb|KHN34064.1|  Glycogenin-2                                            165   4e-45   Glycine soja [wild soybean]
ref|XP_002889125.1|  hypothetical protein ARALYDRAFT_476876             166   5e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_010416641.1|  PREDICTED: putative UDP-glucuronate:xylan al...    164   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010428781.1|  PREDICTED: putative UDP-glucuronate:xylan al...    164   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010471900.1|  PREDICTED: putative UDP-glucuronate:xylan al...    164   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010090867.1|  hypothetical protein L484_020727                   164   1e-44   
ref|XP_008798993.1|  PREDICTED: putative UDP-glucuronate:xylan al...    164   2e-44   Phoenix dactylifera
gb|KCW71171.1|  hypothetical protein EUGRSUZ_F04263                     161   2e-44   Eucalyptus grandis [rose gum]
gb|AAC34345.1|  Unknown protein                                         167   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798991.1|  PREDICTED: putative UDP-glucuronate:xylan al...    164   2e-44   
emb|CDP04731.1|  unnamed protein product                                163   3e-44   Coffea canephora [robusta coffee]
gb|KHG14645.1|  Glycogenin-2                                            163   3e-44   Gossypium arboreum [tree cotton]
ref|XP_004163053.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    163   3e-44   
ref|XP_011007559.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    163   4e-44   Populus euphratica
ref|XP_008441030.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    163   4e-44   Cucumis melo [Oriental melon]
ref|XP_011007558.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    163   4e-44   Populus euphratica
ref|XP_011007557.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    163   4e-44   Populus euphratica
gb|KJB71319.1|  hypothetical protein B456_011G116600                    162   4e-44   Gossypium raimondii
gb|KJB71320.1|  hypothetical protein B456_011G116600                    163   4e-44   Gossypium raimondii
ref|XP_006858468.1|  hypothetical protein AMTR_s00071p00107830          163   4e-44   Amborella trichopoda
gb|KHN44079.1|  Glycogenin-2                                            162   5e-44   Glycine soja [wild soybean]
ref|XP_004148647.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    162   6e-44   
gb|KGN48367.1|  hypothetical protein Csa_6G483470                       162   7e-44   Cucumis sativus [cucumbers]
ref|XP_002307022.2|  hypothetical protein POPTR_0005s06280g             162   8e-44   
ref|XP_003602583.1|  Secondary cell wall-related glycosyltransfer...    162   9e-44   Medicago truncatula
ref|XP_004502919.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    162   1e-43   Cicer arietinum [garbanzo]
ref|XP_010063886.1|  PREDICTED: putative UDP-glucuronate:xylan al...    161   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010680250.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    161   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007048325.1|  Plant glycogenin-like starch initiation prot...    161   2e-43   
ref|XP_006645120.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    161   2e-43   Oryza brachyantha
ref|XP_007048326.1|  Plant glycogenin-like starch initiation prot...    161   2e-43   
ref|XP_011097058.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    160   5e-43   Sesamum indicum [beniseed]
ref|XP_011097062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    160   5e-43   
gb|AAX33317.1|  secondary cell wall-related glycosyltransferase f...    160   5e-43   Populus tremula x Populus tremuloides
emb|CBI37563.3|  unnamed protein product                                159   6e-43   Vitis vinifera
ref|XP_002517237.1|  glycogenin, putative                               159   7e-43   
ref|XP_009414973.1|  PREDICTED: putative UDP-glucuronate:xylan al...    159   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022955.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   8e-43   Populus euphratica
ref|XP_002275240.2|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   9e-43   Vitis vinifera
ref|XP_011022956.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   9e-43   Populus euphratica
ref|XP_011022957.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   9e-43   Populus euphratica
ref|XP_011022954.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   9e-43   Populus euphratica
ref|XP_011022958.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   9e-43   Populus euphratica
ref|XP_010649390.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   1e-42   
gb|AAX33316.1|  secondary cell wall-related glycosyltransferase f...    159   1e-42   Populus tremula x Populus tremuloides
ref|XP_009776714.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   1e-42   Nicotiana sylvestris
ref|XP_009776715.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   1e-42   Nicotiana sylvestris
ref|XP_009776713.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   1e-42   Nicotiana sylvestris
ref|XP_009776712.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    159   1e-42   Nicotiana sylvestris
gb|KCW62287.1|  hypothetical protein EUGRSUZ_H04942                     158   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010025567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    158   2e-42   Eucalyptus grandis [rose gum]
ref|XP_002456736.1|  hypothetical protein SORBIDRAFT_03g041660          158   2e-42   Sorghum bicolor [broomcorn]
ref|XP_006406580.1|  hypothetical protein EUTSA_v10020243mg             158   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_002885270.1|  hypothetical protein ARALYDRAFT_479372             158   2e-42   
emb|CDY38364.1|  BnaA02g18570D                                          157   3e-42   Brassica napus [oilseed rape]
ref|XP_009145872.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    157   5e-42   Brassica rapa
dbj|BAJ87020.1|  predicted protein                                      154   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002310513.2|  hypothetical protein POPTR_0007s04030g             157   7e-42   
ref|XP_010312475.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    156   1e-41   Solanum lycopersicum
ref|XP_004249893.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    156   1e-41   Solanum lycopersicum
ref|XP_009112560.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    156   1e-41   Brassica rapa
ref|XP_009112567.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    156   1e-41   Brassica rapa
ref|NP_001189927.1|  plant glycogenin-like starch initiation prot...    155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566615.1|  plant glycogenin-like starch initiation protein 1     155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030722.1|  plant glycogenin-like starch initiation prot...    155   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    155   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009594275.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   4e-41   Nicotiana tomentosiformis
ref|XP_009594279.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   4e-41   Nicotiana tomentosiformis
ref|XP_009594278.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   4e-41   Nicotiana tomentosiformis
ref|XP_009594277.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   4e-41   Nicotiana tomentosiformis
ref|XP_010550280.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   4e-41   Tarenaya hassleriana [spider flower]
gb|EEC71899.1|  hypothetical protein OsI_04661                          154   4e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001044991.1|  Os01g0880200                                       154   4e-41   
ref|XP_010550282.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   5e-41   Tarenaya hassleriana [spider flower]
dbj|BAJ87677.1|  predicted protein                                      154   5e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG90458.1|  unnamed protein product                                154   6e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ14371.1|  hypothetical protein OsJ_04291                          154   6e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008674740.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   6e-41   
ref|XP_010465976.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010507061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    154   7e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001140733.1|  uncharacterized protein LOC100272808               145   7e-41   
emb|CDM85463.1|  unnamed protein product                                154   8e-41   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA56540.1|  TPA: hypothetical protein ZEAMMB73_374443              154   9e-41   
ref|XP_006297149.1|  hypothetical protein CARUB_v10013152mg             153   1e-40   Capsella rubella
ref|XP_011466789.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    153   1e-40   Fragaria vesca subsp. vesca
emb|CDY18535.1|  BnaA01g26600D                                          153   1e-40   Brassica napus [oilseed rape]
emb|CDY53768.1|  BnaC01g43920D                                          153   2e-40   Brassica napus [oilseed rape]
ref|XP_003568405.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    153   2e-40   Brachypodium distachyon [annual false brome]
gb|KFK39187.1|  hypothetical protein AALP_AA3G211300                    155   2e-40   Arabis alpina [alpine rockcress]
gb|EMS55920.1|  Glycogenin-1                                            152   2e-40   Triticum urartu
gb|EMT19434.1|  Glycogenin-1                                            151   5e-40   
emb|CDX92257.1|  BnaA05g21500D                                          150   9e-40   
ref|XP_006581757.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    150   1e-39   Glycine max [soybeans]
gb|KFK42115.1|  hypothetical protein AALP_AA2G212800                    148   1e-39   Arabis alpina [alpine rockcress]
ref|XP_007159826.1|  hypothetical protein PHAVU_002G270800g             144   2e-39   Phaseolus vulgaris [French bean]
ref|XP_010930628.1|  PREDICTED: putative UDP-glucuronate:xylan al...    150   2e-39   Elaeis guineensis
ref|XP_007137705.1|  hypothetical protein PHAVU_009G148800g             149   3e-39   Phaseolus vulgaris [French bean]
gb|EMT13493.1|  Glycogenin-1                                            150   3e-39   
dbj|BAG89254.1|  unnamed protein product                                142   4e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008654538.1|  PREDICTED: uncharacterized protein LOC100272...    149   4e-39   
ref|XP_002441128.1|  hypothetical protein SORBIDRAFT_09g020930          147   1e-38   Sorghum bicolor [broomcorn]
ref|XP_003564767.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    147   2e-38   Brachypodium distachyon [annual false brome]
dbj|BAJ87861.1|  predicted protein                                      144   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN09596.1|  Glycogenin-1                                            147   2e-38   Glycine soja [wild soybean]
ref|XP_008647980.1|  PREDICTED: LOC100286027 isoform X1                 147   3e-38   Zea mays [maize]
ref|XP_008647982.1|  PREDICTED: LOC100286027 isoform X2                 146   3e-38   
ref|NP_001152387.1|  LOC100286027                                       146   3e-38   Zea mays [maize]
gb|EYU18058.1|  hypothetical protein MIMGU_mgv1a018384mg                145   7e-38   Erythranthe guttata [common monkey flower]
gb|AGT16755.1|  glycogenin                                              145   7e-38   Saccharum hybrid cultivar R570
gb|EEC79261.1|  hypothetical protein OsI_20036                          145   9e-38   Oryza sativa Indica Group [Indian rice]
gb|AAS90653.1|  putative glycogenin                                     145   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654430.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    145   1e-37   Oryza brachyantha
gb|KHG15344.1|  Glycogenin-2                                            145   1e-37   Gossypium arboreum [tree cotton]
gb|EEE63788.1|  hypothetical protein OsJ_18611                          145   1e-37   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85213.1|  predicted protein                                      144   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008786543.1|  PREDICTED: putative UDP-glucuronate:xylan al...    144   2e-37   Phoenix dactylifera
ref|XP_006350977.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    144   2e-37   Solanum tuberosum [potatoes]
ref|XP_006350978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    144   2e-37   Solanum tuberosum [potatoes]
gb|EPS62267.1|  hypothetical protein M569_12523                         144   2e-37   Genlisea aurea
gb|EPS60482.1|  hypothetical protein M569_14321                         140   2e-37   Genlisea aurea
gb|KJB40458.1|  hypothetical protein B456_007G064800                    143   5e-37   Gossypium raimondii
ref|XP_002990211.1|  hypothetical protein SELMODRAFT_131094             140   4e-36   
ref|XP_002992480.1|  hypothetical protein SELMODRAFT_135481             139   5e-36   
gb|EPS59757.1|  hypothetical protein M569_15049                         131   5e-33   Genlisea aurea
ref|XP_011099766.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    131   9e-33   Sesamum indicum [beniseed]
ref|XP_011099765.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    131   9e-33   Sesamum indicum [beniseed]
ref|XP_009411206.1|  PREDICTED: putative UDP-glucuronate:xylan al...    130   1e-32   
emb|CDP04730.1|  unnamed protein product                                129   6e-32   Coffea canephora [robusta coffee]
ref|XP_010921631.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    125   2e-30   Elaeis guineensis
ref|XP_009420264.1|  PREDICTED: putative UDP-glucuronate:xylan al...    125   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921630.1|  PREDICTED: putative UDP-glucuronate:xylan al...    125   2e-30   Elaeis guineensis
ref|XP_009384289.1|  PREDICTED: putative UDP-glucuronate:xylan al...    124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404956.1|  PREDICTED: putative UDP-glucuronate:xylan al...    121   5e-29   
ref|XP_009404954.1|  PREDICTED: putative UDP-glucuronate:xylan al...    121   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007048327.1|  Plant glycogenin-like starch initiation prot...    120   1e-28   
ref|XP_008803691.1|  PREDICTED: putative UDP-glucuronate:xylan al...    120   2e-28   
ref|XP_009408314.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    115   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110483.1|  hypothetical protein L484_003529                   114   1e-26   
ref|XP_001756144.1|  predicted protein                                  112   6e-26   
ref|XP_009396821.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    110   3e-25   
ref|XP_009414600.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...    109   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002441125.1|  hypothetical protein SORBIDRAFT_09g020910        92.4    4e-20   
gb|EEE57188.1|  hypothetical protein OsJ_07131                        96.3    4e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63875.1|  Glycogenin-2                                          94.4    1e-19   Triticum urartu
dbj|BAJ97980.1|  predicted protein                                    94.4    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002453984.1|  hypothetical protein SORBIDRAFT_04g022700        94.0    3e-19   
gb|EEC73397.1|  hypothetical protein OsI_07648                        92.8    6e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004952800.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  92.8    8e-19   Setaria italica
ref|NP_001047126.2|  Os02g0556000                                     92.4    1e-18   
ref|XP_006828387.1|  hypothetical protein AMTR_s00060p00013040        91.3    2e-18   Amborella trichopoda
ref|NP_001131921.1|  uncharacterized protein LOC100193311             85.9    3e-18   
ref|XP_003575141.1|  PREDICTED: putative UDP-glucuronate:xylan al...  90.9    3e-18   Brachypodium distachyon [annual false brome]
emb|CDP01355.1|  unnamed protein product                              90.9    4e-18   Coffea canephora [robusta coffee]
ref|XP_002960604.1|  hypothetical protein SELMODRAFT_73856            89.7    5e-18   
ref|XP_002969246.1|  hypothetical protein SELMODRAFT_91619            89.7    5e-18   
ref|XP_008645791.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  90.1    6e-18   
ref|XP_001783069.1|  predicted protein                                89.7    7e-18   
gb|ABK25357.1|  unknown                                               89.7    8e-18   Picea sitchensis
ref|XP_001777541.1|  predicted protein                                89.0    1e-17   
ref|XP_010274299.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  84.3    7e-16   
gb|KJB63829.1|  hypothetical protein B456_010G019500                  82.8    2e-15   Gossypium raimondii
gb|KJB63830.1|  hypothetical protein B456_010G019500                  83.2    2e-15   Gossypium raimondii
ref|XP_006354951.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  82.8    2e-15   
gb|KHG15663.1|  Glycogenin-1                                          82.0    4e-15   Gossypium arboreum [tree cotton]
ref|XP_007136678.1|  hypothetical protein PHAVU_009G064700g           82.0    4e-15   Phaseolus vulgaris [French bean]
ref|XP_003591107.1|  Glycogenin-1                                     81.6    5e-15   Medicago truncatula
ref|XP_010320334.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  80.9    1e-14   
ref|XP_006601291.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  80.5    1e-14   Glycine max [soybeans]
gb|KHN12781.1|  Glycogenin-1                                          80.5    1e-14   Glycine soja [wild soybean]
ref|XP_003549400.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  80.5    1e-14   Glycine max [soybeans]
ref|XP_006578023.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  79.7    2e-14   Glycine max [soybeans]
ref|XP_011030050.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  79.7    2e-14   Populus euphratica
ref|XP_006374946.1|  hypothetical protein POPTR_0014s02980g           79.7    2e-14   
ref|XP_003523601.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  80.1    2e-14   Glycine max [soybeans]
gb|KHN04505.1|  Hypothetical protein glysoja_019592                   79.7    2e-14   Glycine soja [wild soybean]
ref|XP_011030042.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  79.7    2e-14   Populus euphratica
ref|XP_003544459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  79.7    3e-14   Glycine max [soybeans]
ref|XP_007160847.1|  hypothetical protein PHAVU_001G021800g           79.0    5e-14   Phaseolus vulgaris [French bean]
ref|XP_009791925.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.6    5e-14   Nicotiana sylvestris
ref|XP_009791924.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.6    6e-14   Nicotiana sylvestris
ref|XP_004291114.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.6    6e-14   Fragaria vesca subsp. vesca
ref|XP_011458935.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.6    6e-14   Fragaria vesca subsp. vesca
ref|XP_004494957.1|  PREDICTED: putative UDP-glucuronate:xylan al...  78.2    7e-14   Cicer arietinum [garbanzo]
ref|XP_008361006.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.2    8e-14   
ref|XP_010108604.1|  hypothetical protein L484_006335                 78.2    8e-14   Morus notabilis
ref|XP_009350664.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  77.8    8e-14   Pyrus x bretschneideri [bai li]
ref|XP_009350662.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.2    9e-14   Pyrus x bretschneideri [bai li]
ref|XP_009791926.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.2    9e-14   Nicotiana sylvestris
ref|XP_008361004.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  78.2    9e-14   
ref|XP_008375994.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  77.4    1e-13   Malus domestica [apple tree]
ref|XP_008375992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  77.4    1e-13   Malus domestica [apple tree]
ref|XP_010263572.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  77.0    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010263571.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  77.0    2e-13   
ref|XP_008444626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  76.6    3e-13   
ref|XP_004150886.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  76.6    3e-13   
ref|XP_002510223.1|  glycogenin, putative                             76.6    3e-13   
ref|XP_008444625.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  76.6    3e-13   
ref|XP_004168320.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  76.6    3e-13   
ref|XP_010320335.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  76.3    3e-13   
gb|KGN62510.1|  hypothetical protein Csa_2G357330                     76.3    3e-13   
ref|XP_004238159.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  76.3    4e-13   
ref|XP_009627541.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  75.9    5e-13   
ref|XP_006354952.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  75.9    5e-13   
ref|XP_009627542.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  75.9    5e-13   
gb|KHN43281.1|  Glycogenin-1                                          74.7    1e-12   
ref|XP_004304997.2|  PREDICTED: putative UDP-glucuronate:xylan al...  74.7    1e-12   
ref|XP_006604824.1|  PREDICTED: putative UDP-glucuronate:xylan al...  74.7    1e-12   
emb|CDP18101.1|  unnamed protein product                              74.7    1e-12   
gb|EMT17953.1|  hypothetical protein F775_14903                       74.3    1e-12   
emb|CDM85169.1|  unnamed protein product                              74.7    1e-12   
gb|KDP38342.1|  hypothetical protein JCGZ_04267                       74.3    1e-12   
ref|XP_008218203.1|  PREDICTED: putative UDP-glucuronate:xylan al...  74.3    1e-12   
ref|XP_010255960.1|  PREDICTED: putative UDP-glucuronate:xylan al...  74.3    2e-12   
gb|KHG12194.1|  Uncharacterized protein F383_19799                    73.9    2e-12   
gb|KJB58472.1|  hypothetical protein B456_009G211400                  73.9    2e-12   
ref|XP_007208594.1|  hypothetical protein PRUPE_ppa022628mg           73.6    3e-12   
ref|XP_004985458.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  73.9    3e-12   
ref|XP_010059943.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  73.6    4e-12   
ref|XP_010059944.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  73.6    4e-12   
ref|XP_010059946.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  73.2    4e-12   
gb|KHN16126.1|  Glycogenin-1                                          72.8    4e-12   
gb|KCW66431.1|  hypothetical protein EUGRSUZ_F00232                   73.2    4e-12   
gb|KCW66432.1|  hypothetical protein EUGRSUZ_F00232                   73.2    4e-12   
gb|ADC84479.1|  glycosyltransferase family 8B                         70.5    4e-12   
ref|XP_006851097.1|  hypothetical protein AMTR_s00025p00246110        71.2    5e-12   
gb|KFK29946.1|  hypothetical protein AALP_AA7G198500                  72.8    5e-12   
gb|ADC84478.1|  glycosyltransferase family 8C                         70.1    6e-12   
ref|XP_010447257.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    6e-12   
ref|XP_010447256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.8    7e-12   
ref|XP_008388964.1|  PREDICTED: putative UDP-glucuronate:xylan al...  72.4    7e-12   
gb|KDO38832.1|  hypothetical protein CISIN_1g0374631mg                69.7    7e-12   
ref|XP_010674757.1|  PREDICTED: putative UDP-glucuronate:xylan al...  72.4    7e-12   
ref|XP_011074444.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    7e-12   
ref|XP_003535341.1|  PREDICTED: putative UDP-glucuronate:xylan al...  72.4    8e-12   
ref|XP_002468380.1|  hypothetical protein SORBIDRAFT_01g044930        72.4    8e-12   
ref|XP_011074443.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    9e-12   
ref|XP_010437776.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    9e-12   
ref|XP_008220218.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.0    9e-12   
ref|XP_010432577.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.4    9e-12   
ref|XP_006382602.1|  hypothetical protein POPTR_0005s03650g           72.0    9e-12   
ref|XP_004231270.1|  PREDICTED: putative UDP-glucuronate:xylan al...  72.0    9e-12   
gb|KDO84195.1|  hypothetical protein CISIN_1g007705mg                 72.0    9e-12   
ref|XP_006434785.1|  hypothetical protein CICLE_v10000658mg           72.0    9e-12   
ref|XP_010432579.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.0    9e-12   
ref|XP_010437777.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.0    9e-12   
ref|XP_008220217.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.0    9e-12   
ref|XP_007221825.1|  hypothetical protein PRUPE_ppa003165mg           72.0    1e-11   
ref|XP_009770795.1|  PREDICTED: putative UDP-glucuronate:xylan al...  72.0    1e-11   
ref|XP_006473886.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  72.0    1e-11   
ref|XP_003544084.1|  PREDICTED: putative UDP-glucuronate:xylan al...  71.6    1e-11   
ref|XP_009596978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.6    1e-11   
ref|XP_006433308.1|  hypothetical protein CICLE_v10004021mg           71.6    1e-11   
ref|XP_010916627.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.6    1e-11   
ref|XP_009613940.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.6    1e-11   
ref|XP_006471960.1|  PREDICTED: putative UDP-glucuronate:xylan al...  71.6    1e-11   
gb|ADC84480.1|  glycosyltransferase family 8B                         68.9    1e-11   
ref|XP_009613939.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.6    2e-11   
ref|XP_006283368.1|  hypothetical protein CARUB_v10004410mg           71.6    2e-11   
ref|XP_008345680.1|  PREDICTED: putative UDP-glucuronate:xylan al...  71.6    2e-11   
ref|XP_010916626.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.2    2e-11   
ref|XP_011036785.1|  PREDICTED: putative UDP-glucuronate:xylan al...  71.2    2e-11   
ref|XP_004985459.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  71.2    2e-11   
ref|XP_007147053.1|  hypothetical protein PHAVU_006G092200g           71.2    2e-11   
emb|CAN81983.1|  hypothetical protein VITISV_042631                   70.9    2e-11   
ref|XP_002280832.1|  PREDICTED: putative UDP-glucuronate:xylan al...  70.9    3e-11   
ref|XP_006361898.1|  PREDICTED: putative UDP-glucuronate:xylan al...  70.9    3e-11   
ref|XP_008347148.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.9    3e-11   
emb|CAB38791.1|  putative protein                                     69.3    3e-11   
ref|NP_001130837.1|  hypothetical protein                             70.5    3e-11   
ref|XP_009348718.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.5    3e-11   
ref|XP_010926388.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.5    4e-11   
tpg|DAA43742.1|  TPA: hypothetical protein ZEAMMB73_319049            67.4    4e-11   
ref|XP_010692787.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.1    4e-11   
emb|CDP15517.1|  unnamed protein product                              70.1    4e-11   
ref|XP_009123351.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.1    5e-11   
emb|CDX75345.1|  BnaA01g03570D                                        70.1    5e-11   
ref|XP_009123409.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.1    5e-11   
ref|XP_004972256.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.1    5e-11   
ref|XP_010692786.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  70.1    5e-11   
emb|CDX68968.1|  BnaC01g04850D                                        70.1    5e-11   
gb|KDP23521.1|  hypothetical protein JCGZ_23354                       68.6    5e-11   
ref|XP_009758677.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  69.7    5e-11   
ref|XP_004499062.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  69.3    7e-11   
ref|XP_009390259.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  69.7    7e-11   
ref|XP_004499061.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  69.7    7e-11   
ref|XP_002282762.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  69.3    8e-11   
gb|EEE58453.1|  hypothetical protein OsJ_09685                        69.3    8e-11   
ref|XP_009625849.1|  PREDICTED: putative UDP-glucuronate:xylan al...  69.3    8e-11   
ref|XP_006412369.1|  hypothetical protein EUTSA_v10024741mg           69.3    9e-11   
ref|NP_001154284.1|  UDP-glucuronate:xylan alpha-glucuronosyltran...  69.3    1e-10   
ref|NP_195059.3|  UDP-glucuronate:xylan alpha-glucuronosyltransfe...  69.3    1e-10   
gb|AAK92624.1|AC079633_4  Putative glycogenin                         69.3    1e-10   
ref|XP_010525992.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  68.9    1e-10   
gb|EAY88814.1|  hypothetical protein OsI_10286                        68.9    1e-10   
emb|CDY28291.1|  BnaC03g66680D                                        66.6    1e-10   
ref|XP_010525991.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  68.9    1e-10   
ref|XP_002867186.1|  hypothetical protein ARALYDRAFT_328405           68.9    1e-10   
ref|XP_008673893.1|  PREDICTED: hypothetical protein isoform X1       68.6    1e-10   
tpg|DAA43741.1|  TPA: hypothetical protein ZEAMMB73_319049            68.6    1e-10   
ref|XP_006433306.1|  hypothetical protein CICLE_v10000664mg           68.9    1e-10   
ref|XP_006471968.1|  PREDICTED: putative UDP-glucuronate:xylan al...  68.9    1e-10   
ref|XP_010674823.1|  PREDICTED: putative UDP-glucuronate:xylan al...  68.6    1e-10   
ref|XP_007017252.1|  Glycogenin, putative isoform 2                   68.2    2e-10   
ref|XP_011023601.1|  PREDICTED: putative UDP-glucuronate:xylan al...  68.2    2e-10   
ref|XP_002319544.2|  hypothetical protein POPTR_0013s02380g           68.2    2e-10   
ref|XP_011083928.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  68.2    2e-10   
ref|XP_007017251.1|  Glycogenin, putative isoform 1                   68.2    2e-10   
ref|XP_008805263.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  68.2    2e-10   
ref|XP_002512375.1|  glycogenin, putative                             67.4    3e-10   
ref|XP_009404013.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  67.0    4e-10   
ref|XP_006851095.1|  hypothetical protein AMTR_s00025p00245930        67.0    4e-10   
ref|XP_009404011.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  67.0    5e-10   
ref|XP_003626298.1|  Glycogenin-1                                     67.0    5e-10   
gb|EPS57865.1|  hypothetical protein M569_16951                       67.0    5e-10   
ref|NP_001049188.2|  Os03g0184300                                     66.6    6e-10   
ref|XP_011077916.1|  PREDICTED: putative UDP-glucuronate:xylan al...  66.2    8e-10   
tpg|DAA56781.1|  TPA: hypothetical protein ZEAMMB73_553946            66.2    9e-10   
ref|XP_008676217.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  66.2    1e-09   
gb|ADC84477.1|  glycosyltransferase family 8C                         63.5    1e-09   
ref|XP_006651104.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  65.9    1e-09   
emb|CDY45037.1|  BnaA08g11820D                                        65.9    1e-09   
ref|XP_002458785.1|  hypothetical protein SORBIDRAFT_03g040240        65.9    1e-09   
ref|XP_003589196.1|  Glycogenin glucosyltransferase                   65.5    2e-09   
ref|XP_006361899.1|  PREDICTED: putative UDP-glucuronate:xylan al...  65.1    2e-09   
ref|XP_010272326.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.8    2e-09   
ref|XP_010312667.1|  PREDICTED: putative UDP-glucuronate:xylan al...  65.1    2e-09   
gb|EYU38698.1|  hypothetical protein MIMGU_mgv1a006109mg              64.7    2e-09   
ref|XP_009108806.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  64.7    3e-09   
ref|XP_003589198.1|  Glycogenin glucosyltransferase                   64.7    3e-09   
ref|XP_009108807.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  64.3    3e-09   
ref|XP_003589197.1|  Glycogenin glucosyltransferase                   64.7    3e-09   
ref|XP_009113408.1|  PREDICTED: putative UDP-glucuronate:xylan al...  64.3    4e-09   
emb|CDY41730.1|  BnaA09g15580D                                        64.3    4e-09   
emb|CDX95254.1|  BnaC09g16160D                                        64.3    4e-09   
ref|XP_006392474.1|  hypothetical protein EUTSA_v10024070mg           64.3    4e-09   
ref|XP_007030850.1|  Plant glycogenin-like starch initiation prot...  63.9    5e-09   
ref|XP_003561978.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  62.8    1e-08   
gb|EYU25418.1|  hypothetical protein MIMGU_mgv1a003570mg              62.4    2e-08   
ref|XP_010040839.1|  PREDICTED: putative UDP-glucuronate:xylan al...  62.4    2e-08   
ref|XP_006306168.1|  hypothetical protein CARUB_v10011725mg           62.0    2e-08   
gb|KFK35602.1|  hypothetical protein AALP_AA4G012800                  62.0    2e-08   
ref|XP_006301397.1|  hypothetical protein CARUB_v10021810mg           61.6    3e-08   
ref|XP_009600657.1|  PREDICTED: putative UDP-glucuronate:xylan al...  61.6    3e-08   
ref|XP_010489606.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    5e-08   
ref|XP_008454693.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    5e-08   
ref|XP_008454698.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    5e-08   
ref|XP_010480209.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.8    6e-08   
ref|XP_010511229.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.5    8e-08   
ref|XP_010040834.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.5    8e-08   
ref|XP_010511230.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.5    8e-08   
ref|XP_010040835.1|  PREDICTED: putative UDP-glucuronate:xylan al...  60.5    8e-08   
gb|KJB45231.1|  hypothetical protein B456_007G296600                  59.3    2e-07   
gb|EMS65703.1|  hypothetical protein TRIUR3_04214                     58.9    2e-07   
gb|AAB70408.1|  F7G19.14                                              58.9    2e-07   
emb|CDY32144.1|  BnaCnng06530D                                        58.9    2e-07   
ref|XP_010475720.1|  PREDICTED: putative UDP-glucuronate:xylan al...  58.9    2e-07   
ref|NP_172373.3|  plant glycogenin-like starch initiation protein 5   58.9    3e-07   
ref|XP_002889728.1|  hypothetical protein ARALYDRAFT_470978           58.9    3e-07   
ref|XP_010458168.1|  PREDICTED: putative UDP-glucuronate:xylan al...  58.5    3e-07   
ref|XP_007030849.1|  Plant glycogenin-like starch initiation prot...  58.5    4e-07   
ref|NP_175891.1|  putative UDP-glucuronate:xylan alpha-glucuronos...  58.2    4e-07   
ref|XP_004139358.1|  PREDICTED: putative UDP-glucuronate:xylan al...  58.2    4e-07   
ref|XP_009770796.1|  PREDICTED: putative UDP-glucuronate:xylan al...  58.2    5e-07   
gb|KCW44877.1|  hypothetical protein EUGRSUZ_L01540                   55.8    2e-06   
ref|XP_006417624.1|  hypothetical protein EUTSA_v10007230mg           55.8    2e-06   
ref|XP_002891920.1|  hypothetical protein ARALYDRAFT_337776           55.8    2e-06   
emb|CDY06343.1|  BnaA09g48600D                                        54.7    5e-06   
ref|XP_010549836.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.7    5e-06   
ref|XP_009118330.1|  PREDICTED: putative UDP-glucuronate:xylan al...  54.7    6e-06   
emb|CDY22652.1|  BnaC08g42860D                                        54.7    6e-06   
gb|EPS73755.1|  hypothetical protein M569_01001                       53.9    1e-05   
gb|KJB80982.1|  hypothetical protein B456_013G123900                  52.8    2e-05   
ref|XP_009110860.1|  PREDICTED: putative UDP-glucuronate:xylan al...  52.4    4e-05   
emb|CDY31118.1|  BnaA08g26680D                                        52.4    4e-05   
ref|XP_009390901.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  52.0    5e-05   
ref|XP_009390902.1|  PREDICTED: UDP-glucuronate:xylan alpha-glucu...  51.6    5e-05   
emb|CDY32143.1|  BnaCnng06520D                                        51.2    7e-05   
ref|XP_011075618.1|  PREDICTED: putative UDP-glucuronate:xylan al...  48.5    6e-04   



>ref|XP_004237736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Solanum lycopersicum]
Length=648

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV KL EFASDVAHRTWWK+HDAMP+NLHKYCLLRSKQKAALEWDRREAEK NY+DGHW
Sbjct  537  WNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLLRSKQKAALEWDRREAEKANYSDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL+ CFE+FCFWESMLWHWGETNWTDN+TS+PTPPMV T SLSSL
Sbjct  597  KIKIKDPRLETCFEEFCFWESMLWHWGETNWTDNATSSPTPPMVNTASLSSL  648



>ref|XP_009763873.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana sylvestris]
Length=648

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVEKL EFASDVAHRTWWK+HDAMPENLHKYCLLRSKQKAALEWDRREAEK NY+DGHW
Sbjct  537  WNVEKLQEFASDVAHRTWWKVHDAMPENLHKYCLLRSKQKAALEWDRREAEKANYSDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RLQ CFEDFCFWESMLWHWGETNWTDN+T++PTPP   T SLSSL
Sbjct  597  KIKIKDSRLQTCFEDFCFWESMLWHWGETNWTDNATASPTPPTANTASLSSL  648



>ref|XP_009629284.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nicotiana tomentosiformis]
Length=648

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVEKL EFASDVAHRTWWK+HDAMPENLHKYCLLRSKQKAALEWDRREAEK NY+DGHW
Sbjct  537  WNVEKLQEFASDVAHRTWWKVHDAMPENLHKYCLLRSKQKAALEWDRREAEKANYSDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RLQ CFEDFCFWESMLWHWGETNWTDN+T++PTPP   T SLSSL
Sbjct  597  KIKIKDSRLQTCFEDFCFWESMLWHWGETNWTDNATASPTPPTANTASLSSL  648



>ref|XP_006356282.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X1 [Solanum tuberosum]
Length=648

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV KL EFASDVAHRTWWK+HDAMP+NLHKYCLLRSKQKAALEWDRREAEK N++DGHW
Sbjct  537  WNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLLRSKQKAALEWDRREAEKANFSDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL+ C+E+FCFWESMLWHWGETNWTDN+TS+PTPPMV T SLSSL
Sbjct  597  KIKIKDPRLETCYEEFCFWESMLWHWGETNWTDNATSSPTPPMVNTASLSSL  648



>ref|XP_006356283.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like isoform X2 [Solanum tuberosum]
Length=642

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV KL EFASDVAHRTWWK+HDAMP+NLHKYCLLRSKQKAALEWDRREAEK N++DGHW
Sbjct  531  WNVGKLQEFASDVAHRTWWKVHDAMPDNLHKYCLLRSKQKAALEWDRREAEKANFSDGHW  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL+ C+E+FCFWESMLWHWGETNWTDN+TS+PTPPMV T SLSSL
Sbjct  591  KIKIKDPRLETCYEEFCFWESMLWHWGETNWTDNATSSPTPPMVNTASLSSL  642



>gb|KJB59999.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=646

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  535  WNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDNST+ P+PP +K VSLSSL
Sbjct  595  KIKIKDKRLKTCFEEFCFWESMLWHWGEKNWTDNSTANPSPPAIKKVSLSSL  646



>gb|KJB60000.1| hypothetical protein B456_009G284700 [Gossypium raimondii]
Length=645

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  534  WNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDNST+ P+PP +K VSLSSL
Sbjct  594  KIKIKDKRLKTCFEEFCFWESMLWHWGEKNWTDNSTANPSPPAIKKVSLSSL  645



>gb|KHG12057.1| Glycogenin-2 [Gossypium arboreum]
Length=646

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  535  WNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDNST++P+PP +K VSLSS 
Sbjct  595  KIKIKDKRLKTCFEEFCFWESMLWHWGEKNWTDNSTASPSPPAIKKVSLSSF  646



>ref|XP_006383614.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|ERP61411.1| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=495

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENLHKYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  384  WNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLLRSKQKAALEWDRRQAEKANYTDGHW  443

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+E+FCFWESMLWHWGE NWTDN+T TP+PP V T SL SL
Sbjct  444  KIKIKDKRLETCYENFCFWESMLWHWGEKNWTDNATVTPSPPAVTTTSLPSL  495



>ref|XP_007019401.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
 gb|EOY16626.1| Plant glycogenin-like starch initiation protein 2 isoform 1 [Theobroma 
cacao]
Length=644

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENLHKYCLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  533  WNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLLRSKQKAQLEWDRRQAEKGNYMDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+T+TP+PP  K  SLSSL
Sbjct  593  KIKIKDKRLKTCFEEFCFWESMLWHWGEKNWTDNATATPSPPATKKASLSSL  644



>ref|XP_002307480.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
 gb|EEE94476.2| hypothetical protein POPTR_0005s21030g [Populus trichocarpa]
Length=651

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENLHKYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  540  WNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLLRSKQKAALEWDRRQAEKANYTDGHW  599

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+E+FCFWESMLWHWGE NWTDN+T TP+PP V T SL SL
Sbjct  600  KIKIKDKRLETCYENFCFWESMLWHWGEKNWTDNATVTPSPPAVTTTSLPSL  651



>gb|KDP43041.1| hypothetical protein JCGZ_25227 [Jatropha curcas]
Length=647

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENLHKYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  534  WNVDILQEFASDVAHKTWWKVHDAMPENLHKYCLLRSKQKAALEWDRRQAEKANYTDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPT--PPMVKTVSLSSL  101
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T TP+  PP + T SLSSL
Sbjct  594  KIKIKDKRLETCFEDFCFWESMLWHWGEKNWTDNATVTPSPPPPAITTKSLSSL  647



>ref|XP_007161486.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
 gb|ESW33480.1| hypothetical protein PHAVU_001G073100g [Phaseolus vulgaris]
Length=645

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPENLHK+CLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  534  WNVDILQEFASDVAHARWWKVHDAMPENLHKFCLLRSKQKAALEWDRRQAEKGNYSDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI+DPRL+ CFEDFCFWESMLWHWGE NWTDNST   +PP+V+T SLSSL
Sbjct  594  KIKIEDPRLKTCFEDFCFWESMLWHWGEKNWTDNSTVNNSPPVVQTKSLSSL  645



>emb|CDP18299.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHRTWWK+HDAMPENLH+YCLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  536  WNVDILQEFASDVAHRTWWKVHDAMPENLHRYCLLRSKQKAALEWDRRQAEKGNYSDGHW  595

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KI+DPRL  CFEDFCFWESMLWHWG+ NWTDN+T+T TP  + T SL S
Sbjct  596  KIKIQDPRLNTCFEDFCFWESMLWHWGDKNWTDNATATSTPKTIPTASLPS  646



>ref|XP_011073953.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
 ref|XP_011073956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Sesamum indicum]
Length=644

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHRTWWK+HDAMP+NL KYCLLRSKQKAALEWDRR+AEK NY+DGHW
Sbjct  533  WNVDILQEFASDVAHRTWWKVHDAMPDNLQKYCLLRSKQKAALEWDRRQAEKSNYSDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI+D RL  CFE+FCFWESMLWHWGETNWTDN TST  PP ++TVSLSSL
Sbjct  593  KIKIQDTRLTTCFEEFCFWESMLWHWGETNWTDNGTSTQPPPAIETVSLSSL  644



>ref|XP_010999819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Populus euphratica]
Length=649

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMP NLHKYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  538  WNVDILQEFASDVAHKTWWKVHDAMPGNLHKYCLLRSKQKAALEWDRRQAEKANYTDGHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+E+FCFWESMLWHWGE NWTDN+T TP+PP V T SL SL
Sbjct  598  KIKIKDKRLETCYENFCFWESMLWHWGEKNWTDNATVTPSPPAVTTTSLPSL  649



>ref|XP_010680014.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Beta vulgaris subsp. vulgaris]
Length=648

 Score =   201 bits (510),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN E LHEFASD+AHRTWWK+HDAMPENLHKYCLLRSKQKA+LEWDRR+AEKGNYTDGHW
Sbjct  536  WNNELLHEFASDIAHRTWWKVHDAMPENLHKYCLLRSKQKASLEWDRRQAEKGNYTDGHW  595

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPM-VKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+T++ +PP  + T SL SL
Sbjct  596  KIKIKDSRLETCFENFCFWESMLWHWGEKNWTDNATTSSSPPTGINTASLPSL  648



>ref|XP_010110482.1| hypothetical protein L484_003528 [Morus notabilis]
 gb|EXC26583.1| hypothetical protein L484_003528 [Morus notabilis]
Length=660

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENLHKYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  550  WNVDILQEFASDVAHKRWWKVHDAMPENLHKYCLLRSKQKAALEWDRRQAEKANYTDGHW  609

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            KVKIKD RL+ICFE+FCFWESMLWHWGE NWTDN+T TP PP + T SLSS
Sbjct  610  KVKIKDKRLKICFEEFCFWESMLWHWGEKNWTDNATVTPAPPAI-TASLSS  659



>ref|XP_010062155.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 ref|XP_010062156.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Eucalyptus grandis]
 gb|KCW69222.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=645

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHRTWWK+HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  534  WNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLLRSKQKAGLEWDRRQAEKGNYTDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE FCFWESMLWHWGE NWTDN+T TP+ P + T SL SL
Sbjct  594  KIKIKDERLKTCFEKFCFWESMLWHWGEKNWTDNATVTPSLPAISTSSLPSL  645



>gb|KCW69223.1| hypothetical protein EUGRSUZ_F02737 [Eucalyptus grandis]
Length=637

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHRTWWK+HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  526  WNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLLRSKQKAGLEWDRRQAEKGNYTDGHW  585

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE FCFWESMLWHWGE NWTDN+T TP+ P + T SL SL
Sbjct  586  KIKIKDERLKTCFEKFCFWESMLWHWGEKNWTDNATVTPSLPAISTSSLPSL  637



>ref|XP_010062154.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Eucalyptus grandis]
Length=646

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHRTWWK+HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  535  WNVDILQEFASDVAHRTWWKVHDAMPENLHKFCLLRSKQKAGLEWDRRQAEKGNYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE FCFWESMLWHWGE NWTDN+T TP+ P + T SL SL
Sbjct  595  KIKIKDERLKTCFEKFCFWESMLWHWGEKNWTDNATVTPSLPAISTSSLPSL  646



>ref|XP_007199740.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
 gb|EMJ00939.1| hypothetical protein PRUPE_ppa002697mg [Prunus persica]
Length=644

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  533  WNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T TP+PP + T S+SS
Sbjct  593  KIKIKDKRLKTCFEDFCFWESMLWHWGEKNWTDNATVTPSPPALTTSSISS  643



>ref|XP_008237654.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Prunus mume]
Length=644

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  533  WNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T TP+PP + T S+SS
Sbjct  593  KIKIKDKRLKTCFEDFCFWESMLWHWGEKNWTDNATVTPSPPALTTSSVSS  643



>ref|XP_004290562.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Fragaria vesca subsp. vesca]
Length=640

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  531  WNVDFLQEFASDVAHKRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T TP+PP V T S++
Sbjct  591  KIKIKDRRLKTCFEDFCFWESMLWHWGEKNWTDNATVTPSPPAVTTASIT  640



>ref|XP_010245814.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245816.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245817.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245818.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245819.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
 ref|XP_010245820.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Nelumbo nucifera]
Length=646

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NYTD HW
Sbjct  535  WNVDILQEFASDVAHKRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYTDEHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++ I D RL+ CFEDFCFWESMLWHWGETNWTDN+T TP PP VKT SLSSL
Sbjct  595  RINITDHRLKTCFEDFCFWESMLWHWGETNWTDNATLTPAPPTVKTASLSSL  646



>gb|KHN41007.1| Glycogenin-2 [Glycine soja]
Length=644

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH  WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  533  WNVDILQEFASNVAHARWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYSDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL  CFEDFCFWESMLWHWGE NWTDNST   +P +V+T SLSSL
Sbjct  593  KIKIKDPRLNTCFEDFCFWESMLWHWGEKNWTDNSTVNNSPLIVQTQSLSSL  644



>ref|XP_003518352.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Glycine max]
Length=644

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH  WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  533  WNVDILQEFASNVAHARWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYSDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL  CFEDFCFWESMLWHWGE NWTDNST   +P +V+T SLSSL
Sbjct  593  KIKIKDPRLNTCFEDFCFWESMLWHWGEKNWTDNSTVNNSPLIVQTQSLSSL  644



>gb|KHN04164.1| Glycogenin-2 [Glycine soja]
Length=643

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH  WWK+HDAMPE L  +CLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  532  WNVDILQEFASNVAHARWWKVHDAMPEKLQNFCLLRSKQKAALEWDRRQAEKGNYSDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+ IKDPRL ICFEDFCFWESMLWHWGE NWTDNST   +PP+V+T SLSSL
Sbjct  592  KINIKDPRLNICFEDFCFWESMLWHWGEKNWTDNSTINNSPPVVQTQSLSSL  643



>gb|KDO83632.1| hypothetical protein CISIN_1g043696mg, partial [Citrus sinensis]
Length=521

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPE+L K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  410  WNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  469

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSS  104
            K+KI+D RL+ CFEDFCFWESMLWHWGE NWTDNST STP PP + + SLSS
Sbjct  470  KIKIQDKRLKTCFEDFCFWESMLWHWGEKNWTDNSTASTPPPPAITSASLSS  521



>ref|XP_006607044.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like, partial [Glycine max]
Length=634

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH  WWK+HDAMPE L  +CLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  523  WNVDILQEFASNVAHARWWKVHDAMPEKLQNFCLLRSKQKAALEWDRRQAEKGNYSDGHW  582

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+ IKDPRL ICFEDFCFWESMLWHWGE NWTDNST   +PP+V+T SLSSL
Sbjct  583  KINIKDPRLNICFEDFCFWESMLWHWGEKNWTDNSTINNSPPVVQTQSLSSL  634



>ref|XP_006472929.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPE+L K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  527  WNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSS  104
            K+KI+D RL+ CFEDFCFWESMLWHWGE NWTDNST STP PP + + SLSS
Sbjct  587  KIKIQDKRLKTCFEDFCFWESMLWHWGEKNWTDNSTASTPPPPAITSASLSS  638



>ref|XP_006434392.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
 gb|ESR47632.1| hypothetical protein CICLE_v10003328mg [Citrus clementina]
Length=638

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPE+L K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  527  WNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSS  104
            K+KI+D RL+ CFEDFCFWESMLWHWGE NWTDNST STP PP + + SLSS
Sbjct  587  KIKIQDKRLKTCFEDFCFWESMLWHWGEKNWTDNSTASTPPPPAITSASLSS  638



>ref|XP_006485174.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Citrus sinensis]
Length=638

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 1/112 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPE+L K+CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  527  WNVDILQEFASDIAHKTWWKVHDAMPEHLQKFCLLRSKQKAALEWDRRQAEKANYTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSS  104
            K+KI+D RL+ CFEDFCFWESMLWHWGE NWTDNST STP PP + + SLSS
Sbjct  587  KIKIQDKRLKTCFEDFCFWESMLWHWGEKNWTDNSTASTPPPPAITSASLSS  638



>gb|KHG03827.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMP NL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  529  WNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  588

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+TSTP+ P     SLS L
Sbjct  589  KIKIKDKRLKKCFEEFCFWESMLWHWGEKNWTDNATSTPSLPATNKASLSLL  640



>gb|KHG05573.1| Glycogenin-2 [Gossypium arboreum]
Length=644

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMP NL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  533  WNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+TSTP+ P     SLS L
Sbjct  593  KIKIKDKRLKKCFEEFCFWESMLWHWGEKNWTDNATSTPSLPATNKASLSLL  644



>ref|XP_004498382.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cicer arietinum]
Length=644

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS++AH  WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEKGN++DGHW
Sbjct  533  WNVDILQEFASNIAHARWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNFSDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRL+ CFEDFCFWESMLWHWGE NWTDNST    PP   T SLSSL
Sbjct  593  KIKIKDPRLKTCFEDFCFWESMLWHWGEKNWTDNSTVNNLPPAFTTKSLSSL  644



>gb|EYU36701.1| hypothetical protein MIMGU_mgv1a005329mg [Erythranthe guttata]
Length=488

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL KYCLLRSKQKAALEWDRR+AEKGNY+DGHW
Sbjct  376  WNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLLRSKQKAALEWDRRQAEKGNYSDGHW  435

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVS  113
            + KI+DPRL  CFE+FCFWESMLWHWG++NWTDN TST  PP    ++
Sbjct  436  RTKIRDPRLTTCFEEFCFWESMLWHWGQSNWTDNGTSTQPPPSTPLIT  483



>ref|XP_009348499.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348515.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=631

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAHR WWK+HDAMP+NL K+CLLRSKQKAALEWDRR+AEK NY+DGHW
Sbjct  520  WNVDFLQEFASNVAHRRWWKVHDAMPQNLQKFCLLRSKQKAALEWDRRQAEKANYSDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T+T +PP + T S+SS
Sbjct  580  KIKIKDKRLKTCFEDFCFWESMLWHWGEKNWTDNATATLSPPALTTASVSS  630



>gb|KEH40452.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=627

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH  WWK+HDAMPENL K+CLLRSKQKAALEWDRR+A+KGNY++GHW
Sbjct  515  WNVDILQEFASNVAHARWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAKKGNYSNGHW  574

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPP-MVKTVSLSSL  101
            K+KIKDPRL+ CFEDFCFWESMLWHWG+ NWTDNST    PP  VKT SLSSL
Sbjct  575  KIKIKDPRLKTCFEDFCFWESMLWHWGDKNWTDNSTVNNLPPAAVKTKSLSSL  627



>gb|KJB80585.1| hypothetical protein B456_013G105100 [Gossypium raimondii]
Length=534

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMP NL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  423  WNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  482

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+TST + P     SLS L
Sbjct  483  KIKIKDKRLKKCFEEFCFWESMLWHWGEKNWTDNATSTLSLPATYKASLSLL  534



>ref|XP_009360737.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=644

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAHR WWK+HDAMPENL  +CLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  533  WNVDFLQEFASNVAHRRWWKVHDAMPENLQNFCLLRSKQKAALEWDRRQAEKANYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T+T +PP +   S++S
Sbjct  593  KIKIKDKRLKTCFEDFCFWESMLWHWGEKNWTDNATATLSPPALTIASVAS  643



>gb|KJB80584.1| hypothetical protein B456_013G105100 [Gossypium raimondii]
Length=644

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMP NL KYCLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  533  WNVDILQEFASDVAHKTWWKVHDAMPGNLQKYCLLRSKQKAQLEWDRRQAEKGNYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FCFWESMLWHWGE NWTDN+TST + P     SLS L
Sbjct  593  KIKIKDKRLKKCFEEFCFWESMLWHWGEKNWTDNATSTLSLPATYKASLSLL  644



>emb|CBI19971.3| unnamed protein product [Vitis vinifera]
Length=558

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWKIHDAMPENL K+CLLRSKQKAALEWDRR+AEKGNYTDGHW
Sbjct  447  WNVDILQEFASNVAHKRWWKIHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYTDGHW  506

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRLQ CFEDFCFWESMLWHWGETNWTDN+T+T  PP   T SL SL
Sbjct  507  KIKIKDPRLQTCFEDFCFWESMLWHWGETNWTDNATATLPPPTTTTASLPSL  558



>ref|XP_009149666.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Brassica rapa]
Length=639

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWW++HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  528  WNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+EDFC+WESMLWHWG+ NWTDNST+T +PP      LSSL
Sbjct  588  KIKIKDKRLETCYEDFCYWESMLWHWGDKNWTDNSTNTLSPPPALKTPLSSL  639



>ref|XP_009149665.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Brassica rapa]
Length=643

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWW++HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  532  WNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+EDFC+WESMLWHWG+ NWTDNST+T +PP      LSSL
Sbjct  592  KIKIKDKRLETCYEDFCYWESMLWHWGDKNWTDNSTNTLSPPPALKTPLSSL  643



>ref|XP_008373924.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X3 [Malus domestica]
Length=625

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAHR WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NY+DGHW
Sbjct  514  WNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYSDGHW  573

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T+T + P   T S+SS
Sbjct  574  KIKIKDERLKTCFEDFCFWESMLWHWGEKNWTDNATATLSTPAHTTASVSS  624



>ref|XP_008373922.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAHR WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NY+DGHW
Sbjct  535  WNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYSDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T+T + P   T S+SS
Sbjct  595  KIKIKDERLKTCFEDFCFWESMLWHWGEKNWTDNATATLSTPAHTTASVSS  645



>gb|KFK44246.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=643

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  531  WNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFEDFCFWESMLWHWG+ NWT+NST S   PP +   SLSSL
Sbjct  591  KIKIKDKRLETCFEDFCFWESMLWHWGDKNWTENSTNSLSPPPALNKTSLSSL  643



>ref|XP_008373923.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=631

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAHR WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEK NY+DGHW
Sbjct  520  WNVDFLQEFASNVAHRRWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKANYSDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+KIKD RL+ CFEDFCFWESMLWHWGE NWTDN+T+T + P   T S+SS
Sbjct  580  KIKIKDERLKTCFEDFCFWESMLWHWGEKNWTDNATATLSTPAHTTASVSS  630



>gb|KFK44245.1| hypothetical protein AALP_AA1G233800 [Arabis alpina]
Length=639

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  527  WNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST-STPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFEDFCFWESMLWHWG+ NWT+NST S   PP +   SLSSL
Sbjct  587  KIKIKDKRLETCFEDFCFWESMLWHWGDKNWTENSTNSLSPPPALNKTSLSSL  639



>ref|XP_010664887.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Vitis vinifera]
Length=642

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWKIHDAMPENL K+CLLRSKQKAALEWDRR+AEKGNYTDGHW
Sbjct  531  WNVDILQEFASNVAHKRWWKIHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYTDGHW  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRLQ CFEDFCFWESMLWHWGETNWTDN+T+T  PP   T SL SL
Sbjct  591  KIKIKDPRLQTCFEDFCFWESMLWHWGETNWTDNATATLPPPTTTTASLPSL  642



>ref|XP_010664886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Vitis vinifera]
Length=643

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWKIHDAMPENL K+CLLRSKQKAALEWDRR+AEKGNYTDGHW
Sbjct  532  WNVDILQEFASNVAHKRWWKIHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYTDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKDPRLQ CFEDFCFWESMLWHWGETNWTDN+T+T  PP   T SL SL
Sbjct  592  KIKIKDPRLQTCFEDFCFWESMLWHWGETNWTDNATATLPPPTTTTASLPSL  643



>ref|XP_010539696.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Tarenaya hassleriana]
Length=640

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPENL K+CLLRSKQKA +EWDRR+AEKGNYTDGHW
Sbjct  528  WNVDILQEFASDIAHKTWWKVHDAMPENLQKFCLLRSKQKAQIEWDRRQAEKGNYTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+ CFEDFCFWESMLWHWG+ NWTDNST+   PP  +  +LS
Sbjct  588  KIKIKDKRLETCFEDFCFWESMLWHWGDKNWTDNSTAGLLPPPGQKFALS  637



>ref|XP_010539695.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Tarenaya hassleriana]
Length=644

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH+TWWK+HDAMPENL K+CLLRSKQKA +EWDRR+AEKGNYTDGHW
Sbjct  532  WNVDILQEFASDIAHKTWWKVHDAMPENLQKFCLLRSKQKAQIEWDRRQAEKGNYTDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+ CFEDFCFWESMLWHWG+ NWTDNST+   PP  +  +LS
Sbjct  592  KIKIKDKRLETCFEDFCFWESMLWHWGDKNWTDNSTAGLLPPPGQKFALS  641



>ref|XP_006302009.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
 gb|EOA34907.1| hypothetical protein CARUB_v10019986mg [Capsella rubella]
Length=618

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+EDFCFWESMLWHWGETN+TDNS++T   P     +LSSL
Sbjct  567  KIKIKDERLKTCYEDFCFWESMLWHWGETNFTDNSSATTVTPPTHKTALSSL  618



>emb|CDY04633.1| BnaC05g16710D [Brassica napus]
Length=639

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWW++HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  528  WNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C+EDFC+WESMLWHWG+ NWTDNST++ +PP      LSSL
Sbjct  588  KIKIKDKRLETCYEDFCYWESMLWHWGDKNWTDNSTNSLSPPPALKTPLSSL  639



>ref|XP_002526157.1| glycogenin, putative [Ricinus communis]
 gb|EEF36233.1| glycogenin, putative [Ricinus communis]
Length=656

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL KYCLLRSKQKAALEWDRR+AEK NYTDGHW
Sbjct  542  WNVDILQEFASDVAHKTWWKVHDAMPENLQKYCLLRSKQKAALEWDRRQAEKANYTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            K+KI+D RL+ CFEDFCFWESMLWHWGETNWTDN+T T
Sbjct  602  KIKIQDKRLETCFEDFCFWESMLWHWGETNWTDNATVT  639



>emb|CDY50243.1| BnaA06g15200D [Brassica napus]
Length=1035

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWW++HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  532  WNVDILQEFASDVAHKTWWRVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL*LE  92
            K+KIKD RL+ C+EDFC+WESMLWHWG+ NWTDNST++ +PP      LSSL +E
Sbjct  592  KIKIKDKRLETCYEDFCYWESMLWHWGDKNWTDNSTNSLSPPPALKTPLSSLAME  646



>ref|XP_010244020.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244021.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244022.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244023.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
 ref|XP_010244024.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Nelumbo nucifera]
Length=648

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEKGNYTDGHW
Sbjct  537  WNVDILQEFASDVAHKQWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYTDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++ I D RL+ CFEDFCFWESMLWHWGETNWTDN+T TPT P V T SLSSL
Sbjct  597  RINITDHRLKTCFEDFCFWESMLWHWGETNWTDNATVTPTTPTVTTASLSSL  648



>ref|XP_010244025.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
 ref|XP_010244026.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Nelumbo nucifera]
Length=589

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+ WWK+HDAMPENL K+CLLRSKQKAALEWDRR+AEKGNYTDGHW
Sbjct  478  WNVDILQEFASDVAHKQWWKVHDAMPENLQKFCLLRSKQKAALEWDRRQAEKGNYTDGHW  537

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++ I D RL+ CFEDFCFWESMLWHWGETNWTDN+T TPT P V T SLSSL
Sbjct  538  RINITDHRLKTCFEDFCFWESMLWHWGETNWTDNATVTPTTPTVTTASLSSL  589



>ref|XP_006416296.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
 gb|ESQ34649.1| hypothetical protein EUTSA_v10007050mg [Eutrema salsugineum]
Length=634

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH+TWWK+HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHW
Sbjct  523  WNVDILQEFASDVAHKTWWKVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHW  582

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C E FC+WESMLWHWG+ NWTDNST++ +PP      LS L
Sbjct  583  KIKIKDKRLETCSEKFCYWESMLWHWGDKNWTDNSTNSLSPPPALKTPLSLL  634



>emb|CDX96589.1| BnaA08g21320D [Brassica napus]
Length=618

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  421  LHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIK  242
            L+EFASDVAHRTWWK+HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHWK+KIK
Sbjct  512  LYEFASDVAHRTWWKVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHWKIKIK  571

Query  241  DPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            D RL+ C+E FC+WESMLWHWG+ NWTDNST++ +PP     +LSS+
Sbjct  572  DKRLETCYEKFCYWESMLWHWGDKNWTDNSTNSLSPPTSLKANLSSV  618



>ref|XP_009348497.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
 ref|XP_009348516.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Pyrus x bretschneideri]
Length=646

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWW++HDAMP NLHK+CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  535  WNVDFMQEFASDVAHNTWWRVHDAMPRNLHKFCLLRTQQKAGLEWDRRQAEKANYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+ C +DFC W+SML HWGE +WTDN+T TP+PP + T S++
Sbjct  595  KIKIKDKRLKTCVQDFCSWKSMLRHWGEKSWTDNTTVTPSPPALTTSSVT  644



>gb|EPS63087.1| hypothetical protein M569_11696, partial [Genlisea aurea]
Length=329

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV++L EFASDVAHRTWWK+HD MPENL  YCLLRSKQKAALEWDRR+AEK N +DGHW
Sbjct  227  WNVDELREFASDVAHRTWWKVHDGMPENLQNYCLLRSKQKAALEWDRRQAEKVNRSDGHW  286

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE--TNWTDNSTSTPTP  134
            ++KI+DPRL+ CFE+FCFWESMLWHWGE  +N T N++S P+P
Sbjct  287  RMKIRDPRLETCFEEFCFWESMLWHWGEEDSNSTANASSHPSP  329



>ref|XP_004166220.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3-like [Cucumis sativus]
Length=634

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWK+HDAMP+NL K+CLLRSKQKA LEWDRR+AEK N+T+GHW
Sbjct  522  WNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLLRSKQKAQLEWDRRQAEKANFTNGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN  155
            K+KIKDPRL+ CFEDFCFWESMLWHWGETNWTDN
Sbjct  582  KIKIKDPRLKTCFEDFCFWESMLWHWGETNWTDN  615



>ref|XP_004148815.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3-like [Cucumis sativus]
 gb|KGN47482.1| hypothetical protein Csa_6G338140 [Cucumis sativus]
Length=634

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWK+HDAMP+NL K+CLLRSKQKA LEWDRR+AEK N+T+GHW
Sbjct  522  WNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLLRSKQKAQLEWDRRQAEKANFTNGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN  155
            K+KIKDPRL+ CFEDFCFWESMLWHWGETNWTDN
Sbjct  582  KIKIKDPRLKTCFEDFCFWESMLWHWGETNWTDN  615



>ref|XP_008441557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Cucumis melo]
Length=634

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFAS+VAH+ WWK+HDAMP+NL K+CLLRSKQKA LEWDRR+AEK N+T+GHW
Sbjct  522  WNVDLLLEFASNVAHKRWWKVHDAMPKNLQKFCLLRSKQKAQLEWDRRQAEKANFTNGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN  155
            K+KIKDPRL+ CFEDFCFWESMLWHWGETNWTDN
Sbjct  582  KIKIKDPRLKTCFEDFCFWESMLWHWGETNWTDN  615



>ref|XP_008237655.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3 [Prunus mume]
Length=644

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WWK+HDAMP+NL  +CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  533  WNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLLRTEQKAGLEWDRRQAEKANYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FC W++ML HWGE NWTDN+  TP+ P + T S+SSL
Sbjct  593  KIKIKDNRLKTCFEEFCSWKNMLRHWGEKNWTDNAIITPSLPALTTASVSSL  644



>ref|XP_008237675.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-glucuronate:xylan 
alpha-glucuronosyltransferase 3 [Prunus mume]
Length=816

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WWK+HDAMP+NL  +CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  705  WNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLLRTEQKAGLEWDRRQAEKANYTDGHW  764

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ CFE+FC W++ML HWGE NWTDN+  TP+ P + T S+SSL
Sbjct  765  KIKIKDNRLKTCFEEFCSWKNMLRHWGEKNWTDNAIITPSLPALTTASVSSL  816



>emb|CDY38807.1| BnaC08g19810D [Brassica napus]
Length=617

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  412  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR  233
            FASDVAHRTWWK+HDAMPENL K+CLLRSKQKA LEWDR +AEKGNYTDGHWK+KIKD R
Sbjct  514  FASDVAHRTWWKVHDAMPENLQKFCLLRSKQKAQLEWDRMQAEKGNYTDGHWKIKIKDKR  573

Query  232  LQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            L+ C+E FC+WESMLWHWG+ NWTDNST++ +P      ++SS+
Sbjct  574  LETCYEKFCYWESMLWHWGDKNWTDNSTNSLSPHTSLKANISSV  617



>ref|XP_007199738.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
 gb|EMJ00937.1| hypothetical protein PRUPE_ppa002694mg [Prunus persica]
Length=644

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WWK+HDAMP+NL  +CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  533  WNVDFMQEFASDVAHKRWWKVHDAMPQNLQNFCLLRTEQKAGLEWDRRQAEKANYTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KIKD RL+ C E+FC W++ML HWGE NWTDN+  TP+ P + T S+SSL
Sbjct  593  KIKIKDNRLKTCSEEFCSWKNMLRHWGEKNWTDNAIITPSLPALTTASVSSL  644



>ref|XP_008373921.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Malus domestica]
Length=548

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWW++HD MP NL K+CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  437  WNVDFMQEFASDVAHNTWWRVHDTMPGNLQKFCLLRTQQKAGLEWDRRQAEKANYTDGHW  496

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+IC +DFC W+SML HWGE +WTDN+T TP+ P + T S++
Sbjct  497  KIKIKDKRLKICVQDFCSWKSMLRHWGEKSWTDNATVTPSLPALTTSSVT  546



>ref|XP_008373920.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Malus domestica]
Length=646

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWW++HD MP NL K+CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  535  WNVDFMQEFASDVAHNTWWRVHDTMPGNLQKFCLLRTQQKAGLEWDRRQAEKANYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+KIKD RL+IC +DFC W+SML HWGE +WTDN+T TP+ P + T S++
Sbjct  595  KIKIKDKRLKICVQDFCSWKSMLRHWGEKSWTDNATVTPSLPALTTSSVT  644



>ref|XP_006427798.1| hypothetical protein CICLE_v10025272mg [Citrus clementina]
 gb|ESR41038.1| hypothetical protein CICLE_v10025272mg [Citrus clementina]
Length=570

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASDVAH  WW++HDAMPE L ++CLLRSKQKA LE+DRR+AEK NYTDGH+
Sbjct  459  WNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLLRSKQKAQLEFDRRQAEKANYTDGHY  518

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+IC ++ C W+SML HWGETNWTD+ +  PTPP + T SLS L
Sbjct  519  KIKVEDGRLKICIDNLCKWKSMLRHWGETNWTDDESFAPTPPALTTASLSGL  570



>ref|XP_006464622.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Citrus sinensis]
Length=642

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASDVAH  WW++HDAMPE L ++CLLRSKQKA LE+DRR+AEK NYTDGH+
Sbjct  531  WNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLLRSKQKAQLEFDRRQAEKANYTDGHY  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+IC ++ C W+SML HWGETNWTD+ +  PTPP + T SLS L
Sbjct  591  KIKVEDGRLKICIDNLCKWKSMLRHWGETNWTDDESFAPTPPALTTASLSGL  642



>ref|XP_009392550.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392551.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392552.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392553.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392554.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392555.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392556.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=642

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWWK+HD MP++L  +CLLRSKQKA LEWDRR+AEK NY+DGHW
Sbjct  539  WNVDIMQEFASDVAHATWWKVHDTMPQHLQSFCLLRSKQKAGLEWDRRQAEKANYSDGHW  598

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN-STSTPTP  134
            +  I DPRL+ICFEDFC+WESMLWHWG+ NW DN +TS PTP
Sbjct  599  RRNITDPRLKICFEDFCYWESMLWHWGDPNWFDNDTTSDPTP  640



>ref|XP_009392557.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWWK+HD MP++L  +CLLRSKQKA LEWDRR+AEK NY+DGHW
Sbjct  538  WNVDIMQEFASDVAHATWWKVHDTMPQHLQSFCLLRSKQKAGLEWDRRQAEKANYSDGHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN-STSTPTP  134
            +  I DPRL+ICFEDFC+WESMLWHWG+ NW DN +TS PTP
Sbjct  598  RRNITDPRLKICFEDFCYWESMLWHWGDPNWFDNDTTSDPTP  639



>ref|XP_010911800.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
 ref|XP_010911801.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Elaeis guineensis]
Length=639

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN + L EFASDVAH  WWK+HD MPE L  +CLLRSKQKAALEWDRR+AEK  + DGHW
Sbjct  532  WNEDILREFASDVAHARWWKVHDTMPEKLQHFCLLRSKQKAALEWDRRQAEKAKFPDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K  I DPRL ICFE+FCFWESMLWHWGETNWTDNS    TP    T +L SL
Sbjct  592  KQNITDPRLHICFEEFCFWESMLWHWGETNWTDNSPVPATP----TAALPSL  639



>gb|KDP24792.1| hypothetical protein JCGZ_25413 [Jatropha curcas]
Length=630

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WWK+HDAMP+ LH++CLL+SKQKA LE+DRR+A+KGNY+DGHW
Sbjct  519  WNVDFFQEFASDIAHERWWKVHDAMPQQLHQFCLLKSKQKAQLEYDRRQAQKGNYSDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K++IKD RL+ C ++ C W+SML HWGETNWTD+    PTPP + T SL+ L
Sbjct  579  KIQIKDSRLKKCVDNLCSWKSMLRHWGETNWTDDDFFNPTPPAISTASLTGL  630



>ref|XP_010911799.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=665

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN + L EFASDVAH  WWK+HD MPE L  +CLLRSKQKAALEWDRR+AEK  + DGHW
Sbjct  558  WNEDILREFASDVAHARWWKVHDTMPEKLQHFCLLRSKQKAALEWDRRQAEKAKFPDGHW  617

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K  I DPRL ICFE+FCFWESMLWHWGETNWTDNS    TP    T +L SL
Sbjct  618  KQNITDPRLHICFEEFCFWESMLWHWGETNWTDNSPVPATP----TAALPSL  665



>ref|NP_177838.2| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 sp|Q8W4A7.1|GUX3_ARATH RecName: Full=Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3; Short=UDP-GlcA:xylan glucuronyltransferase 
3; AltName: Full=Glycogenin-like protein 3; AltName: Full=Plant 
glycogenin-like starch initiation protein 2; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 3; Short=AtGUX3 
[Arabidopsis thaliana]
 gb|AAL32773.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47996.1| unknown protein [Arabidopsis thaliana]
 gb|AEE35939.1| putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Arabidopsis thaliana]
 gb|AHL38869.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=618

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K+KIKD RL+ CFEDFCFWESMLWHWGE
Sbjct  567  KIKIKDKRLKTCFEDFCFWESMLWHWGE  594



>ref|XP_009360735.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Pyrus x bretschneideri]
Length=640

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+TWWK+HDAMP NL K+CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  535  WNVDFMQEFASDVAHKTWWKVHDAMPGNLQKFCLLRTEQKAGLEWDRRQAEKANYTDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KI+D RL+ C E+FC W++ML HWGE NWTDN+  TPT P + T
Sbjct  595  KIKIEDKRLKTCNEEFCSWKNMLQHWGEKNWTDNAIITPTLPALTT  640



>ref|XP_009360736.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Pyrus x bretschneideri]
Length=639

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+TWWK+HDAMP NL K+CLLR++QKA LEWDRR+AEK NYTDGHW
Sbjct  534  WNVDFMQEFASDVAHKTWWKVHDAMPGNLQKFCLLRTEQKAGLEWDRRQAEKANYTDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KI+D RL+ C E+FC W++ML HWGE NWTDN+  TPT P + T
Sbjct  594  KIKIEDKRLKTCNEEFCSWKNMLQHWGEKNWTDNAIITPTLPALTT  639



>gb|KDO58344.1| hypothetical protein CISIN_1g006648mg [Citrus sinensis]
Length=637

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASDVAH  WW++HDAMPE L ++CLLRSKQKA LE+DRR+AE  NYTDGH+
Sbjct  526  WNVDIFQEFASDVAHAKWWRVHDAMPEQLQQFCLLRSKQKAQLEFDRRQAEMANYTDGHY  585

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+IC ++ C W+SML HWGETNWTD+ +  PTPP + T SLS L
Sbjct  586  KIKVEDGRLKICIDNLCKWKSMLRHWGETNWTDDESFAPTPPALTTASLSGL  637



>gb|KHN31133.1| Glycogenin-2 [Glycine soja]
Length=633

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL+SKQKA LEWDR++AE  NYTDGHW
Sbjct  522  WNDDIFHEFASDVAHAKWWKVHDAMPELLQQFCLLKSKQKAQLEWDRKQAEIANYTDGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+SML HWGETNWTD+   TPTPP V T SLS+L
Sbjct  582  RIKVKDRRLKKCIDNLCNWKSMLRHWGETNWTDDEFYTPTPPTVITASLSAL  633



>ref|XP_006578795.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Glycine max]
 ref|XP_006578796.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Glycine max]
Length=639

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL+SKQKA LEWDR++AE  NYTDGHW
Sbjct  528  WNDDIFHEFASDVAHAKWWKVHDAMPELLQQFCLLKSKQKAQLEWDRKQAEIANYTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+SML HWGETNWTD+   TPTPP V T SLS+L
Sbjct  588  RIKVKDRRLKKCIDNLCNWKSMLRHWGETNWTDDEFYTPTPPTVITASLSAL  639



>ref|XP_003525117.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=640

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++C+L+SKQKA LEWDRR+AE  NYT+GHW
Sbjct  529  WNSDIFHEFASDVAHGRWWKVHDAMPELLQQFCMLKSKQKAQLEWDRRQAEIANYTNGHW  588

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C WE+ML HWGETNWTD+ + TPTPP + T SLS L
Sbjct  589  QIKVKDKRLKKCIDNLCSWENMLKHWGETNWTDDESYTPTPPAISTSSLSDL  640



>gb|KHN34064.1| Glycogenin-2 [Glycine soja]
Length=580

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++C+L+SKQKA LEWDRR+AE  NYT+GHW
Sbjct  469  WNSDIFHEFASDVAHGRWWKVHDAMPELLQQFCMLKSKQKAQLEWDRRQAEIANYTNGHW  528

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C WE+ML HWGETNWTD+ + TPTPP + T SLS L
Sbjct  529  QIKVKDKRLKKCIDNLCSWENMLKHWGETNWTDDESYTPTPPAISTSSLSDL  580



>ref|XP_002889125.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65384.1| hypothetical protein ARALYDRAFT_476876 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K+KIKD RL+ CFE+FCFWESMLWHWGE
Sbjct  567  KIKIKDERLKTCFENFCFWESMLWHWGE  594



>ref|XP_010416641.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K+KIKD RL+ C+EDFCFWESMLWHWGE
Sbjct  567  KIKIKDERLKTCYEDFCFWESMLWHWGE  594



>ref|XP_010428781.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K+KIKD RL+ C+EDFCFWESMLWHWGE
Sbjct  567  KIKIKDERLKTCYEDFCFWESMLWHWGE  594



>ref|XP_010471900.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Camelina sativa]
Length=619

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  507  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  566

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K+KIKD RL+ C+EDFCFWESMLWHWGE
Sbjct  567  KIKIKDERLKTCYEDFCFWESMLWHWGE  594



>ref|XP_010090867.1| hypothetical protein L484_020727 [Morus notabilis]
 gb|EXB40992.1| hypothetical protein L484_020727 [Morus notabilis]
Length=636

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WW++HDAMP  L ++CLLRSKQKA LEWDRR+AEKGNYTDGHW
Sbjct  525  WNVDILQEFASDVAHERWWRVHDAMPGLLQQFCLLRSKQKAQLEWDRRQAEKGNYTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+ ML HWGETNWTD     P+PP +   SLS L
Sbjct  585  RIKVKDRRLKRCVDNLCNWKDMLKHWGETNWTDTEFFIPSPPAITATSLSGL  636



>ref|XP_008798993.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
 ref|XP_008798994.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Phoenix dactylifera]
Length=639

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MPENL  +CLL+SKQKAALEWDRR+A K N+ DGHW
Sbjct  532  WNEGILQEFASDVAHARWWKVHDTMPENLQHFCLLKSKQKAALEWDRRQARKANFPDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K  I DPRL ICFE+FCFWESMLWHWGETN T++S    TP    TV+L SL
Sbjct  592  KRNITDPRLHICFEEFCFWESMLWHWGETNLTNDSPVRATP----TVALPSL  639



>gb|KCW71171.1| hypothetical protein EUGRSUZ_F04263 [Eucalyptus grandis]
Length=396

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH TWWK+HDAMPE+LHK+CLL SKQKAALEW RR AE+GNYTDGHW
Sbjct  285  WNVDYYREFASDAAHGTWWKLHDAMPEHLHKFCLLSSKQKAALEWHRRRAERGNYTDGHW  344

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI D RL+ C E+FC+WES L HWGE NWT+++T +     +   SLSSL
Sbjct  345  KIKIADERLKACSEEFCYWESTLLHWGEKNWTNDATDSSLTHTMSNQSLSSL  396



>gb|AAC34345.1| Unknown protein [Arabidopsis thaliana]
Length=1201

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -3

Query  436   WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
             WNV+   EFASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHW
Sbjct  1090  WNVDIFQEFASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHW  1149

Query  256   KVKIKDPRLQICFEDFCFWESMLWHWGE  173
             K+KIKD RL+ CFEDFCFWESMLWHWGE
Sbjct  1150  KIKIKDKRLKTCFEDFCFWESMLWHWGE  1177


 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV   H+FASD AH+TWW++HDAMP+ L ++CLL SKQKA LEWDRR+AEK NY DGHW
Sbjct  483  WNVVGYHQFASDEAHKTWWRVHDAMPKKLQRFCLLSSKQKAQLEWDRRQAEKANYRDGHW  542

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            ++KIKD RL  CFEDFCFWESMLWHWG+
Sbjct  543  RIKIKDKRLTTCFEDFCFWESMLWHWGD  570



>ref|XP_008798991.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Phoenix dactylifera]
Length=665

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 86/112 (77%), Gaps = 4/112 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MPENL  +CLL+SKQKAALEWDRR+A K N+ DGHW
Sbjct  558  WNEGILQEFASDVAHARWWKVHDTMPENLQHFCLLKSKQKAALEWDRRQARKANFPDGHW  617

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K  I DPRL ICFE+FCFWESMLWHWGETN T++S    TP    TV+L SL
Sbjct  618  KRNITDPRLHICFEEFCFWESMLWHWGETNLTNDSPVRATP----TVALPSL  665



>emb|CDP04731.1| unnamed protein product [Coffea canephora]
Length=648

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFA+DV HR+WWK+HDAMPE L  +CLL S+QKA LEWDRR+AEK NYTDGHW
Sbjct  538  WNVDILQEFATDVGHRSWWKVHDAMPERLQDFCLLSSRQKAQLEWDRRQAEKANYTDGHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K++I+DPR + C +  C W+SML HWGE NWTD+    PTPP + T SLSS
Sbjct  598  KLRIEDPRSKKCIDRLCNWKSMLRHWGEKNWTDDPHFYPTPPSITTASLSS  648



>gb|KHG14645.1| Glycogenin-2 [Gossypium arboreum]
Length=643

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE LH++C+LRSKQKA LE DRREAEK N++DGHW
Sbjct  532  WNVDIMLEFASDVAHERWWKVHDAMPEKLHQFCMLRSKQKAQLEVDRREAEKANFSDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD R + C ++ C W SML HWGE+NWTD+    PTPP + T SLS L
Sbjct  592  RIKVKDRRTKKCIDNVCSWRSMLKHWGESNWTDDEFYVPTPPAINTASLSGL  643



>ref|XP_004163053.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=681

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WW +HD MPE L ++CLLRSKQKA LEWDR +AE GNYTDGHW
Sbjct  524  WNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLLRSKQKAQLEWDRIQAEIGNYTDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+ ML HWGETNWTD+  + PTPP +K+ +LS++
Sbjct  584  RIKVKDKRLKKCIDNVCSWKGMLRHWGETNWTDDEFTXPTPPAIKSAALSAI  635



>ref|XP_011007559.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=630

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  519  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEYDRREAEKANYTDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWTD+    P+PP + T SLS L
Sbjct  579  KIKVQDRRLKKCIDNVCNWKSMLKHWGETNWTDDEFLNPSPPAISTASLSGL  630



>ref|XP_008441030.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
 ref|XP_008441032.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Cucumis melo]
Length=628

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WW++HD MPE L ++CLLRSKQKA LEWDR +AE GNYTDGHW
Sbjct  518  WNVDIMQEFASDVAHQRWWQVHDQMPELLQQFCLLRSKQKAQLEWDRIQAEIGNYTDGHW  577

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+K+KD RL+ C ++ C W+ ML HWGETNWTD+    PTPP +K+ +LS+
Sbjct  578  KIKVKDKRLKKCIDNVCSWKGMLRHWGETNWTDDEFYVPTPPAIKSAALSA  628



>ref|XP_011007558.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=631

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  520  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEYDRREAEKANYTDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWTD+    P+PP + T SLS L
Sbjct  580  KIKVQDRRLKKCIDNVCNWKSMLKHWGETNWTDDEFLNPSPPAISTASLSGL  631



>ref|XP_011007557.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=636

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  525  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEYDRREAEKANYTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWTD+    P+PP + T SLS L
Sbjct  585  KIKVQDRRLKKCIDNVCNWKSMLKHWGETNWTDDEFLNPSPPAISTASLSGL  636



>gb|KJB71319.1| hypothetical protein B456_011G116600 [Gossypium raimondii]
Length=574

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE LH++C+LRSKQKA LE DRREAEK N++DGHW
Sbjct  463  WNVDIMLEFASDVAHERWWKVHDAMPEKLHQFCMLRSKQKAQLEVDRREAEKANFSDGHW  522

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD R + C ++ C W SML HWGE+NWTD+    PTPP + T SLS L
Sbjct  523  RIKVKDRRRKKCIDNVCSWRSMLKHWGESNWTDDEFYVPTPPAINTASLSGL  574



>gb|KJB71320.1| hypothetical protein B456_011G116600 [Gossypium raimondii]
Length=643

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE LH++C+LRSKQKA LE DRREAEK N++DGHW
Sbjct  532  WNVDIMLEFASDVAHERWWKVHDAMPEKLHQFCMLRSKQKAQLEVDRREAEKANFSDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD R + C ++ C W SML HWGE+NWTD+    PTPP + T SLS L
Sbjct  592  RIKVKDRRRKKCIDNVCSWRSMLKHWGESNWTDDEFYVPTPPAINTASLSGL  643



>ref|XP_006858468.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
 gb|ERN19935.1| hypothetical protein AMTR_s00071p00107830 [Amborella trichopoda]
Length=640

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASD+AH  WWK+HD MPE L ++CLLRSKQKA LEWDRR+AEK  Y DGHW
Sbjct  531  WNVDILQEFASDIAHWRWWKVHDMMPEKLQRFCLLRSKQKAGLEWDRRQAEKAAYDDGHW  590

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN  155
            K  I DPRL+ICFE+FCFWESMLWHWGETNWTD+
Sbjct  591  KRNITDPRLKICFEEFCFWESMLWHWGETNWTDD  624



>gb|KHN44079.1| Glycogenin-2 [Glycine soja]
Length=503

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEF SDVAH  WWK+HD MPE L ++C+L+SKQKA LEWDRR+AE  NYT GHW
Sbjct  379  WNCDVFHEFPSDVAHERWWKVHDVMPELLQQFCMLKSKQKAQLEWDRRQAEVANYTSGHW  438

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL*LEDV  86
            ++K+KD RL+ C ++ C WE+ML HWGETNWTD+ + TPTPP + T SLS L L ++
Sbjct  439  QIKVKDTRLKKCIDNLCSWENMLKHWGETNWTDDESHTPTPPAIATSSLSDLRLVNL  495



>ref|XP_004148647.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cucumis sativus]
Length=630

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WW +HD MPE L ++CLLRSKQKA LEWDR +AE GNYTDGHW
Sbjct  518  WNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLLRSKQKAQLEWDRIQAEIGNYTDGHW  577

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+ ML HWGETNWTD+    PTPP +K+ +LS++
Sbjct  578  RIKVKDKRLKKCIDNVCSWKGMLRHWGETNWTDDEFYVPTPPAIKSAALSAI  629



>gb|KGN48367.1| hypothetical protein Csa_6G483470 [Cucumis sativus]
Length=630

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH+ WW +HD MPE L ++CLLRSKQKA LEWDR +AE GNYTDGHW
Sbjct  518  WNVDIMQEFASDVAHQRWWTVHDQMPELLQQFCLLRSKQKAQLEWDRIQAEIGNYTDGHW  577

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+ ML HWGETNWTD+    PTPP +K+ +LS++
Sbjct  578  RIKVKDKRLKKCIDNVCSWKGMLRHWGETNWTDDEFYVPTPPAIKSAALSAI  629



>ref|XP_002307022.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
 gb|EEE94018.2| hypothetical protein POPTR_0005s06280g [Populus trichocarpa]
Length=631

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  520  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEYDRREAEKANYTDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W++ML HWGETNWTD+    P+PP + T SLS L
Sbjct  580  KIKVQDRRLKKCIDNVCNWKTMLKHWGETNWTDDEFLNPSPPAISTASLSGL  631



>ref|XP_003602583.1| Secondary cell wall-related glycosyltransferase family [Medicago 
truncatula]
 gb|AES72834.1| UDP-glucuronate:xylan alpha-glucuronosyltransferase [Medicago 
truncatula]
Length=637

 Score =   162 bits (410),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMP+ L ++CLL+SKQKA LEWDR +AE  NYTDGHW
Sbjct  526  WNADIFHEFASDVAHAKWWKVHDAMPKLLQQFCLLQSKQKAQLEWDRSQAEIANYTDGHW  585

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+SML HWGE+NWTD+ + TPTPP V   SLS+L
Sbjct  586  RIKVKDRRLKKCIDNLCDWKSMLRHWGESNWTDDESFTPTPPTVTMSSLSAL  637



>ref|XP_004502919.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Cicer arietinum]
Length=695

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL SKQKA LEWDR +AE  NYTDGHW
Sbjct  584  WNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLLPSKQKAQLEWDRSQAEIANYTDGHW  643

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K +D RL  C ++ C W+SML HWGETNWTD+ + TPTPP+V   SLS+L
Sbjct  644  RIKARDRRLNKCIDNLCNWKSMLRHWGETNWTDDESFTPTPPIVTLSSLSAL  695



>ref|XP_010063886.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Eucalyptus grandis]
Length=635

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH TWWK+HDAMPE+LHK+CLL SKQKAALEW RR AE+GNYTDGHW
Sbjct  524  WNVDYYREFASDAAHGTWWKLHDAMPEHLHKFCLLSSKQKAALEWHRRRAERGNYTDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI D RL+ C E+FC+WES L HWGE NWT+++T +     +   SLSSL
Sbjct  584  KIKIADERLKACSEEFCYWESTLLHWGEKNWTNDATDSSLTHTMSNQSLSSL  635



>ref|XP_010680250.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010680251.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=644

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN + L EFASDVAH  WWK+HDAMPE L  +CLLR+KQKA +EWDRR+AEKGNY+DGHW
Sbjct  532  WNTDFLQEFASDVAHARWWKVHDAMPEKLQGFCLLRTKQKAQIEWDRRQAEKGNYSDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+ +KD R++ C +  C W+ ML HWGETNWTD+ +    PP++K   LSSL
Sbjct  592  KITVKDKRMKKCIDKLCNWKGMLKHWGETNWTDDESYALAPPIIKVTPLSSL  643



>ref|XP_007048325.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOX92482.1| Plant glycogenin-like starch initiation protein 1 isoform 1 [Theobroma 
cacao]
Length=648

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE +H++C+LRS QKA LE+DRR+AEK N+TDGHW
Sbjct  537  WNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCMLRSTQKAQLEFDRRQAEKANFTDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL  C ++ C W+SML HWGE+NWT++    PTPP + T SL+ L
Sbjct  597  KIKVQDKRLMKCIDNVCSWKSMLKHWGESNWTNDEFFVPTPPAINTASLAGL  648



>ref|XP_006645120.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=636

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW
Sbjct  528  WNVEILREFASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE   + N    P  P   T SLSS
Sbjct  588  RRNITDPRLKTCFEKFCFWESMLWHWGEAKNSTNENPVPATP---TASLSS  635



>ref|XP_007048326.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
 gb|EOX92483.1| Plant glycogenin-like starch initiation protein 1 isoform 2 [Theobroma 
cacao]
Length=653

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE +H++C+LRS QKA LE+DRR+AEK N+TDGHW
Sbjct  542  WNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCMLRSTQKAQLEFDRRQAEKANFTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL  C ++ C W+SML HWGE+NWT++    PTPP + T SL+ L
Sbjct  602  KIKVQDKRLMKCIDNVCSWKSMLKHWGESNWTNDEFFVPTPPAINTASLAGL  653



>ref|XP_011097058.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097059.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097060.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
 ref|XP_011097061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Sesamum indicum]
Length=627

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHR WWK+HDAMPE L ++CLL SKQKA LEWDRR+AE+ N++DGHW
Sbjct  517  WNVDILQEFASDVAHRKWWKVHDAMPEKLQEFCLLISKQKAQLEWDRRQAEQRNFSDGHW  576

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K++I+D R++ C + +C W+SML HWGETNWT++    PTPP + T S S
Sbjct  577  KIRIQDKRIKKCIDPYCHWQSMLRHWGETNWTESEFPVPTPPALITTSAS  626



>ref|XP_011097062.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Sesamum indicum]
Length=621

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAHR WWK+HDAMPE L ++CLL SKQKA LEWDRR+AE+ N++DGHW
Sbjct  511  WNVDILQEFASDVAHRKWWKVHDAMPEKLQEFCLLISKQKAQLEWDRRQAEQRNFSDGHW  570

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K++I+D R++ C + +C W+SML HWGETNWT++    PTPP + T S S
Sbjct  571  KIRIQDKRIKKCIDPYCHWQSMLRHWGETNWTESEFPVPTPPALITTSAS  620



>gb|AAX33317.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=636

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASDVAH  WW++HDAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  525  WNADIFQEFASDVAHEKWWRVHDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  585  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  636



>emb|CBI37563.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASDVAH  WW++HDAMPE L ++C+L SKQKA LEWDRR+AEK NY+DGHW
Sbjct  458  WNSDIFQEFASDVAHTRWWRVHDAMPEQLQQFCMLGSKQKAGLEWDRRQAEKANYSDGHW  517

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            ++KI D RL  C ++ C W+ ML HWGETNWTD+   TPTPP +   SLS 
Sbjct  518  RIKINDRRLHKCIDNLCSWKGMLRHWGETNWTDDEIFTPTPPAITMASLSG  568



>ref|XP_002517237.1| glycogenin, putative [Ricinus communis]
 gb|EEF45137.1| glycogenin, putative [Ricinus communis]
Length=630

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW++HDAMP+ LH++CLL+SKQKA LEWDR +AEK NYTDGHW
Sbjct  518  WNVDFFQEFASDIAHERWWRVHDAMPQQLHQFCLLKSKQKAQLEWDRIQAEKANYTDGHW  577

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT-VSLSSL  101
            K+K+KD RL+ C ++ C W+SML HWGETNWTD+    PTPP + T  SL  L
Sbjct  578  KIKVKDNRLKKCIDNLCSWKSMLRHWGETNWTDDEFFNPTPPAITTKASLPGL  630



>ref|XP_009414973.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414974.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414975.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=643

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH TWWK+HD MP++L  +CLLR+KQKAALEWDRR+A+K NY+DGHW
Sbjct  537  WNVDIMQEFASDVAHTTWWKVHDVMPKHLQSFCLLRTKQKAALEWDRRQAKKANYSDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            + KI DPRL+ CFEDFC+W+SMLWHWG+ NW+D + ++
Sbjct  597  RRKITDPRLKKCFEDFCYWQSMLWHWGDPNWSDENLTS  634



>ref|XP_011022955.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Populus euphratica]
Length=636

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  525  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  585  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  636



>ref|XP_002275240.2| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Vitis vinifera]
Length=640

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASDVAH  WW++HDAMPE L ++C+L SKQKA LEWDRR+AEK NY+DGHW
Sbjct  530  WNSDIFQEFASDVAHTRWWRVHDAMPEQLQQFCMLGSKQKAGLEWDRRQAEKANYSDGHW  589

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            ++KI D RL  C ++ C W+ ML HWGETNWTD+   TPTPP +   SLS 
Sbjct  590  RIKINDRRLHKCIDNLCSWKGMLRHWGETNWTDDEIFTPTPPAITMASLSG  640



>ref|XP_011022956.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X3 [Populus euphratica]
Length=631

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  520  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  580  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  631



>ref|XP_011022957.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X4 [Populus euphratica]
Length=631

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  520  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  580  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  631



>ref|XP_011022954.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Populus euphratica]
Length=637

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  526  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  585

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  586  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  637



>ref|XP_011022958.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X5 [Populus euphratica]
Length=630

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD+AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  519  WNVDIFQEFASDIAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWT++    P+PP + T SL  L
Sbjct  579  KIKVQDRRLKKCVDNVCNWKSMLKHWGETNWTNDEFFNPSPPAISTASLPGL  630



>ref|XP_010649390.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Vitis vinifera]
Length=555

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASDVAH  WW++HDAMPE L ++C+L SKQKA LEWDRR+AEK NY+DGHW
Sbjct  445  WNSDIFQEFASDVAHTRWWRVHDAMPEQLQQFCMLGSKQKAGLEWDRRQAEKANYSDGHW  504

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            ++KI D RL  C ++ C W+ ML HWGETNWTD+   TPTPP +   SLS 
Sbjct  505  RIKINDRRLHKCIDNLCSWKGMLRHWGETNWTDDEIFTPTPPAITMASLSG  555



>gb|AAX33316.1| secondary cell wall-related glycosyltransferase family 8 [Populus 
tremula x Populus tremuloides]
Length=649

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFASD AH  WW+++DAMPE LH++C L+SKQKA LE+DRREAEK NYTD HW
Sbjct  538  WNVDIFQEFASDTAHEKWWRVYDAMPEQLHQFCSLKSKQKAQLEYDRREAEKANYTDDHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGETNWTD+    P+PP + T SLS L
Sbjct  598  KIKVQDRRLKKCIDNVCNWKSMLKHWGETNWTDDEFLNPSPPAISTASLSGL  649



>ref|XP_009776714.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X3 [Nicotiana sylvestris]
Length=627

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEKG Y DGHW
Sbjct  511  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKGKYVDGHW  570

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT
Sbjct  571  KIKIKDRRLKRCTDSLCNWKGMLKHWGEKNWTDDPFFHPSPPTLKT  616



>ref|XP_009776715.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X4 [Nicotiana sylvestris]
Length=626

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEKG Y DGHW
Sbjct  510  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKGKYVDGHW  569

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT
Sbjct  570  KIKIKDRRLKRCTDSLCNWKGMLKHWGEKNWTDDPFFHPSPPTLKT  615



>ref|XP_009776713.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Nicotiana sylvestris]
Length=632

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEKG Y DGHW
Sbjct  516  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKGKYVDGHW  575

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT
Sbjct  576  KIKIKDRRLKRCTDSLCNWKGMLKHWGEKNWTDDPFFHPSPPTLKT  621



>ref|XP_009776712.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana sylvestris]
Length=633

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEKG Y DGHW
Sbjct  517  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKGKYVDGHW  576

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT
Sbjct  577  KIKIKDRRLKRCTDSLCNWKGMLKHWGEKNWTDDPFFHPSPPTLKT  622



>gb|KCW62287.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=633

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFAS+VAH  WW++HDAMPE L ++C+L SKQKA LEWDRREAEK NY DGHW
Sbjct  522  WNVDFFQEFASNVAHERWWRVHDAMPEVLKQFCMLGSKQKAQLEWDRREAEKANYADGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+K+KD RL  C ++ C W+SML HWGE NWTD+    P+PP + T SLS
Sbjct  582  KIKVKDARLGKCIDNLCNWKSMLRHWGEMNWTDDQFLPPSPPAISTASLS  631



>ref|XP_010025567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 ref|XP_010025568.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Eucalyptus grandis]
 gb|KCW62286.1| hypothetical protein EUGRSUZ_H04942 [Eucalyptus grandis]
Length=639

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+   EFAS+VAH  WW++HDAMPE L ++C+L SKQKA LEWDRREAEK NY DGHW
Sbjct  528  WNVDFFQEFASNVAHERWWRVHDAMPEVLKQFCMLGSKQKAQLEWDRREAEKANYADGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+K+KD RL  C ++ C W+SML HWGE NWTD+    P+PP + T SLS
Sbjct  588  KIKVKDARLGKCIDNLCNWKSMLRHWGEMNWTDDQFLPPSPPAISTASLS  637



>ref|XP_002456736.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
 gb|EES01856.1| hypothetical protein SORBIDRAFT_03g041660 [Sorghum bicolor]
Length=633

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFASDVAH  WWK+H+ MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  524  WNVEILREFASDVAHARWWKVHNKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I DPRL+ CFE FCFWESMLWHWGE    +NST     P   T SLSS
Sbjct  584  KRNITDPRLKTCFEKFCFWESMLWHWGENK--NNSTQNSAVPATPTASLSS  632



>ref|XP_006406580.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
 gb|ESQ48033.1| hypothetical protein EUTSA_v10020243mg [Eutrema salsugineum]
Length=658

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  542  FNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYEDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPRL+IC +  C W+SML HWGE+NWTD  +  PTPP +  V  SS+
Sbjct  602  KIRVKDPRLKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITAVRRSSI  653



>ref|XP_002885270.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61529.1| hypothetical protein ARALYDRAFT_479372 [Arabidopsis lyrata subsp. 
lyrata]
Length=659

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMPE LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  543  FNSDIFVEFATDIAHRKWWMVHDAMPEELHQFCYLRSKQKAQLEYDRRQAEAANYADGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K++IKDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct  603  KIRIKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITAARRSSL  654



>emb|CDY38364.1| BnaA02g18570D [Brassica napus]
Length=555

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE  H+FASD AH+TWW++HDAMPE+L ++CLLRS+QKA L+WDRR+ +KG Y DGHW
Sbjct  444  WNVEGYHQFASDEAHKTWWRVHDAMPESLQRFCLLRSEQKAKLDWDRRQTDKGKYIDGHW  503

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI+D RL+ CFE FC WE ML +WGETN T NS+   + P +KT + +SL
Sbjct  504  KIKIEDNRLETCFETFCNWEIMLLNWGETNTTGNSSIAASSPSLKTAAKTSL  555



>ref|XP_009145872.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Brassica rapa]
Length=656

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  540  FNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHW  599

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +  V  +SL
Sbjct  600  KIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITAVRKTSL  651



>dbj|BAJ87020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  256  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  315

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I D RL+ICFE FCFWESMLWHWGE     NST   + P + T +LSS
Sbjct  316  KRNITDKRLKICFEKFCFWESMLWHWGE---APNSTKKASTPALPTATLSS  363



>ref|XP_002310513.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
 gb|EEE90963.2| hypothetical protein POPTR_0007s04030g [Populus trichocarpa]
Length=630

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASD+AH  WW++HDAMPE LH++C L+SKQKA LE+DRREAEK NYTDGHW
Sbjct  519  WNADIFQEFASDIAHEKWWRVHDAMPEQLHQFCSLKSKQKAQLEFDRREAEKANYTDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K++D RL+ C ++ C W+SML HWGE+NWT++    P+PP   T SL  L
Sbjct  579  KIKVQDRRLKKCVDNVCNWKSMLKHWGESNWTNDEFFNPSPPATSTASLPGL  630



>ref|XP_010312475.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Solanum lycopersicum]
Length=627

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WW++HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  513  WNVDILQEFASDVAHHKWWRVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  572

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI D RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT   SS+
Sbjct  573  KMKINDRRLKRCTDRLCNWKGMLKHWGEKNWTDDPFFHPSPPTIKTKKTSSI  624



>ref|XP_004249893.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Solanum lycopersicum]
Length=633

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WW++HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  519  WNVDILQEFASDVAHHKWWRVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+KI D RL+ C +  C W+ ML HWGE NWTD+    P+PP +KT   SS+
Sbjct  579  KMKINDRRLKRCTDRLCNWKGMLKHWGEKNWTDDPFFHPSPPTIKTKKTSSI  630



>ref|XP_009112560.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Brassica rapa]
Length=661

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  543  FNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYLRSKQKAQLEYDRRQAEAANYTDGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE--TNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K+KDPR +IC +  C W+SML HWGE  +NWTD+ +  PTPP +  V  SSL
Sbjct  603  KIKVKDPRFKICIDKLCNWKSMLRHWGESNSNWTDDESFVPTPPAITAVRRSSL  656



>ref|XP_009112567.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Brassica rapa]
Length=660

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 2/114 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  542  FNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYLRSKQKAQLEYDRRQAEAANYTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE--TNWTDNSTSTPTPPMVKTVSLSSL  101
            K+K+KDPR +IC +  C W+SML HWGE  +NWTD+ +  PTPP +  V  SSL
Sbjct  602  KIKVKDPRFKICIDKLCNWKSMLRHWGESNSNWTDDESFVPTPPAITAVRRSSL  655



>ref|NP_001189927.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AEE76129.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=654

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  538  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct  598  KIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSL  649



>ref|NP_566615.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AAL07212.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13228.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76127.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
Length=655

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  539  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHW  598

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct  599  KIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSL  650



>ref|NP_001030722.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 sp|Q9LSB1.1|GUX1_ARATH RecName: Full=UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1; Short=UDP-GlcA:xylan glucuronyltransferase 1; AltName: 
Full=Glycogenin-like protein 1; AltName: Full=Plant glycogenin-like 
starch initiation protein 1; AltName: Full=Protein 
GLUCURONIC ACID SUBSTITUTION OF XYLAN 1; Short=AtGUX1 [Arabidopsis 
thaliana]
 dbj|BAB01792.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU93699.1| glycogenin-like starch initiation protein [Arabidopsis thaliana]
 gb|AEE76128.1| plant glycogenin-like starch initiation protein 1 [Arabidopsis 
thaliana]
 gb|AHL38759.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=659

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHW
Sbjct  543  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct  603  KIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSL  654



>ref|XP_010487789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=660

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  543  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHLRSKQKAQLEYDRRQAEAANYTDGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP + +   SS
Sbjct  603  KLRVKDPRFKICIDQLCNWKSMLRHWGESNWTDYESFVPTPPAITSARRSS  653



>ref|XP_009594275.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009594276.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Nicotiana tomentosiformis]
Length=633

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  517  WNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  576

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWG+ NWTD+    P+PP +KT
Sbjct  577  KIKIKDRRLKRCTDRLCNWKGMLKHWGQKNWTDDPFFHPSPPTLKT  622



>ref|XP_009594279.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X4 [Nicotiana tomentosiformis]
Length=626

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  510  WNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  569

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWG+ NWTD+    P+PP +KT
Sbjct  570  KIKIKDRRLKRCTDRLCNWKGMLKHWGQKNWTDDPFFHPSPPTLKT  615



>ref|XP_009594278.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X3 [Nicotiana tomentosiformis]
Length=627

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  511  WNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  570

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWG+ NWTD+    P+PP +KT
Sbjct  571  KIKIKDRRLKRCTDRLCNWKGMLKHWGQKNWTDDPFFHPSPPTLKT  616



>ref|XP_009594277.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Nicotiana tomentosiformis]
Length=632

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  516  WNVDILQEFASDVAHHKWWKVHDAMPEELQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  575

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            K+KIKD RL+ C +  C W+ ML HWG+ NWTD+    P+PP +KT
Sbjct  576  KIKIKDRRLKRCTDRLCNWKGMLKHWGQKNWTDDPFFHPSPPTLKT  621



>ref|XP_010550280.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Tarenaya hassleriana]
Length=654

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFASDVAH+ WW++HDAMP+ LH++C LRSKQKA LE+DR++A  GNY+DGHW
Sbjct  541  FNADIFLEFASDVAHQRWWRVHDAMPQVLHQFCYLRSKQKAQLEYDRQQAGMGNYSDGHW  600

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSL  110
            +++IKDPR  IC +  C W  ML HWGE+NWTD+ +  PTPP + T +L
Sbjct  601  RIRIKDPRFNICIDKLCNWRDMLRHWGESNWTDDESFAPTPPAITTTAL  649



>gb|EEC71899.1| hypothetical protein OsI_04661 [Oryza sativa Indica Group]
Length=635

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW
Sbjct  527  WNNPILREFASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE+    NST     P   T SL+S
Sbjct  587  RRNITDPRLKTCFEKFCFWESMLWHWGESK---NSTKENPVPATPTASLTS  634



>ref|NP_001044991.1| Os01g0880200 [Oryza sativa Japonica Group]
 dbj|BAD81673.1| glycogenin-like protein [Oryza sativa Japonica Group]
 dbj|BAF06905.1| Os01g0880200 [Oryza sativa Japonica Group]
Length=635

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW
Sbjct  527  WNNPILREFASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE+    NST     P   T SL+S
Sbjct  587  RRNITDPRLKTCFEKFCFWESMLWHWGESK---NSTKENPVPATPTASLTS  634



>ref|XP_010550282.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Tarenaya hassleriana]
Length=653

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFASDVAH+ WW++HDAMP+ LH++C LRSKQKA LE+DR++A  GNY+DGHW
Sbjct  540  FNADIFLEFASDVAHQRWWRVHDAMPQVLHQFCYLRSKQKAQLEYDRQQAGMGNYSDGHW  599

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSL  110
            +++IKDPR  IC +  C W  ML HWGE+NWTD+ +  PTPP + T +L
Sbjct  600  RIRIKDPRFNICIDKLCNWRDMLRHWGESNWTDDESFAPTPPAITTTAL  648



>dbj|BAJ87677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=633

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  525  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I D RL+ICFE FCFWESMLWHWGE     NST   + P + T +LSS
Sbjct  585  KRNITDKRLKICFEKFCFWESMLWHWGE---APNSTKKASTPALPTATLSS  632



>dbj|BAG90458.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW
Sbjct  467  WNNPILREFASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHW  526

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE+    NST     P   T SL+S
Sbjct  527  RRNITDPRLKTCFEKFCFWESMLWHWGESK---NSTKENPVPATPTASLTS  574



>gb|EAZ14371.1| hypothetical protein OsJ_04291 [Oryza sativa Japonica Group]
Length=651

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 3/111 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L EFASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW
Sbjct  543  WNNPILREFASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE+    NST     P   T SL+S
Sbjct  603  RRNITDPRLKTCFEKFCFWESMLWHWGESK---NSTKENPVPATPTASLTS  650



>ref|XP_008674740.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Zea mays]
 tpg|DAA56541.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=634

 Score =   154 bits (389),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFA+DVAH  WWK+H+ MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  524  WNVEILREFATDVAHARWWKVHNKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGET-NWTDNSTSTPTPPMVKTVSLS  107
            K  I DPRL+ CFE FCFWESMLWHWGE  N +  S++ P  P   ++S S
Sbjct  584  KRNITDPRLKTCFEKFCFWESMLWHWGENKNNSTQSSAVPATPAATSLSSS  634



>ref|XP_010465976.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Camelina sativa]
Length=661

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  544  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHLRSKQKAQLEYDRRQAEAANYTDGHW  603

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP + +   S
Sbjct  604  KLRVKDPRFKICIDQLCNWKSMLRHWGESNWTDYESFVPTPPAITSAGRS  653



>ref|XP_010507061.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Camelina sativa]
Length=660

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  543  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCHLRSKQKAQLEYDRRQAEAANYTDGHW  602

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP + +   SS
Sbjct  603  KLRVKDPRFKICIDKLCNWKSMLGHWGESNWTDYESFVPTPPAITSDRRSS  653



>ref|NP_001140733.1| uncharacterized protein LOC100272808 [Zea mays]
 gb|ACF84493.1| unknown [Zea mays]
Length=168

 Score =   145 bits (367),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFASDVAH  WWK+H+ MP  L  YCLLRS  KA LEW+RR+AEK N+TDGHW
Sbjct  51   WNVEILREFASDVAHARWWKVHNRMPRKLQSYCLLRSSLKAGLEWERRQAEKANFTDGHW  110

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            K  + DPRL+ CFE FCFWESMLWHWGE +   NST+T
Sbjct  111  KRNVTDPRLKTCFEKFCFWESMLWHWGEKS-KSNSTTT  147



>emb|CDM85463.1| unnamed protein product [Triticum aestivum]
Length=634

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  525  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I D RL+ICFE FCFWESMLWHWGE    +NST   + P +   +LSS
Sbjct  585  KRNITDKRLKICFEKFCFWESMLWHWGEA--PNNSTKKASTPALPAATLSS  633



>tpg|DAA56540.1| TPA: hypothetical protein ZEAMMB73_374443 [Zea mays]
Length=640

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFA+DVAH  WWK+H+ MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  530  WNVEILREFATDVAHARWWKVHNKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  589

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGET-NWTDNSTSTPTPPMVKTVSLS  107
            K  I DPRL+ CFE FCFWESMLWHWGE  N +  S++ P  P   ++S S
Sbjct  590  KRNITDPRLKTCFEKFCFWESMLWHWGENKNNSTQSSAVPATPAATSLSSS  640



>ref|XP_006297149.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
 gb|EOA30047.1| hypothetical protein CARUB_v10013152mg [Capsella rubella]
Length=664

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE   Y DGHW
Sbjct  547  FNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAAKYVDGHW  606

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K+++KDPR +IC +  C W+SML HWGE+NWTD  +  PTPP +  V  SS
Sbjct  607  KLRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITAVRRSS  657



>ref|XP_011466789.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=634

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   EFASDVAH +WWKIHDAMPE L ++C LR+KQKA LEWDRREAEK N+TDGHW
Sbjct  522  WNSDIFQEFASDVAHASWWKIHDAMPELLQQFCFLRTKQKAQLEWDRREAEKANFTDGHW  581

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTS-TPTPPMVKTVSLSSL  101
            K+KIKD RL+ C ++ C W+ ML HWGETNWTD+    +PT P +   S + +
Sbjct  582  KIKIKDRRLKRCVDNVCSWKGMLKHWGETNWTDDQVVYSPTLPAITATSTAGV  634



>emb|CDY18535.1| BnaA01g26600D [Brassica napus]
Length=660

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  542  FNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYLRSKQKAQLEYDRRQAEAANYTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE--TNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR + C +  C W+SML HWGE  +NWTD+ +  PTPP +  V  SSL
Sbjct  602  KIRVKDPRFKTCIDKLCNWKSMLRHWGESNSNWTDDESFVPTPPAITAVRRSSL  655



>emb|CDY53768.1| BnaC01g43920D [Brassica napus]
Length=660

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NYTDGHW
Sbjct  542  FNSDIFVEFATDIAHRRWWMVHDAMPKELHQFCYLRSKQKAQLEYDRRQAEAANYTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE--TNWTDNSTSTPTPPMVKTVSLSSL  101
            K+++KDPR + C +  C W+SML HWGE  +NWTD+ +  PTPP +  V  SSL
Sbjct  602  KIRVKDPRFKTCIDKLCNWKSMLRHWGESNSNWTDDESFVPTPPAITAVRRSSL  655



>ref|XP_003568405.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=628

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 81/111 (73%), Gaps = 4/111 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + +FASDVAH  WWK+HD MP  L  YCLLRS+QKA LEWDRR AEK N+ DGHW
Sbjct  521  WNSLVMRDFASDVAHNRWWKVHDKMPRKLQSYCLLRSRQKAGLEWDRRRAEKANFEDGHW  580

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            + KI DPRL+IC + FCFWESMLWHWGETN T    S P  P+   VSLSS
Sbjct  581  QRKITDPRLKICIDKFCFWESMLWHWGETNQT---KSLPV-PVTPAVSLSS  627



>gb|KFK39187.1| hypothetical protein AALP_AA3G211300 [Arabis alpina]
Length=1277

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = -3

Query  436   WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
             +N +   EFA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY+DGHW
Sbjct  1161  FNSDIFVEFATDIAHRRWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYSDGHW  1220

Query  256   KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
             K+++KD R +IC +  C W+SML HWGE+NWTD  +  PTPP +  +  SSL
Sbjct  1221  KIRVKDRRFKICIDKLCSWKSMLRHWGESNWTDYESFVPTPPAITALRRSSL  1272



>gb|EMS55920.1| Glycogenin-1 [Triticum urartu]
Length=622

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  513  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  572

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I D RL+ICFE FCFWESMLWHWGE    +N+T   + P +   +LSS
Sbjct  573  KRNITDKRLKICFEKFCFWESMLWHWGEA--PNNATKKASTPALPAATLSS  621



>gb|EMT19434.1| Glycogenin-1 [Aegilops tauschii]
Length=642

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  533  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  592

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I D RL+ICFE FCFWESMLWHWGE    +N+T     P +   +LSS
Sbjct  593  KRNITDKRLKICFEKFCFWESMLWHWGEA--PNNATKKAPTPALPAATLSS  641



>emb|CDX92257.1| BnaA05g21500D [Brassica napus]
Length=629

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  412  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR  233
            FA+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHWK+++KD R
Sbjct  521  FATDIAHRRWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDKR  580

Query  232  LQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
             +IC +  C W+SML HWGE+NWTD  +  PTPP +  V  +SL
Sbjct  581  FKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITAVRKTSL  624



>ref|XP_006581757.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Glycine max]
Length=639

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL+SKQKA LEWDRR+AE  NYTDGHW
Sbjct  528  WNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLLKSKQKAQLEWDRRQAEIANYTDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+SML HWGETNWTD+   TPTPP V T SLS+L
Sbjct  588  QIKVKDRRLKKCIDNLCNWKSMLRHWGETNWTDDEFYTPTPPTVTTTSLSAL  639



>gb|KFK42115.1| hypothetical protein AALP_AA2G212800 [Arabis alpina]
Length=415

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  412  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR  233
            FASD AHRTWW++HD M ENL ++CLLRSKQKA LEWDRR+AEKG+Y DGHWK+KI+D R
Sbjct  312  FASDEAHRTWWRVHDGMSENLQRFCLLRSKQKAQLEWDRRQAEKGSYVDGHWKIKIQDKR  371

Query  232  LQICFEDFCFWESMLWHWGET  170
            LQICFE FCFWESML HWGET
Sbjct  372  LQICFEKFCFWESMLLHWGET  392



>ref|XP_007159826.1| hypothetical protein PHAVU_002G270800g [Phaseolus vulgaris]
 gb|ESW31820.1| hypothetical protein PHAVU_002G270800g [Phaseolus vulgaris]
Length=221

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN    HEFASDVAH  WWK+HDAMP+ L ++C+L+SKQKA LE DRR+ E  NY+DGHW
Sbjct  105  WNAYIFHEFASDVAHERWWKVHDAMPKLLEQFCMLKSKQKAQLECDRRQGEIANYSDGHW  164

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDN-STSTPTPPMVKTVSLSSL  101
            ++K+K  RL+   +  C W++ML HWGETNWTD+ S  TPTPP + T SLS L
Sbjct  165  RIKVKHKRLKKGMDKLCSWKNMLKHWGETNWTDDESYYTPTPPAIATTSLSDL  217



>ref|XP_010930628.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Elaeis guineensis]
Length=648

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN + + EFASDVAH  WWK+HD MPE L  +CLL +K+KA+LEWDRR A K NY+DGHW
Sbjct  542  WNEDIMQEFASDVAHARWWKVHDTMPEYLQSFCLLSTKRKASLEWDRRLARKANYSDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            + KI DPR  ICFEDFC+WESMLWHWG+ N+ DN T++
Sbjct  602  RRKIHDPRRHICFEDFCYWESMLWHWGDPNYDDNPTTS  639



>ref|XP_007137705.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
 gb|ESW09699.1| hypothetical protein PHAVU_009G148800g [Phaseolus vulgaris]
Length=636

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL+SKQKA LEWDRR+AE  NYTDGHW
Sbjct  525  WNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLLKSKQKAQLEWDRRQAEIANYTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W++ML HWGETNWTD+   TPTPP +   SLS+L
Sbjct  585  RIKVKDRRLKKCIDNLCNWKTMLRHWGETNWTDDEFYTPTPPTITKTSLSAL  636



>gb|EMT13493.1| Glycogenin-1 [Aegilops tauschii]
Length=685

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK HD MP  L  YCLLR++QKA LEWDRR+AEK N  DGHW
Sbjct  576  WNNFMMREFASDVAHSRWWKTHDKMPRKLQSYCLLRTRQKAGLEWDRRQAEKANLEDGHW  635

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            +  I DPRL+ CFE FCFWESMLWHWGE    + + S P P    T+SLSS
Sbjct  636  RRNITDPRLKTCFEKFCFWESMLWHWGEAK--NQTKSIPAPATPATMSLSS  684



>dbj|BAG89254.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+  + EFASDVAH  WWK+HD MPE L  YCLLRSK KA LEW+RR+AEK N  DGHW
Sbjct  113  WNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLLRSKLKAGLEWERRQAEKANLEDGHW  172

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            +  I DPRL IC+E FC+WESML HWGE N T+N+   P P  + +
Sbjct  173  RRNITDPRLTICYEKFCYWESMLLHWGEKNPTNNN---PVPATISS  215



>ref|XP_008654538.1| PREDICTED: uncharacterized protein LOC100272808 isoform X1 [Zea 
mays]
 gb|AFW84389.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
 gb|AFW84390.1| hypothetical protein ZEAMMB73_479538 [Zea mays]
Length=641

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE L EFASDVAH  WWK+H+ MP  L  YCLLRS  KA LEW+RR+AEK N+TDGHW
Sbjct  524  WNVEILREFASDVAHARWWKVHNRMPRKLQSYCLLRSSLKAGLEWERRQAEKANFTDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTS  146
            K  + DPRL+ CFE FCFWESMLWHWGE + ++++T+
Sbjct  584  KRNVTDPRLKTCFEKFCFWESMLWHWGEKSKSNSTTT  620



>ref|XP_002441128.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
 gb|EES19558.1| hypothetical protein SORBIDRAFT_09g020930 [Sorghum bicolor]
Length=631

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLRS+QKA+LEWDRR+AEK N  DGHW
Sbjct  524  WNNAGMREFASDVAHARWWKVHDKMPRKLQSYCLLRSRQKASLEWDRRQAEKANSEDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            +  I D RL+ CFE FCFWESMLWHWGE    +N+ +   P  VKT SL+
Sbjct  584  RRNITDTRLKTCFEKFCFWESMLWHWGE----NNNRTKSIPMAVKTASLA  629



>ref|XP_003564767.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=632

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L EFASD+AH  WWK+HD MP+ L  YCLLRS+ KA LEW+RR+AEK N+TDGHW
Sbjct  525  WNVPILREFASDIAHTRWWKVHDKMPKKLQSYCLLRSRLKAGLEWERRQAEKANFTDGHW  584

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            +  I D RL+ CFE FCFWESMLWHWGET    NST   T P V+ +   SL
Sbjct  585  RRNITDRRLKTCFEKFCFWESMLWHWGETT---NSTKK-TLPAVQALPAESL  632



>dbj|BAJ87861.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLR++QKA LEWDRR+AEK N  DGHW
Sbjct  240  WNNFIMREFASDVAHNRWWKVHDKMPRKLQSYCLLRTRQKAGLEWDRRQAEKANLEDGHW  299

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTP  134
            +  I DPRL+ CFE FCFWESMLWHWGE    + + S P P
Sbjct  300  RRNITDPRLKTCFEKFCFWESMLWHWGEAK--NQTKSIPAP  338



>gb|KHN09596.1| Glycogenin-1 [Glycine soja]
Length=639

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +  HEFASDVAH  WWK+HDAMPE L ++CLL+SKQKA LEWDRR+AE  NYTD HW
Sbjct  528  WNADIFHEFASDVAHAKWWKVHDAMPELLQQFCLLKSKQKAQLEWDRRQAEIANYTDEHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++K+KD RL+ C ++ C W+SML HWGETNWTD+   TPTPP V T SLS+L
Sbjct  588  QIKVKDRRLKKCIDNLCNWKSMLRHWGETNWTDDEFYTPTPPTVTTASLSAL  639



>ref|XP_008647980.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 ref|XP_008647981.1| PREDICTED: LOC100286027 isoform X1 [Zea mays]
 gb|ACR35990.1| unknown [Zea mays]
 gb|AFW78066.1| secondary cell wall glycosyltransferase family 8 isoform 1 [Zea 
mays]
 gb|AFW78067.1| secondary cell wall glycosyltransferase family 8 isoform 2 [Zea 
mays]
Length=632

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLRS+QKA LEWDRR+AEK N  DGHW
Sbjct  528  WNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLLRSRQKARLEWDRRQAEKANSQDGHW  587

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            ++ + D RL+ CFE FCFWESMLWHWGE     NS  T + PM  T + S
Sbjct  588  RLNVTDTRLKTCFEKFCFWESMLWHWGE-----NSNRTKSVPMAATTARS  632



>ref|XP_008647982.1| PREDICTED: LOC100286027 isoform X2 [Zea mays]
 gb|ACR37754.1| unknown [Zea mays]
Length=546

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLRS+QKA LEWDRR+AEK N  DGHW
Sbjct  442  WNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLLRSRQKARLEWDRRQAEKANSQDGHW  501

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            ++ + D RL+ CFE FCFWESMLWHWGE     NS  T + PM  T + S
Sbjct  502  RLNVTDTRLKTCFEKFCFWESMLWHWGE-----NSNRTKSVPMAATTARS  546



>ref|NP_001152387.1| LOC100286027 [Zea mays]
 gb|ACG47359.1| secondary cell wall-related glycosyltransferase family 8 [Zea 
mays]
Length=633

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLRS+QKA LEWDRR+AEK N  DGHW
Sbjct  529  WNNAGMREFASDVAHARWWKVHDRMPRKLQSYCLLRSRQKARLEWDRRQAEKANSQDGHW  588

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            ++ + D RL+ CFE FCFWESMLWHWGE     NS  T + PM  T + S
Sbjct  589  RLNVTDTRLKTCFEKFCFWESMLWHWGE-----NSNRTKSVPMAATTARS  633



>gb|EYU18058.1| hypothetical protein MIMGU_mgv1a018384mg, partial [Erythranthe 
guttata]
Length=627

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WW++HD+MPE L ++CLL SKQKA LEWDRR A +GNY+DGHW
Sbjct  515  WNVDILREFASDVAHGKWWRVHDSMPEELREFCLLESKQKAQLEWDRRRAAEGNYSDGHW  574

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMV  125
            +++IKD RL+ C + +C W SML HWGETNWT       TPP +
Sbjct  575  RIEIKDGRLKRCVDPYCNWRSMLRHWGETNWTGADFPVHTPPAL  618



>gb|AGT16755.1| glycogenin [Saccharum hybrid cultivar R570]
Length=631

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLRS+QKA+LEWDRR+AEK N  DGHW
Sbjct  524  WNNAGMREFASDVAHARWWKVHDKMPRKLQSYCLLRSRQKASLEWDRRQAEKANSEDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLS  107
            +  I D RL+ CFE FCFWESMLWHWGE    +N+ +   P  V T SL+
Sbjct  584  RRNITDTRLKTCFEKFCFWESMLWHWGE----NNNRTKSIPMAVTTASLA  629



>gb|EEC79261.1| hypothetical protein OsI_20036 [Oryza sativa Indica Group]
Length=671

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+  + EFASDVAH  WWK+HD MPE L  YCLLRSK KA LEW+RR+AEK N  DGHW
Sbjct  568  WNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLLRSKLKAGLEWERRQAEKANLEDGHW  627

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            +  I DPRL IC+E FC+WESML HWGE N T+N+   P P  + +
Sbjct  628  RRNITDPRLTICYEKFCYWESMLLHWGEKNPTNNN---PVPATISS  670



>gb|AAS90653.1| putative glycogenin [Oryza sativa Japonica Group]
Length=671

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+  + EFASDVAH  WWK+HD MPE L  YCLLRSK KA LEW+RR+AEK N  DGHW
Sbjct  568  WNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLLRSKLKAGLEWERRQAEKANLEDGHW  627

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            +  I DPRL IC+E FC+WESML HWGE N T+N+   P P  + +
Sbjct  628  RRNITDPRLTICYEKFCYWESMLLHWGEKNPTNNN---PVPATISS  670



>ref|XP_006654430.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Oryza brachyantha]
Length=626

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MPE L  YC LRS+ KA LEWDRR+AEK ++ DGHW
Sbjct  524  WNNPVMREFASDVAHARWWKVHDKMPEKLQSYCFLRSRLKAGLEWDRRQAEKASFDDGHW  583

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTP  134
            +  I DPRL ICFE FCFWESMLWHWGE N T    S P P
Sbjct  584  RRNITDPRLNICFEKFCFWESMLWHWGEKNPTG---SDPVP  621



>gb|KHG15344.1| Glycogenin-2 [Gossypium arboreum]
Length=640

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE L ++C+LRS+QKA LE+DRR+AEK  + DGHW
Sbjct  529  WNVDIMVEFASDVAHERWWKVHDAMPEELQEFCMLRSRQKAQLEFDRRQAEKAKFRDGHW  588

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++KI+D RL+ C ++ C W+ ML  WG+ NWT++    PTPP + T  LS  
Sbjct  589  RIKIEDKRLEKCIDNRCKWKGMLKQWGKGNWTNDEAFVPTPPAINTKFLSGF  640



>gb|EEE63788.1| hypothetical protein OsJ_18611 [Oryza sativa Japonica Group]
Length=684

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+  + EFASDVAH  WWK+HD MPE L  YCLLRSK KA LEW+RR+AEK N  DGHW
Sbjct  581  WNIPLMREFASDVAHARWWKVHDNMPEKLQSYCLLRSKLKAGLEWERRQAEKANLEDGHW  640

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT  119
            +  I DPRL IC+E FC+WESML HWGE N T+N+   P P  + +
Sbjct  641  RRNITDPRLTICYEKFCYWESMLLHWGEKNPTNNN---PVPATISS  683



>dbj|BAJ85213.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=628

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   + EFASDVAH  WWK+HD MP  L  YCLLR++QKA LEWDRR+AEK N  DGHW
Sbjct  521  WNNFIMREFASDVAHNRWWKVHDKMPRKLQSYCLLRTRQKAGLEWDRRQAEKANLEDGHW  580

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTP  134
            +  I DPRL+ CFE FCFWESMLWHWGE    + + S P P
Sbjct  581  RRNITDPRLKTCFEKFCFWESMLWHWGEAK--NQTKSIPAP  619



>ref|XP_008786543.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=644

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN++ + EFASDVAH  WWK+HD MPE L  +CLL +K+KA+LEWDRR A+K NY+D HW
Sbjct  538  WNLDIMQEFASDVAHARWWKVHDTMPEYLQSFCLLSTKRKASLEWDRRLAKKANYSDVHW  597

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            + KI DPR  ICFE++C+WESMLWHWG+ N+ DN +++
Sbjct  598  RRKISDPRRHICFEEYCYWESMLWHWGDPNYDDNPSTS  635



>ref|XP_006350977.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X1 [Solanum tuberosum]
Length=636

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  519  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  578

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPT  137
            K+KI D RL+ C +  C W+ ML HWGE NWTD+    P+
Sbjct  579  KIKINDRRLKRCTDRLCNWKGMLKHWGEKNWTDDPFFHPS  618



>ref|XP_006350978.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Solanum tuberosum]
Length=630

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ L EFASDVAH  WWK+HDAMPE L  +CLLRSKQKA LEWDRREAEK  Y DGHW
Sbjct  513  WNVDILQEFASDVAHHKWWKVHDAMPEQLQDFCLLRSKQKAQLEWDRREAEKAKYVDGHW  572

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPT  137
            K+KI D RL+ C +  C W+ ML HWGE NWTD+    P+
Sbjct  573  KIKINDRRLKRCTDRLCNWKGMLKHWGEKNWTDDPFFHPS  612



>gb|EPS62267.1| hypothetical protein M569_12523, partial [Genlisea aurea]
Length=503

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE LHEFASD AHR WW +HD+MPE L ++CLL SKQKA LEWDR +AEK N++DGHW
Sbjct  400  WNVEILHEFASDAAHRRWWAVHDSMPEKLQEFCLLPSKQKAQLEWDRIQAEKANFSDGHW  459

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMV  125
            K+ I+D R+  C + +C W SML  WGE NWT+     PTPP +
Sbjct  460  KIGIEDGRIMKCIDPYCEWRSMLSRWGEKNWTETEFPIPTPPAL  503



>gb|EPS60482.1| hypothetical protein M569_14321, partial [Genlisea aurea]
Length=317

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE+LH  ASDVAHRTWWK+HD MPENLH+YCLLRSK KAALEW RR AEKGNY+ GHW
Sbjct  232  WNVEELHTCASDVAHRTWWKVHDGMPENLHRYCLLRSKYKAALEWIRRRAEKGNYSAGHW  291

Query  256  KVKIKDPRLQICFEDFCFWESMLWHW  179
            K+ I+DPRL++CFE++C WE++   W
Sbjct  292  KMTIRDPRLEMCFEEYCSWETVYRRW  317



>gb|KJB40458.1| hypothetical protein B456_007G064800 [Gossypium raimondii]
Length=640

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HD+MPE L ++C+LRS+QKA LE+DRR+AEK  + DGHW
Sbjct  529  WNVDIMVEFASDVAHDRWWKVHDSMPEELQEFCMLRSRQKAQLEFDRRQAEKAKFRDGHW  588

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL  101
            ++KI+D RL+ C ++ C W+ ML  WG+ NWT++    PTPP + T  LS  
Sbjct  589  RIKIEDKRLEKCIDNRCKWKGMLKQWGKGNWTNDEAFVPTPPAINTKFLSGF  640



>ref|XP_002990211.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
 gb|EFJ08771.1| hypothetical protein SELMODRAFT_131094, partial [Selaginella 
moellendorffii]
Length=528

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +KLHE+A+D AH  WW++HD+M + L  YCLLRSKQKA+LEWDRR+AE+  + DGHW
Sbjct  417  WNQQKLHEYANDAAHARWWRVHDSMSKKLQGYCLLRSKQKASLEWDRRQAEQQRFPDGHW  476

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            ++KI+D RL+ CFE+FC+WESMLWHWGE
Sbjct  477  RIKIRDSRLRTCFEEFCYWESMLWHWGE  504



>ref|XP_002992480.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
 gb|EFJ06418.1| hypothetical protein SELMODRAFT_135481, partial [Selaginella 
moellendorffii]
Length=516

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +KLHE+A+D AH  WW++HD+M + L  YCLLRSKQKA+LEWDRR+AE+  + DGHW
Sbjct  405  WNQQKLHEYANDAAHARWWRVHDSMSKKLQGYCLLRSKQKASLEWDRRQAEQQRFPDGHW  464

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            ++KI+D RL+ CFE+FC+WESMLWHWGE
Sbjct  465  RIKIRDSRLRTCFEEFCYWESMLWHWGE  492



>gb|EPS59757.1| hypothetical protein M569_15049, partial [Genlisea aurea]
Length=494

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE+L EFASD AHR WWK+HD+MPE L +YCLLR+ QKA LEWDRREAEKGNY+DGHW
Sbjct  405  WNVERLQEFASDAAHRRWWKMHDSMPEKLQRYCLLRTIQKAQLEWDRREAEKGNYSDGHW  464

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETN  167
            K+++KD R+  C +  C W  ML HW   N
Sbjct  465  KMEVKDDRIDKCIDRDCSWRGMLRHWEIKN  494



>ref|XP_011099766.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X2 [Sesamum indicum]
Length=605

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV++L EFAS+VAHRTWWK+HD MPE L  +C+L++ QKA LEWDRREAEK NY+DGHW
Sbjct  511  WNVDQLQEFASNVAHRTWWKVHDMMPEKLQGFCMLKTIQKAQLEWDRREAEKANYSDGHW  570

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGET  170
            +++I+D RL  C +  C W+ ML HWGE 
Sbjct  571  RIRIRDERLIRCIDQDCSWQGMLRHWGEN  599



>ref|XP_011099765.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 isoform X1 [Sesamum indicum]
Length=614

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV++L EFAS+VAHRTWWK+HD MPE L  +C+L++ QKA LEWDRREAEK NY+DGHW
Sbjct  520  WNVDQLQEFASNVAHRTWWKVHDMMPEKLQGFCMLKTIQKAQLEWDRREAEKANYSDGHW  579

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETN  167
            +++I+D RL  C +  C W+ ML HWGE  
Sbjct  580  RIRIRDERLIRCIDQDCSWQGMLRHWGENT  609



>ref|XP_009411206.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=569

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   +FASD AH TWW++HDA+PENL  +CLL +K KA LE  RR+AEK  Y DGHW
Sbjct  468  WNPQSYRDFASDAAHATWWRVHDALPENLRGFCLLPTKTKAYLEHIRRQAEKAKYPDGHW  527

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTP  140
            K  I DPRL +C E+FC WESML HWGE N   +S + P
Sbjct  528  KQNITDPRLGVCAEEFCSWESMLLHWGEANSPHDSAAAP  566



>emb|CDP04730.1| unnamed protein product [Coffea canephora]
Length=644

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV KLHEFASD AH +WW++HDAMPE L  +C L+SKQKA L +DRREAEK NYTDGHW
Sbjct  553  WNVGKLHEFASDDAHGSWWEVHDAMPEKLQDFCKLKSKQKAQLNYDRREAEKRNYTDGHW  612

Query  256  KVKIKDPRLQICFEDFC--FWESMLWHWGET  170
            K+KIKDPR   C +D C   +ES LW WGE 
Sbjct  613  KIKIKDPRFMKCSDDLCDFDFESRLWRWGEI  643



>ref|XP_010921631.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
 ref|XP_010921632.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN     +FASD AH  WWK+HD MPENL ++CLL S +KA LE DRR+AEK +Y DGHW
Sbjct  532  WNDAGFQQFASDEAHARWWKVHDMMPENLQRFCLLTSLRKAILERDRRQAEKASYPDGHW  591

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I DPRL ICFE+FC WE +L     ++WT++S +    P  +T +LSS
Sbjct  592  KRNISDPRLHICFEEFCLWERIL-----SDWTNDSPA----PATQTAALSS  633



>ref|XP_009420264.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=643

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +K   FASD AH TWW++HD +PE+L   CLL +K+KA LE++RR+AEK NY DGHW
Sbjct  536  WNSQKFWGFASDAAHATWWRVHDTLPEDLQNLCLLSTKRKAYLEYNRRKAEKANYPDGHW  595

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNS  152
            +  I DPR +IC E FC WESML HWGE   ++NS
Sbjct  596  RRNITDPRSEICSEAFCNWESMLLHWGEKRPSNNS  630



>ref|XP_010921630.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Elaeis guineensis]
Length=659

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN     +FASD AH  WWK+HD MPENL ++CLL S +KA LE DRR+AEK +Y DGHW
Sbjct  558  WNDAGFQQFASDEAHARWWKVHDMMPENLQRFCLLTSLRKAILERDRRQAEKASYPDGHW  617

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS  104
            K  I DPRL ICFE+FC WE +L     ++WT++S +    P  +T +LSS
Sbjct  618  KRNISDPRLHICFEEFCLWERIL-----SDWTNDSPA----PATQTAALSS  659



>ref|XP_009384289.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Musa acuminata subsp. malaccensis]
Length=630

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            W+++    FASD AH TWWK+HDA+ ENL ++CLL++K KA LE++RR+A K N+ DGHW
Sbjct  535  WDLQMFWGFASDAAHATWWKVHDALSENLQRFCLLQTKTKAFLEYNRRQAAKANFPDGHW  594

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNST  149
            +  I DPRL IC E FC WE ML HWGE N ++ S+
Sbjct  595  RRNISDPRLHICHERFCSWERMLLHWGEANSSNASS  630



>ref|XP_009404956.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=641

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            W++     FASD AH TWWK+HD + E L  +CLL +K KA LE++RR+AEK +Y DGHW
Sbjct  534  WDLRTYWGFASDAAHETWWKVHDTLTEKLKAFCLLTTKTKAYLEYNRRQAEKASYPDGHW  593

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTP  134
            +  I DPRL +C E FC WESML HWGE N +D+  +   P
Sbjct  594  RKNITDPRLHVCAEKFCSWESMLVHWGEKNSSDDRHTNANP  634



>ref|XP_009404954.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404955.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=644

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            W++     FASD AH TWWK+HD + E L  +CLL +K KA LE++RR+AEK +Y DGHW
Sbjct  537  WDLRTYWGFASDAAHETWWKVHDTLTEKLKAFCLLTTKTKAYLEYNRRQAEKASYPDGHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTSTPTP  134
            +  I DPRL +C E FC WESML HWGE N +D+  +   P
Sbjct  597  RKNITDPRLHVCAEKFCSWESMLVHWGEKNSSDDRHTNANP  637



>ref|XP_007048327.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
 gb|EOX92484.1| Plant glycogenin-like starch initiation protein 1 isoform 3, 
partial [Theobroma cacao]
Length=621

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV+ + EFASDVAH  WWK+HDAMPE +H++C+LRS QKA LE+DRR+AEK N+TDGHW
Sbjct  542  WNVDIMLEFASDVAHERWWKVHDAMPEQVHQFCMLRSTQKAQLEFDRRQAEKANFTDGHW  601

Query  256  KVKIKDPRLQICFEDFCFWE  197
            K+K++D RL  C ++ C W+
Sbjct  602  KIKVQDKRLMKCIDNVCSWK  621



>ref|XP_008803691.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Phoenix dactylifera]
Length=746

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN   L  FASDVAH  WWK+HD MPENL  +CLL S +KA LE DRR+AEK +  DGHW
Sbjct  661  WNYVGLPMFASDVAHARWWKVHDMMPENLQSFCLLSSMRKAVLEQDRRQAEKASNPDGHW  720

Query  256  KVKIKDPRLQICFEDFCFWESML  188
            K  I DPRL+ICFE+FC WES+L
Sbjct  721  KRNISDPRLKICFEEFCSWESIL  743



>ref|XP_009408314.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=631

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN      FASD AH TWWK+HD+MPE+L  +CLL +  KA LE+ RREAEK N+ D HW
Sbjct  537  WNSVTYRSFASDEAHATWWKVHDSMPESLQSFCLLSTLTKAGLEYARREAEKANFPDRHW  596

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            +  + DPR  +CFE FC WE+ML HW E
Sbjct  597  RRNVTDPRRHVCFEKFCRWEAMLLHWDE  624



>ref|XP_010110483.1| hypothetical protein L484_003529 [Morus notabilis]
 gb|EXC26584.1| hypothetical protein L484_003529 [Morus notabilis]
Length=523

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN +   +FASD AH TWWK+ D MPE L ++CLL  KQKA LEWDRR AE+ NY+DGHW
Sbjct  441  WNEKYATKFASDDAHETWWKVFDEMPERLRRFCLLSEKQKARLEWDRRRAERANYSDGHW  500

Query  256  KVKIKDPRLQICFEDFCFWESML  188
            K++IKD RL+ C EDFC  E++L
Sbjct  501  KIQIKDKRLKTCAEDFCLSENVL  523



>ref|XP_001756144.1| predicted protein [Physcomitrella patens]
 gb|EDQ79010.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+++  ++ASD AH TW+KIHD+MPENL + C LR+  KAA E +RREAE G+Y+DGHW
Sbjct  458  WNLKEQQKYASDSAHATWFKIHDSMPENLQRQCWLRTLAKAAREVERREAEAGSYSDGHW  517

Query  256  KVKIKDPRLQIC-FEDFCFWESMLWHWGE  173
            K+KI+DPRL++C   + C WE M+ HW E
Sbjct  518  KIKIRDPRLELCPTPEHCDWEEMIRHWNE  546



>ref|XP_009396821.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=618

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN      FASD AH TWW++HD+MPE L ++CLL +  KA LE++R +AEK N+ D HW
Sbjct  521  WNSVLYRSFASDEAHATWWRVHDSMPEGLQRFCLLSTVTKAGLEYNRHKAEKANFPDQHW  580

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGETNWTDNSTST  143
            +  + DPR  +CFE FC WE +L HW  ++ +  + ST
Sbjct  581  RRNVTDPRRHLCFEKFCRWEDVLQHWNGSHTSSTARST  618



>ref|XP_009414600.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN      FASD AH TWW++HD+MPENL   CLL +  KA LE++RR+AE  N+ D HW
Sbjct  527  WNSILYRSFASDEAHATWWRVHDSMPENLQNLCLLSTVTKAGLEYNRRKAETANFPDEHW  586

Query  256  KVKIKDPRLQICFEDFCFWESMLWHWGE  173
            K  + DPR  ICFE FC WE +L +WG+
Sbjct  587  KRNVTDPRRHICFERFCRWEDVLQNWGK  614



>ref|XP_002441125.1| hypothetical protein SORBIDRAFT_09g020910 [Sorghum bicolor]
 gb|EES19555.1| hypothetical protein SORBIDRAFT_09g020910 [Sorghum bicolor]
Length=189

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN     EFASD+AH  W K+HD MP  L  YCLLRS QKA+LEW++R+AEK N  DGHW
Sbjct  113  WNNAGRREFASDIAHAWWCKVHDKMPWKLQSYCLLRSWQKASLEWNQRQAEKANSEDGHW  172

Query  256  KVKIKDPRLQICFEDF  209
            +  I D RL+ CFE F
Sbjct  173  RRNITDTRLKTCFEKF  188



>gb|EEE57188.1| hypothetical protein OsJ_07131 [Oryza sativa Japonica Group]
Length=596

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN  +L +FASD AH  WW+ HDAMP  L  +CLL  +QKA L WD  EA   N++DGHW
Sbjct  486  WNSPQLRQFASDEAHARWWRAHDAMPAALQGFCLLDERQKALLRWDAAEARAANFSDGHW  545

Query  256  KVKIKDPRLQIC  221
            +V I DPR  IC
Sbjct  546  RVPIADPRRNIC  557



>gb|EMS63875.1| Glycogenin-2 [Triticum urartu]
Length=533

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN  +L +FASD AH  WW  HDAMP  L  +CLL  +QKA L WD  EA K N++DGHW
Sbjct  426  WNAPELRQFASDEAHARWWTAHDAMPPRLQGFCLLDERQKALLRWDVAEARKANFSDGHW  485

Query  256  KVKIKDPRLQIC  221
            + +I DPR  IC
Sbjct  486  RDRIADPRKTIC  497



>dbj|BAJ97980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN  +L +FASD AH  WW  HDAMP  L ++CLL  +QKA L WD  EA K N++DGHW
Sbjct  540  WNAPELRQFASDEAHARWWSAHDAMPPRLQRFCLLDERQKALLRWDVAEARKANFSDGHW  599

Query  256  KVKIKDPRLQIC  221
            + +I DPR  IC
Sbjct  600  RDRIADPRKSIC  611



>ref|XP_002453984.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
 gb|EES06960.1| hypothetical protein SORBIDRAFT_04g022700 [Sorghum bicolor]
Length=644

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L +FASD AH  WWK+HDAMP  L  +CLL  +QKA L WD   A + N++DGHW
Sbjct  538  WNVPALRQFASDEAHARWWKVHDAMPPRLQGFCLLDERQKALLRWDVARAREANFSDGHW  597

Query  256  KVKIKDPRLQIC  221
              +I DPR  IC
Sbjct  598  SARIADPRRSIC  609



>gb|EEC73397.1| hypothetical protein OsI_07648 [Oryza sativa Indica Group]
Length=577

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN  +L +FASD AH  WW+ HDAMP  L  +CLL  +QKA L WD  EA   N++DGHW
Sbjct  467  WNSPQLRQFASDEAHARWWRAHDAMPAALQGFCLLDERQKALLRWDAAEARAANFSDGHW  526

Query  256  KVKIKDPRLQIC  221
            +V I DPR  IC
Sbjct  527  RVPIADPRRNIC  538



>ref|XP_004952800.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1-like [Setaria italica]
Length=642

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L +FASD AH  WWK+HDA+P  L  +CLL  +QKA L WD   A + N +DGHW
Sbjct  538  WNVPALRQFASDEAHARWWKVHDALPPPLQGFCLLDERQKALLRWDVARAREANASDGHW  597

Query  256  KVKIKDPRLQICFED  212
             V+I DPR  +C  D
Sbjct  598  AVRIADPRRSVCAGD  612



>ref|NP_001047126.2| Os02g0556000 [Oryza sativa Japonica Group]
 dbj|BAD15458.1| lycogenin glucosyltransferase (glycogenin)-like protein [Oryza 
sativa Japonica Group]
 dbj|BAF09040.2| Os02g0556000 [Oryza sativa Japonica Group]
Length=654

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN  +L +FASD AH  WW+ HDAMP  L  +CLL  +QKA L WD  EA   N++DGHW
Sbjct  544  WNSPQLRQFASDEAHARWWRAHDAMPAALQGFCLLDERQKALLRWDAAEARAANFSDGHW  603

Query  256  KVKIKDPRLQIC  221
            +V I DPR  IC
Sbjct  604  RVPIADPRRNIC  615



>ref|XP_006828387.1| hypothetical protein AMTR_s00060p00013040 [Amborella trichopoda]
 gb|ERM95803.1| hypothetical protein AMTR_s00060p00013040 [Amborella trichopoda]
Length=601

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE  H +AS+VAHR WW++HDAM E L  +C+L  ++K  LEWDR +A K  ++DGHW
Sbjct  531  WNVEDQHVYASNVAHRRWWRVHDAMEEGLQGFCVLTDQRKIDLEWDRMQAGKAGFSDGHW  590

Query  256  KVKIKDPRLQI  224
            ++KI DPR  +
Sbjct  591  RLKITDPRRHV  601



>ref|NP_001131921.1| uncharacterized protein LOC100193311 [Zea mays]
 gb|ACF80546.1| unknown [Zea mays]
Length=136

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = -3

Query  304  WDRREAEKGNYTDGHWKVKIKDPRLQICFEDFCFWESMLWHWGET-NWTDNSTSTPTPPM  128
            W+  EAEK N+TDGHWK  I DPRL+ CFE FCFWESMLWHWGE  N +  S++ P  P 
Sbjct  70   WEGDEAEKANFTDGHWKRNITDPRLKTCFEKFCFWESMLWHWGENKNNSTQSSAVPATPA  129

Query  127  VKTVSLS  107
              ++S S
Sbjct  130  ATSLSSS  136



>ref|XP_003575141.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 
3 [Brachypodium distachyon]
Length=660

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAM-PENLHKYCLLRSKQKAALEWDRREAEKGNYTDGH  260
            WN  +L +FASD AH  WW+ HDAM P +L ++CLL  +QKA L WD  EA K N++DGH
Sbjct  553  WNAAELRQFASDEAHARWWEAHDAMRPTSLRRFCLLDERQKALLRWDAMEARKANFSDGH  612

Query  259  WKVKIKDPRLQICFED  212
            W+ +I DPR +IC +D
Sbjct  613  WRERIVDPRRRICADD  628



>emb|CDP01355.1| unnamed protein product [Coffea canephora]
Length=582

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            W++E LH +ASDVAHR WWK+HDAM E L K+C LR ++K  LEWDR+ A +    DGHW
Sbjct  511  WDLEDLHVYASDVAHRRWWKLHDAMDEGLQKFCTLRKRRKIDLEWDRKLAREKGLKDGHW  570

Query  256  KVKIKDPR  233
            +V + DPR
Sbjct  571  RVNVTDPR  578



>ref|XP_002960604.1| hypothetical protein SELMODRAFT_73856, partial [Selaginella moellendorffii]
 gb|EFJ38143.1| hypothetical protein SELMODRAFT_73856, partial [Selaginella moellendorffii]
Length=501

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN ++LH FASD  H  WWKIHD MP  L K+C+L+  QK  LEWD  +A++  Y DGHW
Sbjct  416  WNQDQLHIFASDPVHAMWWKIHDTMPAELQKFCVLQGTQKFLLEWDIIKAKRKRYPDGHW  475

Query  256  KVKIKDPR  233
            K+KI+DPR
Sbjct  476  KIKIEDPR  483



>ref|XP_002969246.1| hypothetical protein SELMODRAFT_91619, partial [Selaginella moellendorffii]
 gb|EFJ29334.1| hypothetical protein SELMODRAFT_91619, partial [Selaginella moellendorffii]
Length=501

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN ++LH FASD  H  WWKIHD MP  L K+C+L+  QK  LEWD  +A++  Y DGHW
Sbjct  416  WNQDQLHIFASDPVHAMWWKIHDTMPAELQKFCVLQGTQKFLLEWDIIKAKRKRYPDGHW  475

Query  256  KVKIKDPR  233
            K+KI+DPR
Sbjct  476  KIKIEDPR  483



>ref|XP_008645791.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
1 [Zea mays]
 gb|AFW71791.1| hypothetical protein ZEAMMB73_625729 [Zea mays]
Length=584

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNV  L +FASD AH  WWK+HDAMP  L  +CLL  +QKA L WD   A + N++D HW
Sbjct  479  WNVPALRQFASDEAHARWWKVHDAMPRRLQGFCLLDERQKALLWWDVARAREANFSDAHW  538

Query  256  KVKIKDPRLQIC  221
             V+I DPR  IC
Sbjct  539  SVRIADPRRSIC  550



>ref|XP_001783069.1| predicted protein [Physcomitrella patens]
 gb|EDQ52138.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = -3

Query  412  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR  233
            FASD AH  W+K++D +PENL K+C L +  KA LE +RR AE     D HW + I DPR
Sbjct  453  FASDEAHARWFKVYDELPENLQKFCSLSTGTKAYLEHNRRVAEAAALEDKHWAITITDPR  512

Query  232  LQICFEDFCFWESMLWHWGETNWTDNST  149
            L +C E+ C W ++L +W +T  + +S 
Sbjct  513  LNVCLENHCDWNALLSYWDKTVNSSSSV  540



>gb|ABK25357.1| unknown [Picea sitchensis]
Length=611

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WNVE    +AS+VAH  WWKIHD MP  LHK+CL+ + QK  LEWDR +A+   + D HW
Sbjct  541  WNVENQRAYASNVAHARWWKIHDNMPRQLHKFCLVPTVQKEILEWDRMQAQISGFPDQHW  600

Query  256  KVKIKDPRLQI  224
            K+ I DPRL +
Sbjct  601  KLNITDPRLHL  611



>ref|XP_001777541.1| predicted protein [Physcomitrella patens]
 gb|EDQ57584.1| predicted protein [Physcomitrella patens]
Length=535

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = -3

Query  412  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR  233
            FASD AH  W+K++D +PENL K+C L +  KA LE +RR AE     D HW + IKDPR
Sbjct  443  FASDEAHARWFKVYDELPENLQKHCALSTGTKAYLEHNRRTAEAAALEDKHWAITIKDPR  502

Query  232  LQICFEDFCFWESMLWHWGETNWTDNSTSTPT  137
            L +C E  C W+++L  W +T  T ++    T
Sbjct  503  LNVCQEGHCDWKALLSIWDKTVNTTSAVVVST  534



>ref|XP_010274299.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like [Nelumbo nucifera]
Length=583

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN+   H +ASDVAH  WWK+HDAM E+L ++C L   +K  L+WDR+ AEK    DGHW
Sbjct  506  WNIGDQHVYASDVAHARWWKVHDAMDESLQRFCRLTPHRKIELDWDRKMAEKMGLPDGHW  565

Query  256  KVKIKDPR  233
            ++ I DPR
Sbjct  566  RINISDPR  573



>gb|KJB63829.1| hypothetical protein B456_010G019500 [Gossypium raimondii]
Length=512

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN E  H FASDVAHR WWK HDAM E L K+C L  K+KA L+ DR++A++    D HW
Sbjct  439  WNREDHHIFASDVAHRRWWKFHDAMDEKLQKFCGLTKKRKAQLDADRKKAKEIGLKDKHW  498

Query  256  KVKIKDPR  233
            K+ IKDPR
Sbjct  499  KINIKDPR  506



>gb|KJB63830.1| hypothetical protein B456_010G019500 [Gossypium raimondii]
Length=583

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            WN E  H FASDVAHR WWK HDAM E L K+C L  K+KA L+ DR++A++    D HW
Sbjct  510  WNREDHHIFASDVAHRRWWKFHDAMDEKLQKFCGLTKKRKAQLDADRKKAKEIGLKDKHW  569

Query  256  KVKIKDPR  233
            K+ IKDPR
Sbjct  570  KINIKDPR  577



>ref|XP_006354951.1| PREDICTED: UDP-glucuronate:xylan alpha-glucuronosyltransferase 
2-like [Solanum tuberosum]
Length=583

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -3

Query  436  WNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHW  257
            W+V  LH +ASD+AHRTWWKIHD M ENL K+C L  ++K  L + R+EAE+    D HW
Sbjct  513  WDVGYLHVYASDIAHRTWWKIHDTMDENLQKFCGLSKQRKIELYFSRKEAEEMGLKDEHW  572

Query  256  KVKIKDPR  233
            ++ + DPR
Sbjct  573  RINVTDPR  580



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840