BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF006J05

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                286   7e-93   Erythranthe guttata [common monkey flower]
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    288   7e-93   Elaeis guineensis
gb|KJB54391.1|  hypothetical protein B456_009G074800                    281   8e-93   Gossypium raimondii
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     288   9e-93   Sesamum indicum [beniseed]
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    287   2e-92   Oryza brachyantha
ref|NP_001265946.1|  Hop-interacting protein THI032                     285   1e-91   Solanum lycopersicum
gb|AAL47679.1|  aminotransferase 1                                      285   1e-91   Cucumis melo [Oriental melon]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       285   1e-91   Gossypium arboreum [tree cotton]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    281   1e-91   Gossypium raimondii
gb|AEA48973.1|  glyoxylate aminotransferase                             276   2e-91   Rosa roxburghii [chestnut rose]
gb|KJB83533.1|  hypothetical protein B456_013G252200                    283   2e-91   Gossypium raimondii
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                285   2e-91   Cucumis melo [Oriental melon]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    285   2e-91   Cucumis sativus [cucumbers]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    284   2e-91   Sesamum indicum [beniseed]
gb|AFK37194.1|  unknown                                                 279   2e-91   Medicago truncatula
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             284   2e-91   Fritillaria agrestis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     284   3e-91   Nicotiana sylvestris
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     284   3e-91   Nicotiana tomentosiformis
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    283   6e-91   Solanum tuberosum [potatoes]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     282   1e-90   Gossypium hirsutum [American cotton]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             282   1e-90   Prunus persica
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     282   1e-90   Elaeis guineensis
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     282   1e-90   Prunus mume [ume]
gb|AAQ56192.1|  aminotransferase 1                                      282   2e-90   Cucumis melo [Oriental melon]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    281   2e-90   Gossypium raimondii
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     281   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     281   3e-90   Malus domestica [apple tree]
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             276   3e-90   
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    281   3e-90   
ref|NP_001237048.1|  enzymatic resistance protein                       281   4e-90   
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          281   5e-90   Amborella trichopoda
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     281   5e-90   Fragaria vesca subsp. vesca
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     281   5e-90   Glycine soja [wild soybean]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     281   6e-90   Phoenix dactylifera
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    280   6e-90   Glycine max [soybeans]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     280   6e-90   Eucalyptus grandis [rose gum]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    280   7e-90   Glycine max [soybeans]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      280   7e-90   
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    280   8e-90   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                280   1e-89   Medicago truncatula
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     280   1e-89   Nelumbo nucifera [Indian lotus]
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             276   1e-89   
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     279   2e-89   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         279   2e-89   Ricinus communis
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     279   2e-89   Tarenaya hassleriana [spider flower]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           279   2e-89   Glycine max [soybeans]
emb|CBI24214.3|  unnamed protein product                                278   2e-89   Vitis vinifera
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     278   3e-89   Peperomia schizandra
gb|AFK40703.1|  unknown                                                 278   3e-89   Medicago truncatula
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     278   5e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       278   6e-89   Gossypium arboreum [tree cotton]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         278   7e-89   Jatropha curcas
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     278   7e-89   
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     278   7e-89   Vitis vinifera
emb|CAN84001.1|  hypothetical protein VITISV_007680                     278   8e-89   Vitis vinifera
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              269   1e-88   
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    277   1e-88   Glycine max [soybeans]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    272   1e-88   
dbj|BAJ90006.1|  predicted protein                                      277   1e-88   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABQ81924.1|  aminotransferase 2                                      277   1e-88   Cucumis sativus [cucumbers]
gb|AAQ56193.1|  aminotransferase 2                                      277   2e-88   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      277   2e-88   Cucumis sativus [cucumbers]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      276   2e-88   Genlisea aurea
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    276   2e-88   Cucumis melo [Oriental melon]
ref|NP_001062170.1|  Os08g0502700                                       276   2e-88   
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           276   2e-88   Cucumis melo [Oriental melon]
gb|ACN39798.1|  unknown                                                 276   3e-88   Picea sitchensis
gb|ABK24112.1|  unknown                                                 276   3e-88   Picea sitchensis
gb|AAL62332.1|AF461048_1  aminotransferase 2                            276   3e-88   Cucumis melo [Oriental melon]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     276   4e-88   Triticum urartu
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     275   4e-88   Peperomia bracteata
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             276   5e-88   Populus trichocarpa [western balsam poplar]
gb|ABQ81925.1|  aminotransferase 2                                      275   5e-88   Cucumis melo [Oriental melon]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             275   6e-88   Phaseolus vulgaris [French bean]
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     274   7e-88   Peperomia cerrateae
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    275   7e-88   Setaria italica
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     274   7e-88   Peperomia cerrateae
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  275   8e-88   Citrus sinensis [apfelsine]
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     274   8e-88   Peperomia cerrateae
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    275   8e-88   Citrus sinensis [apfelsine]
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    275   1e-87   Phaseolus vulgaris [French bean]
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          275   1e-87   Sorghum bicolor [broomcorn]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    275   2e-87   
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     272   2e-87   Peperomia cavispicata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     274   2e-87   Populus euphratica
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     273   2e-87   Peperomia bracteata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     273   2e-87   Peperomia bracteata
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     272   2e-87   Peperomia radiatinervosa
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     272   2e-87   Peperomia radiatinervosa
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     273   2e-87   Peperomia bracteata
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     273   3e-87   Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     272   3e-87   Peperomia bracteata
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     272   3e-87   Peperomia parvisagittata
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    273   3e-87   Cucumis sativus [cucumbers]
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     272   3e-87   Peperomia ayacuchoana
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     272   4e-87   Peperomia radiatinervosa
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             273   5e-87   Citrus clementina [clementine]
gb|ACN36238.1|  unknown                                                 270   6e-87   Zea mays [maize]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    273   8e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     271   9e-87   Peperomia parvisagittata
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     271   1e-86   Peperomia parvifolia
emb|CDP08481.1|  unnamed protein product                                272   1e-86   Coffea canephora [robusta coffee]
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     270   2e-86   Peperomia pseudoverruculosa
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     270   2e-86   Peperomia andina
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             271   3e-86   
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     270   3e-86   Peperomia questionis
ref|NP_001148339.1|  LOC100281949                                       271   4e-86   Zea mays [maize]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     271   4e-86   Brassica rapa
emb|CDX81443.1|  BnaC09g08540D                                          271   4e-86   
dbj|BAJ33858.1|  unnamed protein product                                271   5e-86   Eutrema halophilum
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     269   5e-86   Peperomia verruculosa
emb|CDY37208.1|  BnaA09g08290D                                          270   5e-86   Brassica napus [oilseed rape]
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     269   5e-86   Peperomia verruculosa
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      270   6e-86   Spirodela polyrhiza
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     268   1e-85   Peperomia bracteata
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     271   1e-85   Brachypodium distachyon [annual false brome]
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     268   2e-85   Peperomia peruviana
ref|XP_002313371.1|  aminotransferase 2 family protein                  269   2e-85   
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     267   2e-85   Peperomia rupiseda
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    268   4e-85   Brassica rapa
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     266   6e-85   Peperomia chutanka
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     266   7e-85   Peperomia sp. JN-2011
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    267   9e-85   Populus euphratica
emb|CDX89604.1|  BnaC03g45180D                                          266   2e-84   
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     265   2e-84   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     265   2e-84   Peperomia aff. gracillima JN-2011
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     265   3e-84   Peperomia putlaensis
gb|ABK96624.1|  unknown                                                 266   3e-84   Populus trichocarpa x Populus deltoides
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      257   4e-84   Oryza sativa Indica Group [Indian rice]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    266   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    265   6e-84   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  264   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     262   2e-83   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     262   3e-83   Peperomia pugnicaudex
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             263   6e-83   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     261   7e-83   Peperomia polycephala
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     260   1e-82   Peperomia peruviana
gb|ABF70331.1|  aminotransferase 1                                      260   4e-82   Cucumis sativus [cucumbers]
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             259   1e-81   Capsella rubella
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     254   7e-81   
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    255   4e-80   Cicer arietinum [garbanzo]
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    254   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                252   9e-79   Medicago truncatula
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     248   5e-78   Peperomia putlaensis
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     248   6e-78   Peperomia cyclaminoides
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     246   2e-77   Peperomia cyclaminoides
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     246   3e-77   Peperomia cyclaminoides
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     246   3e-77   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     246   4e-77   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     245   5e-77   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     244   1e-76   Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     244   2e-76   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     243   2e-76   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     244   3e-76   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     243   5e-76   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     241   3e-75   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     239   2e-74   Peperomia sp. JN-2011
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     237   9e-74   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     237   9e-74   Peperomia exclamationis
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                236   2e-73   
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             237   4e-73   Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             236   1e-72   
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             231   9e-71   Selaginella moellendorffii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             230   3e-70   Selaginella moellendorffii
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    220   5e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     226   9e-70   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     226   1e-69   Peperomia aff. pinoi JN-2011
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     222   5e-68   Peperomia jalcaensis
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     222   5e-68   Peperomia parvisagittata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     222   5e-68   Peperomia elatior
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     220   3e-67   Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     219   7e-67   Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     219   1e-66   Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     218   1e-66   Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     216   5e-66   Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     216   7e-66   Peperomia cerrateae
ref|XP_001755667.1|  predicted protein                                  218   1e-65   
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     215   2e-65   Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     214   4e-65   Peperomia wernerrauhii
ref|XP_001783551.1|  predicted protein                                  214   3e-64   
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     201   2e-60   Peperomia sp. JN-2011
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                203   9e-60   
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                201   2e-59   Morus notabilis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     197   1e-58   Peperomia aff. ovatopeltata JN-2011
gb|ABR16109.1|  unknown                                                 196   8e-58   Picea sitchensis
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             196   2e-57   
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                194   3e-57   
ref|XP_001763095.1|  predicted protein                                  196   4e-57   
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              191   6e-57   
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  191   2e-55   Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              189   8e-55   
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                175   4e-49   Hyphomicrobium nitrativorans
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      175   4e-49   Hyphomicrobium nitrativorans NL23
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    173   1e-48   Methylocystaceae
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                173   1e-48   Methylosinus
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                173   1e-48   Methylosinus sp. LW4
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     172   4e-48   Methyloceanibacter caenitepidi
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                171   8e-48   
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     171   1e-47   Methylorubrum extorquens DM4
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylorubrum extorquens
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacteriaceae
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacteriaceae
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                171   2e-47   Methylobacterium sp. MB200
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                170   3e-47   Methylosinus
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                170   3e-47   Methylorubrum populi
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                167   3e-46   Methylobacterium
ref|XP_005709273.1|  serine--glyoxylate transaminase                    167   3e-46   Galdieria sulphuraria
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    167   4e-46   Hyphomicrobium methylovorum
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                167   4e-46   Methylocella silvestris
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                166   6e-46   Methylobacterium sp. B34
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                166   7e-46   Methylobacterium
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                166   7e-46   Methylocaldum szegediense
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    166   7e-46   Methylobacterium aquaticum
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    166   8e-46   Methylobacterium
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 166   9e-46   Auxenochlorella protothecoides
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylocystis parvus
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylobacterium sp. 88A
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                166   1e-45   Methylobacterium
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                166   1e-45   Hyphomicrobium denitrificans
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                166   1e-45   Hyphomicrobium denitrificans
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                165   2e-45   Methylobacterium
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                165   2e-45   Methylocystis sp. ATCC 49242
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    165   2e-45   Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           165   3e-45   Methylobacterium mesophilicum
gb|AIQ91949.1|  Aminotransferase class V                                165   4e-45   Methylobacterium oryzae CBMB20
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                164   5e-45   Methylobacterium sp. 77
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                164   6e-45   Hyphomicrobium zavarzinii
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                163   2e-44   Methylocapsa aurea
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                162   2e-44   Hoeflea sp. 108
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                162   4e-44   Methylocapsa acidiphila
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     154   1e-43   Phaseolus vulgaris [French bean]
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                160   1e-43   Granulibacter bethesdensis
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                160   1e-43   Granulibacter bethesdensis
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                160   2e-43   Methylocystis sp. SC2
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   2e-43   Hyphomicrobium
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     160   3e-43   Granulibacter bethesdensis
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                159   3e-43   Methylocystis rosea
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        160   3e-43   Granulibacter bethesdensis CGDNIH4
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                159   3e-43   Methylocystis sp. SB2
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                159   5e-43   Ferrovum
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                158   6e-43   Granulibacter bethesdensis
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                158   7e-43   Methylococcus capsulatus
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                158   8e-43   Methylopila sp. M107
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     151   9e-43   Phaseolus vulgaris [French bean]
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        159   1e-42   Granulibacter bethesdensis
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                158   1e-42   Paraburkholderia sacchari
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                158   1e-42   Paraburkholderia terrae
gb|AID30749.1|  serine--glyoxylate aminotransferase                     154   1e-42   Mesorhizobium huakuii 7653R
gb|AGN53915.1|  glyoxylate aminotransferase                             150   2e-42   Silene latifolia
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                157   2e-42   Paraburkholderia phymatum
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    157   2e-42   Methylobacter
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                157   3e-42   Paraburkholderia hospita
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                157   3e-42   Mesorhizobium sp. ORS 3359
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                157   3e-42   Burkholderiaceae
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                157   3e-42   Methylobacterium nodulans
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                157   3e-42   Paraburkholderia caribensis
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                156   3e-42   Methyloversatilis universalis
ref|WP_020188076.1|  hypothetical protein                               156   5e-42   Methylopila sp. 73B
gb|AGN53895.1|  glyoxylate aminotransferase                             149   6e-42   Silene latifolia
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                156   7e-42   Caballeronia glathei
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                155   7e-42   Methylomonas methanica
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                155   7e-42   Mesorhizobium sp. ORS 3324
gb|AGN53914.1|  glyoxylate aminotransferase                             149   8e-42   Silene latifolia
gb|AGN53916.1|  glyoxylate aminotransferase                             148   1e-41   Silene latifolia
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                155   1e-41   Methylobacter sp. BBA5.1
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                154   2e-41   Methylovulum miyakonense
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                155   2e-41   Lutibaculum baratangense
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                154   2e-41   Methyloversatilis discipulorum
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                155   2e-41   Burkholderia sp. UYPR1.413
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                155   2e-41   Methylobacterium sp. 4-46
gb|AGN53921.1|  glyoxylate aminotransferase                             147   2e-41   Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             147   2e-41   Silene latifolia
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                154   2e-41   Methylohalobius crimeensis
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              155   2e-41   Volvox carteri f. nagariensis
gb|AGN53897.1|  glyoxylate aminotransferase                             147   2e-41   Silene latifolia
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                154   2e-41   Methyloversatilis discipulorum
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                155   2e-41   Methylobacterium sp. WSM2598
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                154   2e-41   Methyloversatilis universalis
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                154   3e-41   Gemmatimonas phototrophica
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                154   3e-41   
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                154   4e-41   
gb|KIZ03753.1|  serine--glyoxylate transaminase                         154   4e-41   
gb|AGN54050.1|  glyoxylate aminotransferase                             147   4e-41   
ref|WP_020592928.1|  hypothetical protein                               153   4e-41   
gb|AGN53906.1|  glyoxylate aminotransferase                             147   5e-41   
gb|AGN53917.1|  glyoxylate aminotransferase                             147   5e-41   
gb|AGN53900.1|  glyoxylate aminotransferase                             147   5e-41   
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                153   6e-41   
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                153   6e-41   
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                153   6e-41   
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                153   7e-41   
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                153   8e-41   
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                153   9e-41   
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                152   1e-40   
gb|AGN54049.1|  glyoxylate aminotransferase                             145   1e-40   
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                152   1e-40   
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                149   2e-40   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                149   2e-40   
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                149   2e-40   
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                149   2e-40   
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                149   2e-40   
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                152   2e-40   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                151   3e-40   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                151   3e-40   
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                151   3e-40   
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                151   3e-40   
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                151   3e-40   
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    151   4e-40   
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    151   4e-40   
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                151   4e-40   
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                151   4e-40   
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                151   4e-40   
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                151   5e-40   
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    151   5e-40   
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                150   5e-40   
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                150   5e-40   
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      151   6e-40   
ref|WP_020058450.1|  hypothetical protein                               150   6e-40   
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                150   8e-40   
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                150   8e-40   
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                150   8e-40   
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                150   9e-40   
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                150   9e-40   
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                150   9e-40   
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   1e-39   
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   2e-39   
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   2e-39   
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   2e-39   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                149   2e-39   
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                149   3e-39   
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   3e-39   
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   3e-39   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                149   3e-39   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   3e-39   
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                149   3e-39   
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                149   3e-39   
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                148   4e-39   
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                148   4e-39   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   5e-39   
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                148   5e-39   
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                148   6e-39   
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                147   7e-39   
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                147   8e-39   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    147   8e-39   
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                147   9e-39   
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                147   9e-39   
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                147   9e-39   
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                147   9e-39   
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                147   1e-38   
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                146   2e-38   
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                146   3e-38   
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 147   3e-38   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                146   3e-38   
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                146   3e-38   
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                145   3e-38   
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                145   4e-38   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                145   4e-38   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                145   4e-38   
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                145   5e-38   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                145   5e-38   
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                145   6e-38   
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             146   6e-38   
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                144   1e-37   
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                144   1e-37   
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                144   1e-37   
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                144   1e-37   
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                144   2e-37   
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                144   2e-37   
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                143   3e-37   
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    143   3e-37   
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                142   5e-37   
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                142   6e-37   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                142   7e-37   
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                142   8e-37   
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                142   8e-37   
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                142   9e-37   
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                142   1e-36   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                141   1e-36   
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                141   2e-36   
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                140   2e-36   
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                140   3e-36   
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                140   4e-36   
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                140   5e-36   
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                140   5e-36   
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                140   6e-36   
ref|WP_023263325.1|  serine--glyoxylate aminotransferase                140   7e-36   
ref|WP_029167381.1|  hypothetical protein                               134   8e-36   
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                139   9e-36   
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    140   9e-36   
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                139   9e-36   
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    139   1e-35   
gb|EBA13502.1|  Serine--glyoxylate transaminase                         139   1e-35   
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_028818976.1|  serine--glyoxylate aminotransferase                139   1e-35   
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                139   2e-35   
ref|WP_007205927.1|  serine--glyoxylate aminotransferase                139   2e-35   
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                139   2e-35   
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            138   2e-35   
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                138   2e-35   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase                138   3e-35   
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                138   3e-35   
ref|WP_005670252.1|  serine-glyoxylate aminotransferase                 132   3e-35   
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                137   4e-35   
gb|ABZ06639.1|  putative aminotransferase class-V                       137   4e-35   
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    137   4e-35   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                137   4e-35   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 138   4e-35   
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                137   4e-35   
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                137   4e-35   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase                137   4e-35   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase                137   5e-35   
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                137   6e-35   
gb|EEE42985.1|  aminotransferase, class V superfamily                   137   6e-35   
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 137   6e-35   
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 137   7e-35   
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                137   7e-35   
ref|WP_019956443.1|  serine--glyoxylate aminotransferase                137   8e-35   
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                137   9e-35   
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                136   9e-35   
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                136   9e-35   
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                136   9e-35   
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_043355494.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase                136   1e-34   
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA           136   2e-34   
ref|WP_040605265.1|  serine--glyoxylate aminotransferase                136   2e-34   
gb|EBA05577.1|  probable serine-glyoxylate aminotransferase             136   2e-34   
ref|WP_013695939.1|  serine--glyoxylate aminotransferase                135   2e-34   
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                135   2e-34   
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                135   2e-34   
ref|WP_017235233.1|  serine--glyoxylate aminotransferase                135   2e-34   
emb|CEG09072.1|  Soluble hydrogenase 42 kDa subunit                     135   2e-34   
ref|WP_044541799.1|  serine--glyoxylate aminotransferase                135   2e-34   
emb|CEG08573.1|  Soluble hydrogenase 42 kDa subunit                     135   2e-34   
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    135   2e-34   
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_010548951.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_044591882.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_020096326.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_042299583.1|  serine--glyoxylate aminotransferase                135   3e-34   
ref|WP_010686651.1|  serine--glyoxylate transaminase                    135   4e-34   
ref|WP_002716390.1|  hypothetical protein                               135   4e-34   
ref|WP_042459424.1|  serine--glyoxylate aminotransferase                135   4e-34   
ref|WP_025610703.1|  hypothetical protein                               130   4e-34   
ref|WP_042251598.1|  serine--glyoxylate aminotransferase                135   4e-34   
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     134   5e-34   
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                134   5e-34   
ref|WP_016841706.1|  hypothetical protein                               133   6e-34   
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                134   6e-34   
ref|WP_011241925.1|  serine--glyoxylate aminotransferase                134   7e-34   
gb|KIX16576.1|  serine--glyoxylate aminotransferase                     134   7e-34   
ref|WP_027528516.1|  serine--glyoxylate aminotransferase                134   8e-34   
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                134   8e-34   
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                134   8e-34   



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   286 bits (733),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTRL  ATRLAV AWGLKNCTQKE
Sbjct  200  KLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKNCTQKE  259

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  260  EWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  319

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSRI
Sbjct  320  CLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSRI  359



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   288 bits (737),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  362  CLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSRI  401



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   281 bits (720),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKE
Sbjct  56   KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKE  115

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  116  EWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLG  175

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  176  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  215



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   288 bits (736),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKNCTQKE
Sbjct  243  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNCTQKE  302

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  303  EWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  362

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  362  CLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKE
Sbjct  147  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKE  206

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  207  EWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLG  266

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  267  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  306



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   276 bits (707),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNCTQKE
Sbjct  9    KLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGLKNCTQKE  68

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  69   EWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  128

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  129  CLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  183  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKE  242

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  243  EWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  302

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  303  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/159 (92%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSRI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+E
Sbjct  79   KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEE  138

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  139  EWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  198

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  199  ALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  362  CLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   283 bits (724),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSRI
Sbjct  362  CLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  362  CLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK+
Sbjct  243  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKD  302

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  303  EWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  362

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  363  CLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSRI  402



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  362  CLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   276 bits (705),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  85   KLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  144

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  145  EWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  204

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  205  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  244



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSRI
Sbjct  362  CLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SRI
Sbjct  362  CLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR+
Sbjct  362  CLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSRV  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  362  CLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSRI  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            +MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKNCTQKE
Sbjct  242  QMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SRI
Sbjct  362  CLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASRI  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   280 bits (717),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+E
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  362  ALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  152  KLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  211

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  212  EWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  271

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  272  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  311



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  302  EWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  362  ALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL NCTQKE
Sbjct  242  KMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSRI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSRI
Sbjct  362  CLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  362  CLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  215  KLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQRE  274

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLG
Sbjct  275  EWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLG  334

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  335  CLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  374



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   278 bits (710),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+E
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSRI
Sbjct  362  ALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   278 bits (711),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  362  CLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   278 bits (711),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   278 bits (710),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSRI
Sbjct  362  CLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   278 bits (710),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  362  CLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   278 bits (710),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLG
Sbjct  302  EWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSRI  401



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
             MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKE
Sbjct  103  DMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKE  162

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  163  EWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  222

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  223  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  262



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT+KE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  ENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  362  CLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQ E
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQSE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SRI
Sbjct  362  CLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  243  KMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKE  302

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G
Sbjct  303  EWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMG  362

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  ALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  362  CLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  362  CLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT KE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  ENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  362  CLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   275 bits (702),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASRI  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCTQKE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLG
Sbjct  302  EWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  362  CLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  243  KIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKE  302

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  303  EWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  362

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   274 bits (700),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   274 bits (700),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   275 bits (703),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KE
Sbjct  242  QLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLG
Sbjct  302  EWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSRI
Sbjct  362  CLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            +MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKNC QKE
Sbjct  243  EMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNCCQKE  302

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  303  ECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  362

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  363  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKE
Sbjct  278  KIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKE  337

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  338  EWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  397

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  398  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  187  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  246

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  247  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  306

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  307  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SRI
Sbjct  362  CLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  195  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  254

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  255  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  314

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  315  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  198  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  257

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  258  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  317

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  318  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSRI  401



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  196  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  255

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  256  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  315

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  316  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGC
Sbjct  303  WFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSRI
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
             MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKE
Sbjct  169  DMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKE  228

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  229  EWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  288

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  289  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+LQLLG
Sbjct  302  EWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDLQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  362  CLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSRI  401



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQ+E
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQEE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSRI
Sbjct  362  CLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSRI  401



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
             MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKE
Sbjct  244  DMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKE  303

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  304  EWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  363

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  364  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  403



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  279  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  338

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  339  EWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  398

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  399  CLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   269 bits (687),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  196  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  255

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  256  ECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  315

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  316  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   270 bits (691),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  302  EWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   270 bits (691),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKNCTQKE
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  302  EWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSRI
Sbjct  362  CLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+A GLKNCTQKE
Sbjct  196  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKNCTQKE  255

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  256  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  315

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  316  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKNCTQKE
Sbjct  302  KMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKNCTQKE  361

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG
Sbjct  362  ENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  421

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSRI
Sbjct  422  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSRI  461



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   269 bits (687),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   266 bits (680),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  302  EWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   265 bits (676),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  303  WFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR+
Sbjct  363  LAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASRV  401



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   257 bits (656),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  530  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  351
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  350  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  171
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  170  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   262 bits (670),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  96
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSRI
Sbjct  362  CLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   261 bits (666),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  105
            CL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            CL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNCTQKEE
Sbjct  236  LGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNCTQKEE  295

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  296  WFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  355

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQN  102
            LAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  356  LAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SRI
Sbjct  362  CLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSRI  401



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   254 bits (648),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT KE
Sbjct  131  KMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKE  190

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLG
Sbjct  191  ENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLG  250

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            CL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  251  CLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  290



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKNC Q +E
Sbjct  243  LGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNCCQNKE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
             +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLLGC
Sbjct  303  SYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSRI
Sbjct  363  LAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSRI  401



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLG
Sbjct  302  EWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            CLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  362  CLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC QKEE
Sbjct  243  LGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNCCQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNELQLLGC
Sbjct  303  WYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGC  362

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSRI
Sbjct  363  LAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVA  126
            CL+GVEMVLKD+GYPVK GSGVA
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAA  120
            CL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  187  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  246

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  247  ECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  306

Query  194  CLAGVEMVLKDIGYPVKLGSGVAA  123
            CL+GVEMVLKD+GYPVK GSGVAA
Sbjct  307  CLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  195  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  254

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  255  ECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  314

Query  194  CLAGVEMVLKDIGYPVKLGSGVAA  123
            CL+GVEMVLKD+GYPVK GSGVAA
Sbjct  315  CLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  186  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKE  245

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NELQLLG
Sbjct  246  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNELQLLG  305

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAA  120
            CL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  306  CLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVAA  123
            CL+GVEMVLKD+GYPVK GSGVAA
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  195  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  254

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  255  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  314

Query  194  CLAGVEMVLKDIGYPVKLGSGVAA  123
            CL+GVEMVLKD+GYPVK GSGVAA
Sbjct  315  CLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  187  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  246

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  247  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  306

Query  194  CLAGVEMVLKDIGYPVKLGSG  132
            CL+GVEMVLKD+GYPVK GSG
Sbjct  307  CLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  186  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKE  245

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  246  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  305

Query  194  CLAGVEMVLKDIGYPVKLGSGVA  126
            CL+GVEMVLKD+GYPVK GSGVA
Sbjct  306  CLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  190  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  249

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  250  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  309

Query  194  CLAGVEMVLKDIGYPVKLGSGVA  126
            CL+GVEMVLKD+GYPVK GSGVA
Sbjct  310  CLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   244 bits (622),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLGSGVA  126
            CL+GVEMVLKD+GYPVK GSGVA
Sbjct  327  CLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVKLG  138
            CL+GVEMVLKD+GYPVK G
Sbjct  327  CLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  196  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  255

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  256  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  315

Query  194  CLAGVEMVLKDIGYPVKLG  138
            CL+GVEMVLKD+GYPVK G
Sbjct  316  CLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPVK  144
            CL+GVEMVLKD+GYPVK
Sbjct  327  CLSGVEMVLKDVGYPVK  343



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPV  147
            CL+GVEMVLKD+GYPV
Sbjct  327  CLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVLKDIGYPV  147
            CL+GVEMVLKD+GYPV
Sbjct  327  CLSGVEMVLKDVGYPV  342



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
             +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC Q+E
Sbjct  190  NLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCCQQE  249

Query  374  E-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
            E W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNELQLL
Sbjct  250  EEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNELQLL  309

Query  197  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            GCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  310  GCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ 
Sbjct  242  KLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRP  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG
Sbjct  302  EWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  362  ALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ 
Sbjct  242  KVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRP  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG
Sbjct  302  EWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLG  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR+
Sbjct  362  ALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSRL  401



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  
Sbjct  242  ELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCVKDP  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+ 
Sbjct  302  ELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLIS  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  362  ALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  
Sbjct  242  ELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCIKDP  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+ 
Sbjct  302  ELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLIS  361

Query  194  CLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  362  ALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSRL  401



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   220 bits (560),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -1

Query  446  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  267
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  266  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  86   PSRI  75
            PSRI
Sbjct  121  PSRI  124



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   226 bits (575),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 126/130 (97%), Gaps = 0/130 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  183  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  242

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  243  EWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  302

Query  194  CLAGVEMVLK  165
            CL+GVEMVLK
Sbjct  303  CLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVL  168
            CL+GVEMVL
Sbjct  327  CLSGVEMVL  335



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  195  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  254

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  255  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  314

Query  194  CLAGVEMVL  168
            CL+GVEMVL
Sbjct  315  CLSGVEMVL  323



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVL  168
            CL+GVEMVL
Sbjct  327  CLSGVEMVL  335



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVL  168
            CL+GVEMVL
Sbjct  327  CLSGVEMVL  335



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVEMVL  168
            CL+GVEMVL
Sbjct  327  CLSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGV  180
            CL+GV
Sbjct  327  CLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVE  177
            CL+GVE
Sbjct  327  CLSGVE  332



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGVE  177
            CL+GVE
Sbjct  327  CLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  186  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  245

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  246  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  305

Query  194  CLAGVE  177
            CL+GVE
Sbjct  306  CLSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGV  180
            CL+GV
Sbjct  327  CLSGV  331



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  378
            + GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL  CTQ 
Sbjct  242  EAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTLCTQD  301

Query  377  EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
             +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQ+L
Sbjct  302  PKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNELQML  361

Query  197  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            G LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  362  GALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISSRI  402



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            EWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  EWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAG  183
            CL+G
Sbjct  327  CLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326

Query  194  CLAGV  180
            CL+GV
Sbjct  327  CLSGV  331



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  378
            + GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL  CT+ 
Sbjct  242  EAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTLCTKD  301

Query  377  EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
             +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLL
Sbjct  302  PKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNELQLL  361

Query  197  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            G LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I SRI
Sbjct  362  GALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVSRI  402



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  184  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKE  243

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  201
            E FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQL
Sbjct  244  ECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQL  301



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+E
Sbjct  242  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
            EWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ L+
Sbjct  302  EWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTLI  360



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            EW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  302  EWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH RLG ATRL V+AWGLKNCT KE
Sbjct  207  KMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKNCTPKE  266

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            E FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  267  ECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+E
Sbjct  242  KLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQRE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            EW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  302  EWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            K+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKE
Sbjct  242  KLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKE  301

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
            EWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+  +
Sbjct  302  EWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTFI  360



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 124/159 (78%), Gaps = 19/159 (12%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH       +L V            E
Sbjct  204  LGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-------KLVV------------E  244

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            W+S +VTA+V P  IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNELQLLGC
Sbjct  245  WYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGC  304

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSRI
Sbjct  305  LAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQK  378
            K GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL  C +K
Sbjct  242  KAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARK  301

Query  377  EEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
             +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NELQLL
Sbjct  302  PQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLL  361

Query  197  GCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            G LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR+
Sbjct  362  GALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASRL  402



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   191 bits (484),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
             MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKE
Sbjct  103  DMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKE  162

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            EWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  163  EWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  218



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEE
Sbjct  243  LGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEE  302

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  201
            WFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+  
Sbjct  303  WFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEVMF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  245  MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  304

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            WFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  305  WFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++ +W S
Sbjct  241  FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWHS  300

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + G L  
Sbjct  301  DTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIGGVLFS  360

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  81
            VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  361  VEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++ +W S
Sbjct  244  FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWHS  303

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + G L  
Sbjct  304  DTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIGGVLFS  363

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  81
            VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  364  VEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASA  114
             EM + D+G PV  GSGVAAA A
Sbjct  365  AEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASA  114
             EM + D+G PV  GSGVAAA A
Sbjct  365  AEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASA  114
             EM + D+G PV  GSGVAAA A
Sbjct  365  AEMAMLDVGIPVTAGSGVAAAQA  387



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = -1

Query  548  GTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEW  369
            G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  C ++ +W
Sbjct  212  GGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLCAKEPKW  271

Query  368  FSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL  189
             SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL LLG +
Sbjct  272  QSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNELMLLGAI  331

Query  188  AGVEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            +G EM ++D+G  V+ GSGVAAA  Y +N 
Sbjct  332  SGAEMSMRDVGIQVEPGSGVAAAQEYFRNA  361



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  L +  R AV AWGLKNC  + +WFS
Sbjct  248  YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNCATEPKWFS  307

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL +LG LAG
Sbjct  308  DTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNELMVLGALAG  367

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
             EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  368  AEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  227  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  286

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  287  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  346

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  347  AEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  250  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  250  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  250  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  250  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKESKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++VP   D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASA  114
             EM + D+G PV  GSGVAAA A
Sbjct  365  AEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW S
Sbjct  250  YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMSLLDNGVNVTPGSGVAAASSYLREN  397



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  LG ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLGEATRQAVAAWGLKTCAKEAKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILVPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D G  V+ GSGVAAAS+YL+
Sbjct  370  AEMAMLDNGVKVQPGSGVAAASSYLR  395



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL    R AV+AWGLK C +  + +S
Sbjct  242  YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTCCKNPKEYS  301

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTAVVVP   D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL +L  LAG
Sbjct  302  DTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNELMVLATLAG  361

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
             EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  362  TEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>sp|O08374.2|SGAA_HYPME RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Hyphomicrobium methylovorum]
 dbj|BAA19919.1| serine-glyoxylate aminotransferase [Hyphomicrobium methylovorum]
Length=405

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+ QLL GLR  LDLLF EGLDNV ARHTRL +  R AV AWGLK C ++ +W+S
Sbjct  242  FFPYTPATQLLRGLRTSLDLLFAEGLDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWYS  301

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP  IDS+ I K A+ RYN S GLGLNKVAGKVFRIGHLG L+E+ + G L  
Sbjct  302  DTVSAILVPEGIDSNAITKTAYYRYNTSFGLGLNKVAGKVFRIGHLGMLDEVMIGGALFA  361

Query  182  VEMVLKDIGYPVKLGSGVAAASAYL-QNTT  96
             EM LKD G  +KLGSG  AA+ Y  +N T
Sbjct  362  AEMALKDNGVNLKLGSGTGAAAEYFSKNAT  391



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  C ++ +W+S
Sbjct  240  YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCAKEPKWYS  299

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL +LG LAG
Sbjct  300  DTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELMVLGALAG  359

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  90
             EM + D+G PV LGSGV AA ++ +   P+
Sbjct  360  AEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQN  102
             EM + D G  V  GSGVAAAS+YL+ 
Sbjct  370  AEMAMIDCGIKVTPGSGVAAASSYLRE  396



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQN  102
             EM + D G  V  GSGVAAAS+YL+ 
Sbjct  370  AEMAMIDCGIKVTPGSGVAAASSYLRE  396



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPSI LLYGLR  +DLL EEGL NV ARH RL    R AV+AWGL+ C +  +W+S
Sbjct  240  YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELCARDPKWYS  299

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            +TV+A+VVP   D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL L   +AG
Sbjct  300  NTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNELMLCSAIAG  359

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
             EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  360  AEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ +LYGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  C ++E+W+S
Sbjct  245  YFPYTPALPMLYGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLCAKEEKWYS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+AV+VP  ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL LLG LAG
Sbjct  305  DTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNELMLLGALAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            VEM + D G  ++ GSGVAAA   L+ +
Sbjct  365  VEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   166 bits (419),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = -1

Query  536  PYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDT  357
            PYTP + LL+GL+A L LL  EGLDNV ARH RL   TR AV AWGLK   ++  W SDT
Sbjct  220  PYTPILPLLHGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKLLCREPRWQSDT  279

Query  356  VTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  177
            +T V VP  +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++EL L G L GVE
Sbjct  280  LTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDELMLAGALGGVE  339

Query  176  MVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  78
            M L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  340  MTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L   TR AV AWGLK C ++ +W S
Sbjct  245  YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTCAKEPKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D G  ++ GSGVAAA A  +
Sbjct  365  AEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLAEATRQAVAAWGLKTCAKEAKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++VP  ID++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILVPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D G  V+ GSGVAAAS+YL+
Sbjct  370  AEMAMLDNGVKVQPGSGVAAASSYLR  395



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+N+  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAIVKEEGLENIYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+  L+ GLRA +DLL  EG+DNV+ARH RL +  R  V AWGLK C ++ +W+S
Sbjct  242  FFPYTPATTLIRGLRASIDLLLAEGIDNVVARHHRLASGVRAGVAAWGLKLCAKEPKWYS  301

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP  +DS+ + K A+ RYN SLGLGLNKVAGKVFRIGHLG+L+E  + G L  
Sbjct  302  DTVSAILVPEGVDSNAVTKTAYYRYNTSLGLGLNKVAGKVFRIGHLGSLDEYMVGGVLFA  361

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQN  102
            VEM LKD G PVKLGSG AAA+ Y  +
Sbjct  362  VEMALKDNGIPVKLGSGTAAAAEYFTS  388



>ref|WP_015599474.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|AGK59459.1| class V aminotransferase [Hyphomicrobium denitrificans 1NES1]
Length=406

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+  L+ GLR  +DLL  EG+DNV+ARH RL +  R  V AWGLK C ++ +W S
Sbjct  243  FFPYTPATTLIRGLRTSIDLLLGEGIDNVVARHHRLASGVRAGVHAWGLKLCAKEPKWHS  302

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+AV+VP   DS+ + K A+ RYN SLGLGLNKVAGKVFRIGHLG+L+E  + G L  
Sbjct  303  DTVSAVLVPEGFDSNVVTKTAYYRYNTSLGLGLNKVAGKVFRIGHLGSLDEFMVGGVLFA  362

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQN  102
            VEM LKD G PVKLGSG  AA+ Y  N
Sbjct  363  VEMALKDCGIPVKLGSGTGAAAEYFTN  389



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKTCAKEPKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG +AG
Sbjct  305  DTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIAG  364

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D G  ++ GSGVAAA A  +
Sbjct  365  AEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L+++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPVLPLLYGLREALEIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  310  DTVTAIVVPEGADAAKVIIHAFERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  370  AEMAMLDCGIKVTPGSGVAAASSYLREN  397



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  291  YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNS  350

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG
Sbjct  351  DTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAG  410

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  V  GSGVAAAS+YL+  
Sbjct  411  AEMAMIDCGIKVTPGSGVAAASSYLREN  438



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP + LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK C ++ +W S
Sbjct  250  YFPYTPPLPLLYGLREALACLREEGLENVYNRHKVLAEATRQAVAAWGLKTCAKEAKWNS  309

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG
Sbjct  310  DTVTAILVPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAG  369

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D G  V+ GSGVAAAS+YL+
Sbjct  370  AEMSMLDNGVKVQPGSGVAAASSYLR  395



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            ++PYTP+ QL+ GLRA L+L+F EG+DN++ARHTRL +  R AV AWGLK C ++ +W S
Sbjct  243  FFPYTPATQLIRGLRASLNLIFAEGIDNIVARHTRLASGVRAAVDAWGLKLCAKEPKWHS  302

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A+VVP  ID++ ++K A+ RYN SLG GLNK+ G+VFRIGHLG L+E  +   L  
Sbjct  303  DTVSAIVVPEGIDANNVLKTAYYRYNTSLGTGLNKLNGRVFRIGHLGALDEGMIGSALFN  362

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            VEM LKD G P+K GSG  AA+ Y   T
Sbjct  363  VEMTLKDCGVPIKFGSGTGAAAEYFSKT  390



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ +LYGLR  L +LFEE L++V  RH  L    R AV+AWGLK C  + +W+S
Sbjct  240  YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPCATEPKWYS  299

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP  I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG + G
Sbjct  300  DTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIGG  359

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQ  105
             EM + D+G  VKLGSGV AA A+ +
Sbjct  360  AEMAMADVGIDVKLGSGVGAAQAHFR  385



>ref|WP_026227793.1| serine--glyoxylate aminotransferase [Hoeflea sp. 108]
Length=396

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++QLL G+RA LDL+ EEGLDN+  RH RL T  R AV AWGLK C ++ +W S
Sbjct  240  YFPYTPAVQLLRGMRAALDLIQEEGLDNIFERHNRLATGVRKAVDAWGLKVCAKEAKWNS  299

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A+VVP  IDS+E+V+RA+  Y  SLG+GLNKVAGKVFRIGHLG +NE+ + G ++ 
Sbjct  300  DTVSAIVVPEGIDSAEVVRRAYHGYQTSLGVGLNKVAGKVFRIGHLGWVNEVMMCGAISA  359

Query  182  VEMVLKDIGYPVKLGSGVAAA  120
             EM L+D+G  V+ GSGV AA
Sbjct  360  AEMALRDVGVKVQPGSGVGAA  380



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP++ +LYGLR  + +LFEE L++V  RH  L    R AV+AWGL  C ++ +W S
Sbjct  240  YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPCAKEAKWDS  299

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP+ I+ ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG +AG
Sbjct  300  DTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIAG  359

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM ++D+G  ++LGSGV AA  + ++T
Sbjct  360  AEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KE
Sbjct  56   QLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKE  115

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  273
            EW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  116  EWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+
Sbjct  244  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWY  303

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  304  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  363

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  364  GAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+
Sbjct  244  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWY  303

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  304  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  363

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  364  GAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_014890662.1| serine--glyoxylate aminotransferase [Methylocystis sp. SC2]
 emb|CCJ06629.1| Aminotransferase class V [Methylocystis sp. SC2]
Length=397

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGVRAAVSAWGLKCCAKEPKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG + G
Sbjct  305  DTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIGG  364

Query  182  VEMVLKDIGYPVKLGSG  132
             EM + D+G PV  GSG
Sbjct  365  AEMAMLDVGIPVTPGSG  381



>ref|WP_013949995.1| MULTISPECIES: serine--glyoxylate aminotransferase [Hyphomicrobium]
 emb|CCB67605.1| serine-glyoxylate aminotransferase [Hyphomicrobium sp. MC1]
Length=406

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP+ QL+ GLRA LDL+  EG+DNV+ARH R+ +  R AV AWGLK C ++ +W S
Sbjct  243  YFPYTPATQLIRGLRASLDLILAEGIDNVVARHHRMASGVRAAVDAWGLKLCAKEPKWHS  302

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP   D++ ++K A+ RYN SLG GLNKVAGKVFRIGHLG ++E  + G L  
Sbjct  303  DTVSAILVPEGADANAVLKTAYYRYNTSLGTGLNKVAGKVFRIGHLGAVDEFMVGGVLFA  362

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
            VEM LKD G  +KLGSG  AA+ Y   T
Sbjct  363  VEMALKDSGINIKLGSGTGAAAEYFSKT  390



>gb|AHJ67030.1| hypothetical protein GbCGDNIH2_0048 [Granulibacter bethesdensis 
CGDNIH2]
Length=433

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+
Sbjct  283  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWY  342

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  343  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  402

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  403  GAEMAMRDIGIDVKPGSGAAAAEEY  427



>ref|WP_018405893.1| serine--glyoxylate aminotransferase [Methylocystis rosea]
Length=397

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGVRAAVSAWGLKCCAKEPKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG + G
Sbjct  305  DTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIGG  364

Query  182  VEMVLKDIGYPVKLGSG  132
             EM + D+G PV  GSG
Sbjct  365  AEMAMCDVGIPVTPGSG  381



>gb|AHJ64409.1| Serine-pyruvate aminotransferase [Granulibacter bethesdensis 
CGDNIH4]
Length=433

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+
Sbjct  283  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWY  342

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  343  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  402

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  403  GAEMAMRDIGIDVKPGSGAAAAEEY  427



>ref|WP_029648781.1| serine--glyoxylate aminotransferase [Methylocystis sp. SB2]
Length=397

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +W S
Sbjct  245  YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHHLAEGVRAAVSAWGLKCCAKEPKWNS  304

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTVTA+VVP   D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG + G
Sbjct  305  DTVTAIVVPGGFDAAKVIEIAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIGG  364

Query  182  VEMVLKDIGYPVKLGSG  132
             EM + D+G PV  GSG
Sbjct  365  AEMAMCDVGIPVTPGSG  381



>ref|WP_031597721.1| serine--glyoxylate aminotransferase [Ferrovum myxofaciens]
Length=398

 Score =   159 bits (401),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWF  366
            Y+PYTPSI +LYGLR  L +L EEGL+NV ARH  L    R AV Q W L  C +  +W+
Sbjct  240  YFPYTPSIPMLYGLREALVMLEEEGLENVFARHHYLAEGVRAAVTQGWKLSLCAKAPQWY  299

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SD+V+A+VVP+  +++E+++RA++RYNL+LG GL+KVAGKVFRIGHLG+LNE+ L+G +A
Sbjct  300  SDSVSAIVVPAGFNAAEVIERAYRRYNLALGAGLSKVAGKVFRIGHLGDLNEVMLMGAIA  359

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM + D G PV  GSGVAAA+ +
Sbjct  360  GAEMAMLDCGIPVTPGSGVAAATQF  384



>ref|WP_038515723.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+ WGL  C + ++W+
Sbjct  244  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKGWGLTLCAKDQKWY  303

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  304  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  363

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  364  GAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_010960683.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus]
 gb|AAU92322.1| serine--glyoxylate aminotransferase [Methylococcus capsulatus 
str. Bath]
Length=395

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -1

Query  548  GTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEW  369
            G ++PYTPSI LLYGLR  L+LL EEGL+NV ARH RL    R AV AWGL+ C Q  +W
Sbjct  238  GGFFPYTPSIPLLYGLRKSLELLLEEGLENVYARHARLAEGVRRAVAAWGLQLCAQDPKW  297

Query  368  FSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL  189
            +S+TV+AVVVP   D+ +++  A+ RYNLSLG GL++V+GKVFRIGHLG+LNEL L   +
Sbjct  298  YSNTVSAVVVPPEFDARDVIHTAYFRYNLSLGAGLSEVSGKVFRIGHLGDLNELSLASAI  357

Query  188  AGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
             G EM + D+G P+  GSG+AAASA+ + T P+I  R+
Sbjct  358  VGSEMAMLDVGIPLTPGSGIAAASAHWRETAPVIQPRV  395



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP+  LL+GL+  L  + +EGL+ +  RH+ L  ATR A+ AWGLK C +   W S
Sbjct  243  YFPYTPATPLLHGLKEALACIEDEGLEQIFHRHSVLANATRKAIDAWGLKLCAKSPRWHS  302

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++ P  ID+++I+  A+ RYNL+LG GL+KVAGKVFRIGH+G+LNEL LLG LAG
Sbjct  303  DTVSAILAPEGIDAAKIIATAYNRYNLALGAGLSKVAGKVFRIGHIGDLNELMLLGALAG  362

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM + D G  +K GSGV AA  YL++ 
Sbjct  363  AEMAMLDNGVKIKAGSGVGAAQDYLRDN  390



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   151 bits (382),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            ++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKE
Sbjct  56   QLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKE  115

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  273
            EW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  116  EWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AHJ61786.1| Serine-pyruvate aminotransferase [Granulibacter bethesdensis 
CGDNIH3]
Length=433

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R AV+ WGL  C + ++W+
Sbjct  283  YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKGWGLTLCAKDQKWY  342

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + 
Sbjct  343  SDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAIT  402

Query  185  GVEMVLKDIGYPVKLGSGVAAASAY  111
            G EM ++DIG  VK GSG AAA  Y
Sbjct  403  GAEMAMRDIGIDVKPGSGAAAAEEY  427



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+ C +  +W+
Sbjct  248  YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLELCAKGPKWY  307

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   +A
Sbjct  308  SDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAIA  367

Query  185  GVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  90
            G EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  368  GAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>ref|WP_042306504.1| serine--glyoxylate aminotransferase [Burkholderia terrae]
Length=422

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 1/151 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLRA LDLLFEEGLDNV ARH  L +  R A+ + WGL+ C +  +W 
Sbjct  248  YFPYTPALSLLYGLRAALDLLFEEGLDNVFARHHYLASGVRAAITEGWGLEVCAKAPKWH  307

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A+VVP   ++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +A
Sbjct  308  SDTVSAIVVPEGFNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLVSAIA  367

Query  185  GVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            G EM + D G  V+ GSGV AA  Y +  TP
Sbjct  368  GAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



>gb|AID30749.1| serine--glyoxylate aminotransferase [Mesorhizobium huakuii 7653R]
Length=249

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFS  363
            Y+PYTP+ QLL GLRA LDL+ EEGLDN+ ARH RL    R AV AWGLK C +  +W S
Sbjct  93   YFPYTPATQLLRGLRASLDLIAEEGLDNIFARHHRLAEGVRKAVDAWGLKLCAKAPKWHS  152

Query  362  DTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            DTV+A++VP  IDS++IVKRA++ Y  SLG GLNKV GKVFRIGHLG LNE+ +L  L+ 
Sbjct  153  DTVSAILVPEGIDSADIVKRAYRTYQTSLGGGLNKVMGKVFRIGHLGWLNEVMVLSSLSA  212

Query  182  VEMVLKDIGYPVKLGSGVAAASAYLQNT  99
             EM L D G  +  GSGV AA  + + +
Sbjct  213  AEMALLDCGVRLAPGSGVGAAIQHFRAS  240



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -1

Query  554  KMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKE  375
            KMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKE
Sbjct  52   KMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKE  111

Query  374  EWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  285
            EWFSDTVTAVV+P YIDS+EIVKRAWKRYN
Sbjct  112  EWFSDTVTAVVIPPYIDSAEIVKRAWKRYN  141



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = -1

Query  542  YWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWF  366
            Y+PYTP++ LLYGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+ C +   W 
Sbjct  248  YFPYTPALSLLYGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLELCAKAPRWH  307

Query  365  SDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLA  186
            SDTV+A+VVP  +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +A
Sbjct  308  SDTVSAIVVPEGVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMSAIA  367

Query  185  GVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  93
            G EM + D G  V+ GSGV AA  Y +  TP
Sbjct  368  GAEMAMLDAGIDVRPGSGVGAAGQYWRTHTP  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760