BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005P12

Length=400
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590354.1|  PREDICTED: uncharacterized protein LOC104087...  56.6    8e-07   Nicotiana tomentosiformis
ref|XP_009590352.1|  PREDICTED: uncharacterized protein LOC104087...  56.6    8e-07   Nicotiana tomentosiformis
ref|XP_009799706.1|  PREDICTED: uncharacterized protein LOC104245...  54.3    5e-06   Nicotiana sylvestris
ref|XP_009799707.1|  PREDICTED: uncharacterized protein LOC104245...  54.3    5e-06   Nicotiana sylvestris
ref|XP_009413538.1|  PREDICTED: uncharacterized protein LOC103994824  52.4    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011074759.1|  PREDICTED: uncharacterized protein LOC105159405  52.0    3e-05   Sesamum indicum [beniseed]
emb|CDP10040.1|  unnamed protein product                              50.1    1e-04   Coffea canephora [robusta coffee]
ref|XP_006473052.1|  PREDICTED: uncharacterized protein LOC102612442  50.1    1e-04   Citrus sinensis [apfelsine]
ref|XP_006434454.1|  hypothetical protein CICLE_v10001142mg           50.1    2e-04   Citrus clementina [clementine]
ref|XP_010241711.1|  PREDICTED: uncharacterized protein LOC104586241  50.1    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_011101525.1|  PREDICTED: uncharacterized protein LOC105179584  49.7    2e-04   Sesamum indicum [beniseed]
ref|XP_011044210.1|  PREDICTED: uncharacterized protein LOC105139468  48.9    3e-04   Populus euphratica
gb|EYU17440.1|  hypothetical protein MIMGU_mgv1a018390mg              48.5    4e-04   Erythranthe guttata [common monkey flower]
gb|EYU36855.1|  hypothetical protein MIMGU_mgv1a007325mg              48.5    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_011042849.1|  PREDICTED: uncharacterized protein LOC105138468  48.5    5e-04   Populus euphratica
ref|XP_002302181.2|  hypothetical protein POPTR_0002s06930g           48.1    5e-04   
gb|KJB28996.1|  hypothetical protein B456_005G079200                  48.5    5e-04   Gossypium raimondii
gb|KJB16471.1|  hypothetical protein B456_002G231400                  47.8    7e-04   Gossypium raimondii
emb|CBI18199.3|  unnamed protein product                              47.4    0.001   Vitis vinifera



>ref|XP_009590354.1| PREDICTED: uncharacterized protein LOC104087550 isoform X2 [Nicotiana 
tomentosiformis]
Length=407

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADN  221
            K  IQAQMLELEKERF W+RFS+KK+ ELEMMRMENER+KLENE MALELK+KEMLADN
Sbjct  348  KLQIQAQMLELEKERFNWKRFSRKKDIELEMMRMENERIKLENECMALELKRKEMLADN  406



>ref|XP_009590352.1| PREDICTED: uncharacterized protein LOC104087550 isoform X1 [Nicotiana 
tomentosiformis]
Length=420

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADN  221
            K  IQAQMLELEKERF W+RFS+KK+ ELEMMRMENER+KLENE MALELK+KEMLADN
Sbjct  361  KLQIQAQMLELEKERFNWKRFSRKKDIELEMMRMENERIKLENECMALELKRKEMLADN  419



>ref|XP_009799706.1| PREDICTED: uncharacterized protein LOC104245746 isoform X1 [Nicotiana 
sylvestris]
Length=418

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADN  221
            K  IQAQMLELEKERF W+RFS+KK+ ELEMMRMENER+KLENE MALELK+KEMLA+N
Sbjct  359  KLQIQAQMLELEKERFNWKRFSRKKDIELEMMRMENERIKLENECMALELKRKEMLAEN  417



>ref|XP_009799707.1| PREDICTED: uncharacterized protein LOC104245746 isoform X2 [Nicotiana 
sylvestris]
Length=405

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADN  221
            K  IQAQMLELEKERF W+RFS+KK+ ELEMMRMENER+KLENE MALELK+KEMLA+N
Sbjct  346  KLQIQAQMLELEKERFNWKRFSRKKDIELEMMRMENERIKLENECMALELKRKEMLAEN  404



>ref|XP_009413538.1| PREDICTED: uncharacterized protein LOC103994824 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K HIQAQMLELEK+R+KWQRFS+KK+ EL MMRMENERMK+ENER++LEL+QKEM  D  
Sbjct  360  KLHIQAQMLELEKQRYKWQRFSKKKDRELNMMRMENERMKIENERLSLELRQKEMELDLT  419

Query  217  S  215
            S
Sbjct  420  S  420



>ref|XP_011074759.1| PREDICTED: uncharacterized protein LOC105159405 [Sesamum indicum]
Length=437

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  391  HIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            HI  QMLELEKERFKWQRF +KK+ ELEMM+ME ERMKLENERMALEL++KEM  DNN
Sbjct  380  HIDLQMLELEKERFKWQRFCRKKDRELEMMKMEIERMKLENERMALELRRKEMGIDNN  437



>emb|CDP10040.1| unnamed protein product [Coffea canephora]
Length=445

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K  IQAQMLELEKERFKWQ+FS+KK+ ELE+M++ENERM+LENERMALELK+KEM  ++N
Sbjct  386  KLQIQAQMLELEKERFKWQKFSRKKDRELEIMKIENERMRLENERMALELKRKEMGIESN  445



>ref|XP_006473052.1| PREDICTED: uncharacterized protein LOC102612442 [Citrus sinensis]
Length=447

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLAD  224
            K  IQ +MLELEK+RFKWQRFS+K++ ELE +RMENERMKLENERMALELKQKEM AD
Sbjct  388  KLQIQVEMLELEKQRFKWQRFSKKRDRELEKLRMENERMKLENERMALELKQKEMGAD  445



>ref|XP_006434454.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|ESR47694.1| hypothetical protein CICLE_v10001142mg [Citrus clementina]
 gb|KDO83724.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
 gb|KDO83725.1| hypothetical protein CISIN_1g013261mg [Citrus sinensis]
Length=447

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLAD  224
            K  IQ +MLELEK+RFKWQRFS+K++ ELE +RMENERMKLENERMALELKQKEM AD
Sbjct  388  KLQIQVEMLELEKQRFKWQRFSKKRDRELEKLRMENERMKLENERMALELKQKEMGAD  445



>ref|XP_010241711.1| PREDICTED: uncharacterized protein LOC104586241 [Nelumbo nucifera]
Length=452

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K  I+AQMLELE+ERFKWQRFS+KK+ EL+ MRMENERMKLENERMALELK +E+ AD N
Sbjct  390  KIQIEAQMLELERERFKWQRFSRKKDRELDKMRMENERMKLENERMALELKHRELEADFN  449



>ref|XP_011101525.1| PREDICTED: uncharacterized protein LOC105179584 [Sesamum indicum]
Length=437

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  391  HIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            HIQA+ LEL+KERFKW+RF +KK+ ELEMM+ME ERMKLENERMALEL+QKE+  DNN
Sbjct  380  HIQAEKLELDKERFKWERFCRKKDRELEMMKMEIERMKLENERMALELRQKEIGMDNN  437



>ref|XP_011044210.1| PREDICTED: uncharacterized protein LOC105139468 [Populus euphratica]
Length=447

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -1

Query  388  IQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            IQ +MLELEK+RFKWQRFS+K++ ELE +RMENERMKLENERMALELK KEM AD N
Sbjct  391  IQQEMLELEKQRFKWQRFSKKRDHELEKLRMENERMKLENERMALELKHKEMGADFN  447



>gb|EYU17440.1| hypothetical protein MIMGU_mgv1a018390mg [Erythranthe guttata]
Length=384

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = -1

Query  391  HIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEM-LADNN  218
            HIQ Q LELEKERFKWQRF +K++ ELEMM+ME ERMKLENERMALEL++KEM + DNN
Sbjct  326  HIQVQTLELEKERFKWQRFCRKQDRELEMMKMEIERMKLENERMALELRRKEMGIIDNN  384



>gb|EYU36855.1| hypothetical protein MIMGU_mgv1a007325mg [Erythranthe guttata]
Length=411

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 1/61 (2%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEM-LADN  221
            + HI+ QMLELEKERFKWQ+F QKK+ ELE+MR+E ERMKLENERMAL+L+++EM + DN
Sbjct  351  RVHIEEQMLELEKERFKWQKFCQKKDRELEIMRIEIERMKLENERMALDLRRREMGIIDN  410

Query  220  N  218
            N
Sbjct  411  N  411



>ref|XP_011042849.1| PREDICTED: uncharacterized protein LOC105138468 [Populus euphratica]
Length=447

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K  IQ +MLELEK+RFKWQRFS+K++ ELE +RMENERMKLEN++MALELK+KEM AD N
Sbjct  388  KLQIQQEMLELEKQRFKWQRFSKKRDRELEKLRMENERMKLENDQMALELKRKEMGADFN  447



>ref|XP_002302181.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
 gb|EEE81454.2| hypothetical protein POPTR_0002s06930g [Populus trichocarpa]
Length=420

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K  IQ +MLELEK+RFKWQRFS+K++ ELE +RMENER+KLENE+MALELK+KEM AD N
Sbjct  361  KLQIQQEMLELEKQRFKWQRFSKKRDRELEKLRMENERIKLENEQMALELKRKEMGADFN  420



>gb|KJB28996.1| hypothetical protein B456_005G079200 [Gossypium raimondii]
Length=447

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLAD  224
            K  IQ +MLELEK+RFKWQRFS+K++ ELE MRMENERMKLENERMALELKQKE+ AD
Sbjct  390  KLQIQVEMLELEKQRFKWQRFSKKRDRELEKMRMENERMKLENERMALELKQKELDAD  447



>gb|KJB16471.1| hypothetical protein B456_002G231400 [Gossypium raimondii]
Length=442

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLAD  224
            K  IQ +MLELEK+RFKWQRFS+K + ELE +RMENERMKLENERMALELK+KE+ AD
Sbjct  385  KLQIQVEMLELEKQRFKWQRFSKKSDCELEKIRMENERMKLENERMALELKRKELAAD  442



>emb|CBI18199.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = -1

Query  397  KXHIQAQMLELEKERFKWQRFSQKKNFelemmrmenermklenerMALELKQKEMLADNN  218
            K  IQ QMLELEK+RFKWQRF +KK+ +L+ +RMENERMKLENERMALELK+KEM A  N
Sbjct  302  KLQIQEQMLELEKQRFKWQRFCRKKDRDLDKLRMENERMKLENERMALELKRKEMGASYN  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554820161530