BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005H05

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI37693.3|  unnamed protein product                                249   1e-79   Vitis vinifera
ref|XP_002283561.1|  PREDICTED: COP9 signalosome complex subunit ...    250   7e-79   Vitis vinifera
gb|KHN16463.1|  COP9 signalosome complex subunit 5b                     239   6e-77   Glycine soja [wild soybean]
gb|KDP33444.1|  hypothetical protein JCGZ_07015                         245   9e-77   Jatropha curcas
ref|XP_009617619.1|  PREDICTED: COP9 signalosome complex subunit ...    244   1e-76   Nicotiana tomentosiformis
ref|XP_002527960.1|  jun activation domain binding protein, putative    244   2e-76   Ricinus communis
gb|AFK33507.1|  unknown                                                 238   3e-76   Medicago truncatula
ref|XP_010111938.1|  COP9 signalosome complex subunit 5b                243   1e-75   
emb|CDP18325.1|  unnamed protein product                                239   1e-75   Coffea canephora [robusta coffee]
ref|XP_008445090.1|  PREDICTED: COP9 signalosome complex subunit ...    242   2e-75   Cucumis melo [Oriental melon]
ref|XP_009786152.1|  PREDICTED: COP9 signalosome complex subunit ...    241   4e-75   Nicotiana sylvestris
ref|XP_003522659.1|  PREDICTED: COP9 signalosome complex subunit 5a     241   6e-75   Glycine max [soybeans]
ref|XP_004138765.1|  PREDICTED: COP9 signalosome complex subunit ...    240   7e-75   Cucumis sativus [cucumbers]
ref|XP_007137114.1|  hypothetical protein PHAVU_009G100700g             240   9e-75   Phaseolus vulgaris [French bean]
ref|XP_003526451.1|  PREDICTED: COP9 signalosome complex subunit 5a     239   2e-74   Glycine max [soybeans]
ref|XP_004291259.1|  PREDICTED: COP9 signalosome complex subunit ...    239   2e-74   Fragaria vesca subsp. vesca
ref|XP_002324396.1|  COP9 complex family protein                        238   5e-74   
gb|ACJ84456.1|  unknown                                                 238   6e-74   Medicago truncatula
ref|XP_003603531.1|  COP9 signalosome complex subunit 5b                238   6e-74   
gb|EYU29155.1|  hypothetical protein MIMGU_mgv1a0088021mg               231   4e-73   Erythranthe guttata [common monkey flower]
ref|XP_011031359.1|  PREDICTED: COP9 signalosome complex subunit ...    236   4e-73   Populus euphratica
gb|AAC26484.1|  putative JUN kinase activation domain binding pro...    235   4e-73   Medicago sativa [alfalfa]
ref|XP_004501247.1|  PREDICTED: COP9 signalosome complex subunit ...    235   5e-73   Cicer arietinum [garbanzo]
ref|XP_011076561.1|  PREDICTED: COP9 signalosome complex subunit ...    235   7e-73   Sesamum indicum [beniseed]
ref|XP_011045010.1|  PREDICTED: COP9 signalosome complex subunit ...    235   8e-73   Populus euphratica
ref|XP_011459046.1|  PREDICTED: COP9 signalosome complex subunit ...    234   2e-72   Fragaria vesca subsp. vesca
ref|XP_010048447.1|  PREDICTED: COP9 signalosome complex subunit ...    234   2e-72   Eucalyptus grandis [rose gum]
ref|XP_007221779.1|  hypothetical protein PRUPE_ppa007500mg             234   3e-72   Prunus persica
ref|XP_006382165.1|  COP9 complex family protein                        233   4e-72   Populus trichocarpa [western balsam poplar]
ref|XP_006351153.1|  PREDICTED: COP9 signalosome complex subunit ...    233   6e-72   Solanum tuberosum [potatoes]
gb|KDO67280.1|  hypothetical protein CISIN_1g018085mg                   232   6e-72   Citrus sinensis [apfelsine]
ref|XP_010259860.1|  PREDICTED: COP9 signalosome complex subunit ...    231   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_009338826.1|  PREDICTED: COP9 signalosome complex subunit ...    231   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_008378244.1|  PREDICTED: COP9 signalosome complex subunit ...    231   2e-71   Malus domestica [apple tree]
ref|XP_008393958.1|  PREDICTED: COP9 signalosome complex subunit ...    232   2e-71   
ref|XP_006450165.1|  hypothetical protein CICLE_v10008736mg             229   8e-71   Citrus clementina [clementine]
ref|XP_004241422.1|  PREDICTED: COP9 signalosome complex subunit 5b     229   2e-70   Solanum lycopersicum
gb|KDO67279.1|  hypothetical protein CISIN_1g018085mg                   228   5e-70   Citrus sinensis [apfelsine]
ref|XP_006347307.1|  PREDICTED: COP9 signalosome complex subunit ...    227   1e-69   Solanum tuberosum [potatoes]
emb|CBL87025.1|  CSN5 protein                                           227   1e-69   Solanum lycopersicum
ref|XP_011082082.1|  PREDICTED: COP9 signalosome complex subunit ...    226   2e-69   Sesamum indicum [beniseed]
ref|XP_006450164.1|  hypothetical protein CICLE_v10008736mg             225   5e-69   Citrus clementina [clementine]
gb|KHG19604.1|  COP9 signalosome complex subunit 5b -like protein       224   9e-69   Gossypium arboreum [tree cotton]
ref|NP_001234331.1|  JAB                                                224   1e-68   
ref|XP_010477567.1|  PREDICTED: COP9 signalosome complex subunit 5b     223   4e-68   Camelina sativa [gold-of-pleasure]
gb|KJB55192.1|  hypothetical protein B456_009G068200                    222   5e-68   Gossypium raimondii
ref|XP_007011590.1|  COP9-signalosome 5B                                222   6e-68   
gb|AAO41956.1|  putative c-JUN coactivator protein AJH1                 211   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669282.1|  PREDICTED: COP9 signalosome complex subunit ...    219   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010551182.1|  PREDICTED: COP9 signalosome complex subunit 5b     216   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_006305189.1|  hypothetical protein CARUB_v10009554mg             216   2e-65   Capsella rubella
ref|XP_002893252.1|  hypothetical protein ARALYDRAFT_472541             215   3e-65   
gb|ABK24758.1|  unknown                                                 214   6e-65   Picea sitchensis
gb|KJB55195.1|  hypothetical protein B456_009G068200                    213   2e-64   Gossypium raimondii
ref|XP_009115580.1|  PREDICTED: COP9 signalosome complex subunit 5b     212   5e-64   Brassica rapa
gb|AAM65053.1|  putative JUN kinase activator protein                   211   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173705.1|  COP9 signalosome complex subunit 5a                   211   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420301.1|  PREDICTED: COP9 signalosome complex subunit ...    211   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002887356.1|  hypothetical protein ARALYDRAFT_894961             210   3e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010914180.1|  PREDICTED: COP9 signalosome complex subunit ...    209   5e-63   Elaeis guineensis
ref|XP_010498782.1|  PREDICTED: COP9 signalosome complex subunit ...    209   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010460061.1|  PREDICTED: COP9 signalosome complex subunit ...    209   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010929274.1|  PREDICTED: COP9 signalosome complex subunit ...    208   1e-62   Elaeis guineensis
gb|KFK41544.1|  hypothetical protein AALP_AA2G143000                    207   3e-62   Arabis alpina [alpine rockcress]
ref|XP_008810007.1|  PREDICTED: COP9 signalosome complex subunit ...    207   4e-62   Phoenix dactylifera
ref|XP_008804896.1|  PREDICTED: COP9 signalosome complex subunit ...    202   4e-62   Phoenix dactylifera
gb|AAC36344.1|  AJH1                                                    206   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44380.1|  hypothetical protein AALP_AA1G249900                    206   1e-61   Arabis alpina [alpine rockcress]
ref|XP_006845674.1|  hypothetical protein AMTR_s00019p00231450          205   3e-61   Amborella trichopoda
gb|EAZ32248.1|  hypothetical protein OsJ_16452                          202   7e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960128.1|  PREDICTED: COP9 signalosome complex subunit ...    204   8e-61   Setaria italica
ref|XP_006416142.1|  hypothetical protein EUTSA_v10008042mg             202   3e-60   Eutrema salsugineum [saltwater cress]
ref|NP_001054112.1|  Os04g0654700                                       202   3e-60   
gb|EEC78160.1|  hypothetical protein OsI_17724                          202   5e-60   Oryza sativa Indica Group [Indian rice]
emb|CAE03401.3|  OSJNBa0071I13.2                                        202   6e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415831.1|  PREDICTED: COP9 signalosome complex subunit ...    201   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006652935.1|  PREDICTED: COP9 signalosome complex subunit ...    201   7e-60   Oryza brachyantha
ref|NP_177279.1|  COP9 signalosome complex subunit 5b                   200   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAC36343.1|  AJH2                                                    200   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471135.1|  PREDICTED: COP9 signalosome complex subunit ...    200   3e-59   Camelina sativa [gold-of-pleasure]
ref|NP_001149650.1|  COP9 signalosome complex subunit 5b                200   3e-59   Zea mays [maize]
ref|XP_006302454.1|  hypothetical protein CARUB_v10020540mg             199   7e-59   Capsella rubella
ref|XP_010427950.1|  PREDICTED: COP9 signalosome complex subunit ...    199   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010240543.1|  PREDICTED: COP9 signalosome complex subunit ...    195   2e-57   Brachypodium distachyon [annual false brome]
ref|XP_001775449.1|  predicted protein                                  195   3e-57   
gb|EMS48301.1|  COP9 signalosome complex subunit 5b                     190   1e-55   Triticum urartu
gb|EMT09486.1|  hypothetical protein F775_29820                         190   2e-55   
dbj|BAJ93853.1|  predicted protein                                      189   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001752249.1|  predicted protein                                  189   3e-55   
emb|CDY25761.1|  BnaA07g10210D                                          188   8e-55   Brassica napus [oilseed rape]
ref|XP_002961002.1|  hypothetical protein SELMODRAFT_73440              188   9e-55   
ref|XP_002967006.1|  hypothetical protein SELMODRAFT_168868             188   9e-55   
ref|XP_006450163.1|  hypothetical protein CICLE_v10008736mg             186   3e-54   
gb|KJB65951.1|  hypothetical protein B456_010G123100                    185   6e-54   Gossypium raimondii
ref|XP_009103210.1|  PREDICTED: COP9 signalosome complex subunit ...    186   6e-54   Brassica rapa
gb|KHG22386.1|  COP9 signalosome complex subunit 5a -like protein       184   2e-53   Gossypium arboreum [tree cotton]
ref|XP_006390791.1|  hypothetical protein EUTSA_v10018788mg             182   9e-53   Eutrema salsugineum [saltwater cress]
gb|KJB55194.1|  hypothetical protein B456_009G068200                    179   1e-51   Gossypium raimondii
ref|NP_973890.1|  COP9 signalosome complex subunit 5a                   175   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929275.1|  PREDICTED: COP9 signalosome complex subunit ...    168   3e-47   
gb|KJB55196.1|  hypothetical protein B456_009G068200                    164   4e-46   Gossypium raimondii
ref|XP_004353437.1|  signalosome complex protein                        161   2e-44   Acanthamoeba castellanii str. Neff
ref|XP_638491.1|  Mov34/MPN/PAD-1 family protein                        146   6e-39   Dictyostelium discoideum AX4
ref|XP_003292126.1|  Mov34/MPN/PAD-1 family protein                     141   4e-37   Dictyostelium purpureum
ref|XP_011082083.1|  PREDICTED: COP9 signalosome complex subunit ...    140   9e-37   Sesamum indicum [beniseed]
gb|AAL82571.1|  Jun activation domain binding protein                   134   7e-36   Homo sapiens [man]
gb|KFP72154.1|  COP9 signalosome complex subunit 5                      134   9e-36   Acanthisitta chloris
ref|XP_009074279.1|  PREDICTED: COP9 signalosome complex subunit 5      134   9e-36   Acanthisitta chloris
ref|XP_007248979.1|  PREDICTED: COP9 signalosome complex subunit 5      137   1e-35   Astyanax mexicanus [blind cave fish]
ref|XP_009866049.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-35   Apaloderma vittatum
ref|XP_007885057.1|  PREDICTED: COP9 signalosome complex subunit ...    135   3e-35   Callorhinchus milii [Australian ghost shark]
ref|XP_009491803.1|  PREDICTED: COP9 signalosome complex subunit 5      135   3e-35   Pelecanus crispus
ref|NP_957019.1|  COP9 signalosome complex subunit 5                    136   3e-35   Danio rerio [leopard danio]
ref|XP_009512046.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-35   Phalacrocorax carbo [common cormorant]
ref|XP_009569185.1|  PREDICTED: COP9 signalosome complex subunit 5      135   3e-35   Cuculus canorus
gb|KFW95881.1|  COP9 signalosome complex subunit 5                      134   3e-35   Phalacrocorax carbo [common cormorant]
ref|XP_005019397.1|  PREDICTED: COP9 signalosome complex subunit 5      134   4e-35   
ref|XP_010134433.1|  PREDICTED: COP9 signalosome complex subunit 5      134   4e-35   Buceros rhinoceros silvestris
ref|XP_001636625.1|  predicted protein                                  136   4e-35   Nematostella vectensis
ref|XP_009883867.1|  PREDICTED: COP9 signalosome complex subunit 5      134   5e-35   Charadrius vociferus
gb|KFQ58471.1|  COP9 signalosome complex subunit 5                      135   5e-35   Pelecanus crispus
gb|KFV70073.1|  COP9 signalosome complex subunit 5                      134   5e-35   Picoides pubescens
ref|XP_004637626.1|  PREDICTED: COP9 signalosome complex subunit 5      133   6e-35   
gb|KFR15387.1|  COP9 signalosome complex subunit 5                      134   6e-35   Opisthocomus hoazin [hoatzin]
ref|XP_004697588.1|  PREDICTED: COP9 signalosome complex subunit 5      134   7e-35   Echinops telfairi [lesser hedgehog tenrec]
gb|EOB01530.1|  COP9 signalosome complex subunit 5                      134   7e-35   Anas platyrhynchos [duck]
gb|KFO04966.1|  COP9 signalosome complex subunit 5                      134   7e-35   Balearica regulorum gibbericeps
gb|AET43978.1|  COP9 signalosome subunit 5                              135   7e-35   Reishia clavigera
ref|XP_008852995.1|  PREDICTED: COP9 signalosome complex subunit ...    134   7e-35   Nannospalax galili
gb|KFR04453.1|  COP9 signalosome complex subunit 5                      134   8e-35   Nipponia nippon
gb|KFZ45477.1|  COP9 signalosome complex subunit 5                      134   8e-35   Antrostomus carolinensis
gb|KFO89731.1|  COP9 signalosome complex subunit 5                      134   8e-35   Buceros rhinoceros silvestris
gb|KFO71148.1|  COP9 signalosome complex subunit 5                      134   8e-35   Cuculus canorus
ref|XP_005042220.1|  PREDICTED: COP9 signalosome complex subunit 5      134   8e-35   
ref|XP_006006855.1|  PREDICTED: COP9 signalosome complex subunit ...    135   8e-35   Latimeria chalumnae
gb|ELU08061.1|  hypothetical protein CAPTEDRAFT_163387                  134   8e-35   Capitella teleta
gb|KFV78011.1|  COP9 signalosome complex subunit 5                      134   8e-35   Struthio camelus australis
gb|KGL93740.1|  COP9 signalosome complex subunit 5                      134   8e-35   Charadrius vociferus
ref|NP_989109.1|  COP9 signalosome complex subunit 5                    135   8e-35   Xenopus tropicalis [western clawed frog]
gb|KFP12389.1|  COP9 signalosome complex subunit 5                      134   8e-35   Egretta garzetta
gb|KFU88065.1|  COP9 signalosome complex subunit 5                      134   8e-35   Chaetura pelagica
gb|KFZ51066.1|  COP9 signalosome complex subunit 5                      134   9e-35   Podiceps cristatus
ref|XP_009957073.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   Leptosomus discolor
ref|XP_008565069.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006860136.1|  PREDICTED: COP9 signalosome complex subunit 5      134   1e-34   Chrysochloris asiatica
ref|XP_005392181.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   
ref|XP_009453744.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   
gb|KFW88042.1|  COP9 signalosome complex subunit 5                      134   1e-34   Manacus vitellinus
ref|XP_005517166.1|  PREDICTED: COP9 signalosome complex subunit ...    135   1e-34   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007885051.1|  PREDICTED: COP9 signalosome complex subunit ...    135   1e-34   Callorhinchus milii [Australian ghost shark]
ref|XP_009083868.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   
ref|XP_005150844.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   
ref|XP_009333319.1|  PREDICTED: COP9 signalosome complex subunit 5      133   1e-34   Pygoscelis adeliae
ref|XP_010574205.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   Haliaeetus leucocephalus
ref|XP_009575600.1|  PREDICTED: COP9 signalosome complex subunit 5      133   1e-34   Fulmarus glacialis
gb|KFW04486.1|  COP9 signalosome complex subunit 5                      133   1e-34   Fulmarus glacialis
ref|XP_009957065.1|  PREDICTED: COP9 signalosome complex subunit ...    134   1e-34   Leptosomus discolor
gb|AAX37104.1|  COP9 constitutive photomorphogenic-like subunit 5       134   2e-34   synthetic construct
gb|AAD03468.1|  38 kDa Mov34 homolog                                    134   2e-34   Homo sapiens [man]
ref|XP_008173762.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Chrysemys picta bellii
gb|KFP96001.1|  COP9 signalosome complex subunit 5                      134   2e-34   Leptosomus discolor
ref|XP_006131546.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   
ref|XP_006090662.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   
ref|XP_535093.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    134   2e-34   Canis lupus familiaris [dogs]
ref|XP_005866406.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   Myotis brandtii
ref|NP_001034400.1|  COP9 signalosome complex subunit 5                 134   2e-34   Gallus gallus [bantam]
ref|NP_001232700.1|  putative JUN activation binding protein vari...    134   2e-34   Taeniopygia guttata
ref|XP_009083861.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Serinus canaria [canary]
ref|XP_005150843.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Melopsittacus undulatus
ref|XP_011448116.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Crassostrea gigas
ref|XP_010574204.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Haliaeetus leucocephalus
ref|XP_003831400.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   Pan paniscus [bonobo]
ref|XP_006237820.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Rattus norvegicus [brown rat]
ref|NP_006828.2|  COP9 signalosome complex subunit 5                    134   2e-34   Homo sapiens [man]
gb|KFW63060.1|  COP9 signalosome complex subunit 5                      133   2e-34   Pygoscelis adeliae
ref|XP_004679877.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   Condylura cristata
ref|XP_001494265.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   
ref|NP_001179068.1|  COP9 signalosome complex subunit 5                 134   2e-34   Bos taurus [bovine]
ref|NP_001264030.1|  COP9 signalosome complex subunit 5 isoform 2       134   2e-34   Mus musculus [mouse]
gb|ELR58372.1|  COP9 signalosome complex subunit 5                      134   2e-34   Bos mutus
gb|AAB16847.1|  Jun activation domain binding protein                   134   2e-34   Homo sapiens [man]
ref|NP_001098770.1|  COP9 signalosome complex subunit 5                 134   2e-34   Sus scrofa [pigs]
gb|AAP36860.1|  Homo sapiens COP9 constitutive photomorphogenic h...    134   2e-34   synthetic construct
ref|XP_001512862.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_006131545.1|  PREDICTED: COP9 signalosome complex subunit ...    134   2e-34   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001368118.1|  PREDICTED: COP9 signalosome complex subunit 5      134   2e-34   Monodelphis domestica
ref|XP_008704973.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Ursus maritimus [white bear]
ref|XP_005311431.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Chrysemys picta bellii
ref|XP_001179203.2|  PREDICTED: COP9 signalosome complex subunit ...    132   3e-34   
ref|XP_007527171.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   Erinaceus europaeus [common hedgehog]
ref|XP_011219513.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Ailuropoda melanoleuca
ref|XP_006262064.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   
ref|XP_004602468.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   Sorex araneus [Eurasian shrew]
ref|XP_007429682.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   Python bivittatus
ref|XP_004814144.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   
ref|NP_001020866.1|  COP9 signalosome complex subunit 5                 134   3e-34   Rattus norvegicus [brown rat]
ref|XP_007080737.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Panthera tigris altaica
ref|XP_008565067.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Galeopterus variegatus [Malayan flying lemur]
pdb|4D18|E  Chain E, Crystal Structure Of The Cop9 Signalosome          134   3e-34   Homo sapiens [man]
gb|EGW14995.1|  COP9 signalosome complex subunit 5                      134   3e-34   Cricetulus griseus [Chinese hamsters]
ref|NP_038743.1|  COP9 signalosome complex subunit 5 isoform 1          134   3e-34   Mus musculus [mouse]
ref|XP_008106749.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   Anolis carolinensis [Carolina anole]
ref|XP_006943314.1|  PREDICTED: COP9 signalosome complex subunit ...    133   3e-34   Felis catus [cat]
ref|XP_005663091.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   Sus scrofa [pigs]
ref|XP_011448117.1|  PREDICTED: COP9 signalosome complex subunit ...    134   3e-34   
ref|XP_007066265.1|  PREDICTED: COP9 signalosome complex subunit 5      134   3e-34   Chelonia mydas [green seaturtle]
ref|NP_001086291.1|  COP9 signalosome complex subunit 5                 133   4e-34   Xenopus laevis [clawed frog]
ref|XP_005977666.1|  PREDICTED: COP9 signalosome complex subunit ...    134   4e-34   
ref|XP_008072512.1|  PREDICTED: COP9 signalosome complex subunit 5      134   5e-34   Carlito syrichta
ref|XP_001200311.2|  PREDICTED: COP9 signalosome complex subunit ...    135   5e-34   
gb|EAW86930.1|  COP9 constitutive photomorphogenic homolog subuni...    134   5e-34   Homo sapiens [man]
gb|KFM00893.1|  COP9 signalosome complex subunit 5                      133   6e-34   Aptenodytes forsteri
ref|XP_009274936.1|  PREDICTED: COP9 signalosome complex subunit 5      133   6e-34   Aptenodytes forsteri
ref|XP_004638141.1|  PREDICTED: COP9 signalosome complex subunit ...    133   6e-34   Octodon degus
gb|ETE60341.1|  COP9 signalosome complex subunit 5                      134   6e-34   Ophiophagus hannah
ref|XP_006069586.1|  PREDICTED: COP9 signalosome complex subunit ...    133   1e-33   
ref|XP_007651216.1|  PREDICTED: COP9 signalosome complex subunit ...    133   1e-33   
gb|ELW64697.1|  COP9 signalosome complex subunit 5                      134   1e-33   Tupaia chinensis
ref|XP_007634273.1|  PREDICTED: COP9 signalosome complex subunit ...    133   1e-33   
dbj|BAM18530.1|  COP9 complex homolog subunit 5                         132   2e-33   Papilio xuthus [Chinese swallowtail]
gb|KJB55193.1|  hypothetical protein B456_009G068200                    131   2e-33   Gossypium raimondii
ref|XP_006901120.1|  PREDICTED: COP9 signalosome complex subunit ...    129   2e-33   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006779523.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    132   3e-33   
gb|EHJ73122.1|  JAB-MPN domain protein                                  132   4e-33   
gb|ERE86124.1|  COP9 signalosome complex subunit 5                      134   5e-33   Cricetulus griseus [Chinese hamsters]
ref|XP_011297758.1|  PREDICTED: COP9 signalosome complex subunit 5      130   8e-33   Fopius arisanus
ref|NP_001138802.1|  JAB-MPN domain protein                             130   9e-33   Bombyx mori [silk moth]
ref|XP_009045703.1|  hypothetical protein LOTGIDRAFT_224262             129   1e-32   Lottia gigantea
gb|KEH17815.1|  COP9 signalosome complex subunit 5a-like protein        122   1e-32   Medicago truncatula
ref|XP_006752490.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    129   2e-32   Leptonychotes weddellii
ref|XP_008548790.1|  PREDICTED: COP9 signalosome complex subunit ...    129   2e-32   Microplitis demolitor
ref|XP_008989617.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    129   3e-32   
ref|XP_002422812.1|  COP9 signalosome complex subunit, putative         128   3e-32   Pediculus humanus corporis [human body lice]
ref|XP_004524030.1|  PREDICTED: COP9 signalosome complex subunit ...    128   3e-32   
gb|KDR11248.1|  COP9 signalosome complex subunit 5                      127   6e-32   Zootermopsis nevadensis
dbj|BAN21083.1|  jun activation domain binding protein                  127   7e-32   Riptortus pedestris
ref|XP_009974671.1|  PREDICTED: COP9 signalosome complex subunit 5      121   1e-31   Tyto alba [Schleiereule]
gb|EFZ10471.1|  hypothetical protein SINV_14809                         122   1e-31   
ref|XP_010601003.1|  PREDICTED: COP9 signalosome complex subunit ...    121   1e-31   
gb|AEE62710.1|  unknown                                                 126   2e-31   Dendroctonus ponderosae
ref|XP_004354957.1|  Mov34/MPN/PAD-1 family protein                     126   2e-31   Cavenderia fasciculata
ref|XP_011502813.1|  PREDICTED: COP9 signalosome complex subunit 5      126   2e-31   Ceratosolen solmsi marchali
ref|XP_972769.1|  PREDICTED: COP9 signalosome complex subunit 5         126   3e-31   
ref|NP_001156462.1|  COP9 complex homolog subunit 5                     125   4e-31   Acyrthosiphon pisum
ref|XP_005099578.1|  PREDICTED: COP9 signalosome complex subunit ...    125   4e-31   Aplysia californica
emb|CDH56438.1|  cop9 signalosome complex subunit 5a-like               125   4e-31   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_008185322.1|  PREDICTED: COP9 complex homolog subunit 5 is...    125   4e-31   Acyrthosiphon pisum
ref|XP_009029035.1|  hypothetical protein HELRODRAFT_185158             125   5e-31   Helobdella robusta
emb|CDS11961.1|  Putative COP9 signalosome complex subunit 5a           125   6e-31   Lichtheimia ramosa
gb|ADP30958.1|  COP9 constitutive photomorphogenic-like protein s...    125   6e-31   Penaeus monodon [giant tiger prawn]
gb|EPB91337.1|  COP9 signalosome complex subunit 5a                     124   9e-31   Mucor circinelloides f. circinelloides 1006PhL
gb|KJB65952.1|  hypothetical protein B456_010G123100                    124   9e-31   Gossypium raimondii
gb|KJB65950.1|  hypothetical protein B456_010G123100                    124   1e-30   Gossypium raimondii
ref|XP_008485715.1|  PREDICTED: COP9 signalosome complex subunit ...    124   2e-30   Diaphorina citri
ref|XP_008479869.1|  PREDICTED: COP9 signalosome complex subunit ...    124   2e-30   Diaphorina citri
ref|XP_004524029.1|  PREDICTED: COP9 signalosome complex subunit ...    124   2e-30   Ceratitis capitata [medfly]
dbj|GAM27607.1|  hypothetical protein SAMD00019534_107830               124   2e-30   Acytostelium subglobosum LB1
gb|ETN63713.1|  jun activation domain binding protein                   123   2e-30   Anopheles darlingi [American malaria mosquito]
ref|XP_011267966.1|  PREDICTED: COP9 signalosome complex subunit 5      123   2e-30   Camponotus floridanus
ref|XP_003399827.1|  PREDICTED: COP9 signalosome complex subunit ...    123   3e-30   Bombus terrestris [large earth bumblebee]
ref|XP_003399828.1|  PREDICTED: COP9 signalosome complex subunit ...    123   3e-30   
ref|XP_623836.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    123   4e-30   Apis mellifera [bee]
ref|XP_003486847.1|  PREDICTED: COP9 signalosome complex subunit ...    123   4e-30   Bombus impatiens
ref|XP_006565324.1|  PREDICTED: COP9 signalosome complex subunit ...    123   4e-30   Apis mellifera [bee]
ref|XP_003700698.1|  PREDICTED: COP9 signalosome complex subunit ...    122   4e-30   Megachile rotundata
ref|XP_011332242.1|  PREDICTED: COP9 signalosome complex subunit 5      122   5e-30   Ooceraea biroi
ref|XP_011147629.1|  PREDICTED: COP9 signalosome complex subunit ...    122   6e-30   Harpegnathos saltator
ref|XP_011147628.1|  PREDICTED: COP9 signalosome complex subunit ...    122   6e-30   
gb|EFN79117.1|  COP9 signalosome complex subunit 5                      122   7e-30   Harpegnathos saltator
ref|XP_011147627.1|  PREDICTED: COP9 signalosome complex subunit ...    122   8e-30   Harpegnathos saltator
ref|XP_011049626.1|  PREDICTED: COP9 signalosome complex subunit ...    122   1e-29   Acromyrmex echinatior
ref|XP_011049625.1|  PREDICTED: COP9 signalosome complex subunit ...    122   1e-29   Acromyrmex echinatior
ref|XP_011171452.1|  PREDICTED: COP9 signalosome complex subunit 5      122   1e-29   Solenopsis invicta [imported red fire ant]
ref|XP_005648133.1|  Mov34-domain-containing protein                    122   1e-29   Coccomyxa subellipsoidea C-169
ref|XP_011209192.1|  PREDICTED: COP9 signalosome complex subunit 5      121   1e-29   Bactrocera dorsalis [papaya fruit fly]
ref|XP_001862398.1|  COP9 signalosome complex subunit 5                 122   1e-29   Culex quinquefasciatus
ref|XP_011049624.1|  PREDICTED: COP9 signalosome complex subunit ...    122   1e-29   Acromyrmex echinatior
emb|CEP10016.1|  hypothetical protein                                   122   1e-29   Parasitella parasitica
ref|XP_008217721.1|  PREDICTED: COP9 signalosome complex subunit ...    121   2e-29   
ref|XP_008217730.1|  PREDICTED: COP9 signalosome complex subunit ...    121   2e-29   
ref|XP_011292660.1|  PREDICTED: COP9 signalosome complex subunit 5      120   2e-29   
ref|XP_001649479.1|  AAEL014747-PA                                      120   2e-29   
gb|KFB47242.1|  hypothetical protein ZHAS_00015265                      120   2e-29   
ref|XP_003424702.2|  PREDICTED: COP9 signalosome complex subunit ...    121   3e-29   
ref|XP_006675144.1|  hypothetical protein BATDEDRAFT_15731              120   3e-29   
gb|ESA08506.1|  hypothetical protein GLOINDRAFT_349082                  120   4e-29   
ref|XP_011182476.1|  PREDICTED: COP9 signalosome complex subunit 5      119   5e-29   
gb|EFA83038.1|  Mov34/MPN/PAD-1 family protein                          120   6e-29   
gb|KFH67419.1|  COP9 signalosome complex subunit 5                      119   7e-29   
ref|XP_002103175.1|  GD19103                                            119   9e-29   
gb|AAD28608.1|AF129083_1  COP9 signalosome subunit 5 CSN5               119   9e-29   
ref|NP_477442.1|  COP9 complex homolog subunit 5, isoform A             119   1e-28   
ref|XP_001980192.1|  GG17007                                            119   1e-28   
ref|XP_002074130.1|  GK14483                                            119   1e-28   
ref|XP_001359383.1|  GA13321                                            119   1e-28   
ref|NP_001262639.1|  COP9 complex homolog subunit 5, isoform B          118   1e-28   
gb|AAD27862.2|AF132563_1  LD14392p                                      119   1e-28   
ref|XP_001990340.1|  GH19288                                            118   1e-28   
ref|XP_010732391.1|  PREDICTED: COP9 signalosome complex subunit 5      118   1e-28   
ref|XP_002056387.1|  GJ10255                                            118   2e-28   
ref|XP_004047172.1|  PREDICTED: COP9 signalosome complex subunit 5      119   2e-28   
gb|AII16527.1|  COP9 signalosome complex subunit 5                      118   2e-28   
ref|XP_001998673.1|  GI23503                                            117   3e-28   
ref|XP_005066755.1|  PREDICTED: COP9 signalosome complex subunit 5      118   4e-28   
ref|XP_005851620.1|  hypothetical protein CHLNCDRAFT_19207              117   6e-28   
gb|KIZ06923.1|  COP9 signalosome complex subunit 5                      117   6e-28   
ref|XP_005722652.1|  PREDICTED: COP9 signalosome complex subunit ...    115   9e-28   
ref|XP_007554550.1|  PREDICTED: COP9 signalosome complex subunit 5      116   1e-27   
ref|XP_008394459.1|  PREDICTED: COP9 signalosome complex subunit 5      116   1e-27   
ref|XP_008305996.1|  PREDICTED: COP9 signalosome complex subunit 5      116   1e-27   
ref|XP_004081080.1|  PREDICTED: COP9 signalosome complex subunit 5      116   1e-27   
ref|XP_003967989.1|  PREDICTED: COP9 signalosome complex subunit ...    116   1e-27   
ref|XP_005797898.1|  PREDICTED: COP9 signalosome complex subunit ...    116   1e-27   
emb|CAG00664.1|  unnamed protein product                                116   1e-27   
emb|CBN81931.1|  COP9 signalosome complex subunit 5                     116   1e-27   
gb|ACO09632.1|  COP9 signalosome complex subunit 5                      116   1e-27   
ref|XP_003740357.1|  PREDICTED: COP9 signalosome complex subunit ...    115   2e-27   
ref|XP_006634059.1|  PREDICTED: COP9 signalosome complex subunit ...    115   2e-27   
ref|XP_003443502.1|  PREDICTED: COP9 signalosome complex subunit ...    115   2e-27   
ref|XP_007263567.1|  Mov34-domain-containing protein                    115   2e-27   
ref|XP_004363323.1|  constitutive photomorphogenic 9 complex chai...    115   3e-27   
ref|NP_001158520.1|  COP9 signalosome complex subunit 5                 114   5e-27   
ref|XP_010884175.1|  PREDICTED: COP9 signalosome complex subunit 5      114   5e-27   
ref|XP_312032.5|  AGAP002880-PA                                         114   5e-27   
ref|XP_002129245.1|  PREDICTED: COP9 signalosome complex subunit ...    114   7e-27   
ref|XP_002952633.1|  hypothetical protein VOLCADRAFT_81927              114   1e-26   
ref|XP_001954897.1|  GF18500                                            113   1e-26   
emb|CDY12502.1|  BnaC07g13420D                                          113   1e-26   
gb|EFX73885.1|  hypothetical protein DAPPUDRAFT_109433                  112   3e-26   
gb|EIE80444.1|  hypothetical protein RO3G_05149                         112   3e-26   
gb|ACI68431.1|  COP9 signalosome complex subunit 5                      111   7e-26   
ref|XP_001694818.1|  COP signalosome subunit 5                          110   8e-26   
ref|XP_002066624.1|  GK19363                                            105   1e-25   
ref|XP_005770092.1|  hypothetical protein EMIHUDRAFT_75732              110   2e-25   
emb|CEG78022.1|  Putative COP9 signalosome complex subunit 5a           110   2e-25   
gb|KIO05285.1|  hypothetical protein M404DRAFT_999877                   110   2e-25   
emb|CEG64164.1|  Putative COP9 signalosome complex subunit 5a           109   2e-25   
gb|KIM56673.1|  hypothetical protein SCLCIDRAFT_1220107                 109   3e-25   
gb|KIK24601.1|  hypothetical protein PISMIDRAFT_678215                  108   4e-25   
ref|XP_009552267.1|  Metallo peptidase M67A                             109   5e-25   
ref|XP_007337040.1|  Mov34-domain-containing protein                    107   2e-24   
ref|XP_007303304.1|  Mov34-domain-containing protein                    107   2e-24   
ref|XP_007394451.1|  hypothetical protein PHACADRAFT_253814             106   3e-24   
ref|XP_007867853.1|  Mov34-domain-containing protein                    106   3e-24   
gb|KJA26913.1|  hypothetical protein HYPSUDRAFT_36079                   106   4e-24   
emb|CAX73045.1|  COP9 complex homolog subunit 5                         102   8e-24   
gb|EYU29172.1|  hypothetical protein MIMGU_mgv1a0183042mg             99.0    1e-23   
gb|KIM42468.1|  hypothetical protein M413DRAFT_444883                   104   2e-23   
ref|XP_007313368.1|  hypothetical protein SERLADRAFT_456480             103   3e-23   
gb|KII84562.1|  hypothetical protein PLICRDRAFT_179381                  103   4e-23   
gb|KIK72494.1|  hypothetical protein PAXRUDRAFT_836440                  102   4e-23   
ref|XP_003384689.1|  PREDICTED: COP9 signalosome complex subunit ...    102   6e-23   
ref|XP_005833249.1|  hypothetical protein GUITHDRAFT_107880             102   1e-22   
emb|CCD78036.1|  Jab1/MPN domain metalloenzyme (M67 family)             102   1e-22   
gb|KDR72698.1|  hypothetical protein GALMADRAFT_252900                  102   1e-22   
ref|XP_006028872.1|  PREDICTED: COP9 signalosome complex subunit 5      101   1e-22   
gb|KGB40099.1|  COP9 signalosome complex subunit 5                      102   2e-22   
ref|XP_007383497.1|  Mov34-domain-containing protein                    101   2e-22   
gb|KIM86852.1|  hypothetical protein PILCRDRAFT_289786                  101   3e-22   
ref|XP_001839727.2|  jun coactivator Jab1                               101   3e-22   
gb|KIJ90495.1|  hypothetical protein K443DRAFT_686728                   101   3e-22   
dbj|GAA27173.1|  COP9 signalosome complex subunit 5                     101   3e-22   
emb|CCM01188.1|  predicted protein                                      100   3e-22   
gb|KIK40381.1|  hypothetical protein CY34DRAFT_807228                   101   3e-22   
ref|XP_006815652.1|  PREDICTED: COP9 signalosome complex subunit ...    100   4e-22   
ref|XP_010149546.1|  PREDICTED: COP9 signalosome complex subunit 5    99.8    4e-22   
emb|CDP99135.1|  Protein BM-CSN-5, isoform b                            100   5e-22   
emb|CDP99134.1|  Protein BM-CSN-5, isoform d                            100   6e-22   
gb|KFV92888.1|  COP9 signalosome complex subunit 5                    99.4    6e-22   
gb|EMC87035.1|  COP9 signalosome complex subunit 5                    99.4    6e-22   
ref|XP_006150523.1|  PREDICTED: COP9 signalosome complex subunit ...    100   6e-22   
ref|XP_005705078.1|  COP9 signalosome complex subunit 5               99.8    8e-22   
gb|KFQ67876.1|  COP9 signalosome complex subunit 5                    99.0    9e-22   
gb|KDQ08143.1|  hypothetical protein BOTBODRAFT_38129                 99.8    9e-22   
dbj|GAN00834.1|  COP9-signalosome 5B                                  99.8    1e-21   
dbj|BAD92371.1|  COP9 signalosome subunit 5 variant                   98.6    2e-21   
ref|XP_004842148.1|  PREDICTED: COP9 signalosome complex subunit ...  98.6    2e-21   
emb|CDJ85538.1|  Mov34 MPN PAD-1 domain containing protein            99.0    2e-21   
emb|CDJ96405.1|  Mov34 MPN PAD-1 domain containing protein            99.0    2e-21   
ref|XP_003029105.1|  hypothetical protein SCHCODRAFT_70193            98.6    2e-21   
gb|EPY74001.1|  COP9 signalosome complex subunit 5 isoform 1            100   3e-21   
gb|KIP09733.1|  hypothetical protein PHLGIDRAFT_18515                 98.2    4e-21   
gb|EPS97388.1|  hypothetical protein FOMPIDRAFT_1025013               97.8    5e-21   
gb|KIJ18085.1|  hypothetical protein PAXINDRAFT_167370                97.8    5e-21   
gb|KEH17814.1|  hypothetical protein MTR_8g006645                     94.4    6e-21   
ref|XP_007772746.1|  Mov34-domain-containing protein                  98.2    7e-21   
ref|XP_007363558.1|  Mov34-domain-containing protein                  97.4    7e-21   
gb|KDQ60418.1|  hypothetical protein JAAARDRAFT_32821                 97.4    8e-21   
ref|XP_002837843.1|  hypothetical protein                             97.1    8e-21   
ref|XP_001882520.1|  predicted protein                                97.1    8e-21   
gb|KDE08164.1|  COP9 signalosome complex subunit 5                    97.1    9e-21   
gb|KFO20318.1|  COP9 signalosome complex subunit 5                    99.0    1e-20   
ref|XP_007856350.1|  cop9 signalosome complex subunit 5               97.1    1e-20   
gb|EFO27045.2|  COP9 signalosome complex subunit 5                    96.7    1e-20   
ref|XP_006464013.1|  hypothetical protein AGABI2DRAFT_209023          96.7    1e-20   
ref|XP_007332426.1|  hypothetical protein AGABI1DRAFT_62649           96.7    1e-20   
ref|XP_003137030.1|  COP9 signalosome complex subunit 5               96.7    1e-20   
ref|XP_001940104.1|  COP9 signalosome complex subunit 5               96.7    1e-20   
gb|KDQ24552.1|  hypothetical protein PLEOSDRAFT_1094348               96.7    1e-20   
ref|XP_009162505.1|  hypothetical protein T265_00468                  99.8    1e-20   
ref|XP_007876876.1|  hypothetical protein PFL1_01182                  96.3    2e-20   
gb|KDD74343.1|  hypothetical protein H632_c1386p0                     95.5    2e-20   
emb|CDO75755.1|  hypothetical protein BN946_scf184921.g31             94.4    7e-20   
gb|EDL14299.1|  COP9 (constitutive photomorphogenic) homolog, sub...  92.8    1e-19   
gb|KIJ63800.1|  hypothetical protein HYDPIDRAFT_40823                 93.2    2e-19   
gb|KIL64761.1|  hypothetical protein M378DRAFT_77858                  93.2    2e-19   
ref|XP_003301972.1|  hypothetical protein PTT_13630                   92.8    3e-19   
gb|KHJ84222.1|  Mov34/MPN/PAD-1 family protein                        92.4    3e-19   
gb|EMD34840.1|  hypothetical protein CERSUDRAFT_117048                92.4    4e-19   
gb|ETN69927.1|  Mov34/MPN/PAD-1 family protein                        92.0    4e-19   
gb|KIK65834.1|  hypothetical protein GYMLUDRAFT_38312                 92.0    4e-19   
gb|EUC54240.1|  COP9 signalosome complex subunit 5                    92.0    5e-19   
ref|XP_008041270.1|  Mov34-domain-containing protein                  92.0    6e-19   
dbj|GAD91695.1|  COP9 signalosome complex subunit 5                   91.7    6e-19   
gb|KIN05013.1|  hypothetical protein OIDMADRAFT_142793                91.7    6e-19   
ref|XP_005712040.1|  unnamed protein product                          92.0    7e-19   
gb|KJB65954.1|  hypothetical protein B456_010G123100                  90.9    8e-19   
ref|XP_002114449.1|  hypothetical protein TRIADDRAFT_27810            91.3    9e-19   
ref|XP_011120074.1|  hypothetical protein AOL_s00054g456              91.3    1e-18   
gb|EZF23226.1|  COP9 signalosome complex subunit 5                    90.5    1e-18   
ref|XP_008022372.1|  hypothetical protein SETTUDRAFT_146496           90.9    1e-18   
gb|KIY49923.1|  Mov34-domain-containing protein                       91.3    1e-18   
ref|XP_008083662.1|  JAB1/MPN                                         90.5    1e-18   
gb|EJT99231.1|  Mov34-domain-containing protein                       90.9    2e-18   
ref|XP_001806244.1|  hypothetical protein SNOG_16117                  90.9    2e-18   
emb|CEL63357.1|  COP9 signalosome complex subunit 5                   90.9    2e-18   
ref|XP_003234683.1|  COP9 signalosome complex subunit 5               90.1    2e-18   
gb|EYC46046.1|  hypothetical protein Y032_0410g948                    90.5    2e-18   
gb|KIY62389.1|  Mov34-domain-containing protein                       90.5    2e-18   
gb|EYC46045.1|  hypothetical protein Y032_0410g948                    90.5    2e-18   
ref|XP_007674494.1|  hypothetical protein BAUCODRAFT_32485            89.4    4e-18   
gb|ERG87648.1|  cop9 signalosome complex subunit 5                    89.4    4e-18   
gb|EWC48220.1|  COP9 signalosome complex subunit 5                    89.4    4e-18   
ref|XP_011109554.1|  hypothetical protein H072_3584                   89.4    5e-18   
ref|XP_003170580.1|  COP9 signalosome complex subunit 5               89.0    5e-18   
ref|XP_010756604.1|  COP9 signalosome complex subunit 5               89.0    6e-18   
emb|CCO32282.1|  COP9 signalosome complex subunit 5                   91.3    8e-18   
emb|CCA72027.1|  probable COP9 signalosome subunit 5 CSN5             88.2    2e-17   
gb|KIO31911.1|  hypothetical protein M407DRAFT_14046                  88.6    2e-17   
gb|KIJ25292.1|  hypothetical protein M422DRAFT_785628                 88.2    2e-17   
ref|XP_007289754.1|  COP9 signalosome complex subunit 5               88.2    2e-17   
gb|KIJ37072.1|  hypothetical protein M422DRAFT_33926                  87.8    2e-17   
gb|ESZ94555.1|  COP9 signalosome complex subunit 5                    87.0    2e-17   
ref|XP_007923897.1|  CSN5 cop9 signalosome subunit 5                  87.4    2e-17   
ref|XP_003010514.1|  hypothetical protein ARB_03215                   87.0    3e-17   
ref|XP_003023342.1|  hypothetical protein TRV_02444                   87.0    3e-17   
ref|XP_001743582.1|  hypothetical protein                             87.0    3e-17   
gb|KIM33767.1|  hypothetical protein M408DRAFT_325370                 87.0    4e-17   
gb|EMF15575.1|  Mov34-domain-containing protein                       86.7    4e-17   
emb|CEF98127.1|  JAB/MPN domain                                       86.3    5e-17   
ref|XP_003079540.1|  COP9 signalosome, subunit CSN5 (ISS)             86.3    6e-17   
ref|XP_007779451.1|  COP9 signalosome complex subunit 5               85.9    6e-17   
ref|XP_001551965.1|  hypothetical protein BC1G_09577                  86.3    6e-17   
gb|EGD96904.1|  COP9 signalosome complex subunit 5                    85.5    9e-17   
gb|EPZ33258.1|  JAB1/Mov34/MPN/PAD-1 domain-containing protein        85.1    1e-16   
gb|EME47502.1|  hypothetical protein DOTSEDRAFT_69442                 85.5    1e-16   
ref|XP_002791463.1|  COP9 signalosome complex subunit 5               85.1    1e-16   
ref|XP_004773046.1|  PREDICTED: COP9 signalosome complex subunit 5    84.3    2e-16   
ref|XP_001595259.1|  hypothetical protein SS1G_03348                  84.7    2e-16   
ref|XP_008463225.1|  PREDICTED: COP9 signalosome complex subunit ...  80.5    2e-16   
ref|XP_002848322.1|  COP9 signalosome complex subunit 5               84.7    2e-16   
ref|XP_002678028.1|  jun kinase activation domain binding protein     84.3    2e-16   
gb|EGT56002.1|  hypothetical protein CAEBREN_15614                    84.3    3e-16   
gb|EGT48387.1|  hypothetical protein CAEBREN_22923                    84.3    3e-16   
ref|XP_007586662.1|  putative cop9 signalosome complex subunit 5 ...  83.6    5e-16   
gb|EHK48656.1|  hypothetical protein TRIATDRAFT_134074                83.2    6e-16   
gb|EMS21844.1|  COP9 signalosome complex subunit 5                    84.0    7e-16   
ref|XP_009267304.1|  COP9 signalosome complex subunit 5               83.2    8e-16   
gb|EGU11163.1|  COP9 signalosome complex subunit 5                    83.6    8e-16   
emb|CDY67262.1|  BnaCnng54150D                                        78.6    8e-16   
emb|CDJ03438.1|  COP9 signalosome complex subunit 5                   83.2    8e-16   
ref|XP_002584116.1|  COP9 signalosome complex subunit 5               82.8    8e-16   
gb|KFZ02747.1|  hypothetical protein V502_11539                       82.8    1e-15   
ref|XP_003089147.1|  hypothetical protein CRE_15192                   82.4    1e-15   
gb|KFH42515.1|  COP9 signalosome complex subunit-like protein         82.4    1e-15   
ref|XP_001239887.1|  hypothetical protein CIMG_09508                  82.4    1e-15   
ref|XP_003101399.1|  CRE-CSN-5 protein                                82.8    1e-15   
gb|EST07993.1|  hypothetical protein PSEUBRA_SCAF19g03258             82.8    1e-15   
gb|KIW33954.1|  hypothetical protein PV07_00765                       82.8    1e-15   
ref|XP_007839403.1|  COP9 signalosome complex subunit 5               82.4    1e-15   
gb|EEH04320.1|  COP9 signalosome complex subunit                      82.4    1e-15   
emb|CCX31218.1|  Similar to COP9 signalosome complex subunit 5; a...  82.0    1e-15   
ref|XP_002626520.1|  COP9 signalosome complex subunit 5               82.0    2e-15   
ref|XP_001538829.1|  COP9 signalosome complex subunit 5               82.0    2e-15   
ref|XP_006956806.1|  hypothetical protein WALSEDRAFT_59607            82.0    2e-15   
ref|XP_003067409.1|  COP9 signalosome complex subunit 5, putative     82.0    2e-15   
ref|XP_003056186.1|  predicted protein                                82.0    2e-15   
gb|EFW19686.1|  COP9 signalosome complex subunit 5                    82.0    2e-15   
ref|XP_007682348.1|  hypothetical protein COCMIDRAFT_31624            82.0    2e-15   
dbj|BAJ34223.1|  unnamed protein product                              81.3    2e-15   
ref|XP_007792821.1|  putative cop9 signalosome complex subunit 5 ...  81.6    2e-15   
ref|XP_007705204.1|  hypothetical protein COCSADRAFT_31162            82.0    2e-15   
ref|XP_007715257.1|  hypothetical protein COCCADRAFT_103980           82.0    2e-15   
ref|XP_001211499.1|  COP9 signalosome complex subunit 5               81.6    2e-15   
ref|NP_500841.1|  Protein CSN-5                                       82.0    2e-15   
ref|XP_007410237.1|  hypothetical protein MELLADRAFT_116525           82.0    2e-15   
gb|EMD90731.1|  hypothetical protein COCHEDRAFT_1022509               81.6    3e-15   
ref|XP_001397194.2|  COP9 signalosome complex subunit 5               81.3    3e-15   
gb|EKG20488.1|  Mov34/MPN/PAD-1                                       81.3    3e-15   
ref|XP_001275909.1|  COP9 signalosome subunit CsnE                    80.9    4e-15   



>emb|CBI37693.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  123  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  182

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  183  QAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  242

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRSRTE SGPEPM+ET
Sbjct  243  QSNRSRTEPSGPEPMIET  260



>ref|XP_002283561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Vitis vinifera]
Length=360

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  283  QAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  342

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRSRTE SGPEPM+ET
Sbjct  343  QSNRSRTEPSGPEPMIET  360



>gb|KHN16463.1| COP9 signalosome complex subunit 5b [Glycine soja]
Length=191

 Score =   239 bits (611),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  54   GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  113

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  114  QAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  173

Query  157  QSNRSRTESSGPEPMVET  104
            Q+NR+RTE SGPEPM+E+
Sbjct  174  QANRTRTEPSGPEPMIES  191



>gb|KDP33444.1| hypothetical protein JCGZ_07015 [Jatropha curcas]
Length=366

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  229  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  288

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  289  QAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  348

Query  157  QSNRSRTESSGPEPMVET  104
             S+RSRTE SGPEPMVE+
Sbjct  349  PSSRSRTEGSGPEPMVES  366



>ref|XP_009617619.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
tomentosiformis]
Length=367

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQLSHSRFGPL+AP QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  290  QAENQLSHSRFGPLMAPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  349

Query  157  QSNRSRTESSGPEPMVET  104
            QS +S+TE SGPEPM+ET
Sbjct  350  QSGKSQTEPSGPEPMIET  367



>ref|XP_002527960.1| jun activation domain binding protein, putative [Ricinus communis]
 gb|EEF34372.1| jun activation domain binding protein, putative [Ricinus communis]
Length=367

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP QRKKEEESQL KIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  290  QAENQLAHSRFGPLIAPPQRKKEEESQLTKITRDSAKITVEQVHGLMSQVIKDILFNSVR  349

Query  157  QSNRSRTESSGPEPMVET  104
            QS+RSR E SGPEPMVET
Sbjct  350  QSSRSRAEGSGPEPMVET  367



>gb|AFK33507.1| unknown [Medicago truncatula]
Length=210

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  73   GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  132

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  133  QAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  192

Query  157  QSNRSRTESSGPEPMVET  104
            Q+N+SRTE+S PEPM+E+
Sbjct  193  QANKSRTETSDPEPMIES  210



>ref|XP_010111938.1| COP9 signalosome complex subunit 5b [Morus notabilis]
 gb|EXC32056.1| COP9 signalosome complex subunit 5b [Morus notabilis]
Length=368

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  231  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  290

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  291  QAENQLAHSRFGPLIAPPQRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  350

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRS  E SGP+PM+E+
Sbjct  351  QSNRSHAEPSGPDPMIES  368



>emb|CDP18325.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  123  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  182

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+H+RFG ++AP QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFNTVR
Sbjct  183  QAENQLAHARFGHIMAPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNTVR  242

Query  157  QSNRSRTESSGPEPMVET  104
            QSN+S+T+SSGP+PMVET
Sbjct  243  QSNKSQTKSSGPDPMVET  260



>ref|XP_008445090.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Cucumis 
melo]
Length=365

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  228  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  287

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q ENQL+HSRFGPLIAP+QRKKEE+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  288  QVENQLAHSRFGPLIAPSQRKKEEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  347

Query  157  QSNRSRTESSGPEPMVET  104
            QSN+SR ESS PEPMVE+
Sbjct  348  QSNKSRPESSSPEPMVES  365



>ref|XP_009786152.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
sylvestris]
Length=367

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQLSHSRFGPL+AP QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  QAENQLSHSRFGPLMAPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVC  349

Query  157  QSNRSRTESSGPEPMVET  104
            QS +S+TE SGPEPM+ET
Sbjct  350  QSGKSQTEPSGPEPMIET  367



>ref|XP_003522659.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=374

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  237  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  296

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  297  QAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  356

Query  157  QSNRSRTESSGPEPMVET  104
            Q+NR+RTE+SGPEPM+E+
Sbjct  357  QANRTRTEASGPEPMIES  374



>ref|XP_004138765.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 ref|XP_004160845.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 gb|KGN62874.1| hypothetical protein Csa_2G378560 [Cucumis sativus]
Length=365

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  228  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  287

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q ENQL+HSRFGPLIAP+QRKKEE+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  288  QVENQLAHSRFGPLIAPSQRKKEEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  347

Query  157  QSNRSRTESSGPEPMVET  104
            Q N+SR ESS PEPMVE+
Sbjct  348  QPNKSRPESSSPEPMVES  365



>ref|XP_007137114.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
 gb|ESW09108.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
Length=374

 Score =   240 bits (613),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  237  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  296

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  297  QAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  356

Query  157  QSNRSRTESSGPEPMVET  104
            Q+NR+RTE SGPEPM+E+
Sbjct  357  QANRNRTEPSGPEPMIES  374



>ref|XP_003526451.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=375

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  238  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  297

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  298  QAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  357

Query  157  QSNRSRTESSGPEPMVET  104
            Q+NR+RTE SGPEPM+E+
Sbjct  358  QANRTRTEPSGPEPMIES  375



>ref|XP_004291259.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=359

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  222  GVHCKQYYSLDITYFKSCLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  281

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN LSHSRFGPL+ P QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V+
Sbjct  282  QAENHLSHSRFGPLVTPTQRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVQ  341

Query  157  QSNRSRTESSGPEPMVET  104
            QSN+S TE SGPEPM+E+
Sbjct  342  QSNKSNTEPSGPEPMIES  359



>ref|XP_002324396.1| COP9 complex family protein [Populus trichocarpa]
 gb|EEF02961.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 1/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQL+HSR GPL+AP QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  290  HAENQLAHSRLGPLMAP-QRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  348

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRSR E+SGPEPMVET
Sbjct  349  QSNRSRAETSGPEPMVET  366



>gb|ACJ84456.1| unknown [Medicago truncatula]
Length=357

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  220  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  280  QAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  339

Query  157  QSNRSRTESSGPEPMVET  104
            Q+N+SRTE+S PEPM+E+
Sbjct  340  QANKSRTETSDPEPMIES  357



>ref|XP_003603531.1| COP9 signalosome complex subunit 5b [Medicago truncatula]
 gb|AES73782.1| COP9 signalosome complex subunit 5 [Medicago truncatula]
Length=357

 Score =   238 bits (606),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  220  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  280  QAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  339

Query  157  QSNRSRTESSGPEPMVET  104
            Q+N+SRTE+S PEPM+E+
Sbjct  340  QANKSRTETSDPEPMIES  357



>gb|EYU29155.1| hypothetical protein MIMGU_mgv1a0088021mg, partial [Erythranthe 
guttata]
Length=226

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEK+E
Sbjct  89   GVHCKQYYSLDITYFKSGLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKIE  148

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QLSHSRFG LI   QRKKEEESQL KIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  149  QAESQLSHSRFGSLITAPQRKKEEESQLTKITRDSAKITVEQVHGLMSQVIKDILFNSVR  208

Query  157  QSNRSRTESSGPEPMVET  104
            QSN+S+ ESS PEPMVET
Sbjct  209  QSNKSQAESSSPEPMVET  226



>ref|XP_011031359.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=365

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 1/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  229  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  288

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQL+HSR GPL+ P QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  289  HAENQLAHSRLGPLMTP-QRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  347

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRS+TE SGPEPMVET
Sbjct  348  QSNRSQTEPSGPEPMVET  365



>gb|AAC26484.1| putative JUN kinase activation domain binding protein [Medicago 
sativa]
Length=357

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  220  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  280  QAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  339

Query  157  QSNRSRTESSGPEPMVET  104
            Q+N+S TE+S PEPM+E+
Sbjct  340  QANKSHTETSDPEPMIES  357



>ref|XP_004501247.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cicer arietinum]
Length=356

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 1/139 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  218  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFGPLIAP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  278  QAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  337

Query  157  QSNRSRTE-SSGPEPMVET  104
            Q+N+SRT+ +SGPEPM+E+
Sbjct  338  QANKSRTDTTSGPEPMIES  356



>ref|XP_011076561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Sesamum 
indicum]
Length=361

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDY AGQISDLAEK+E
Sbjct  224  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYFAGQISDLAEKIE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQLSHSRFG L+A  QRKKEEESQL KIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  284  QAENQLSHSRFGSLLAAPQRKKEEESQLTKITRDSAKITVEQVHGLMSQVIKDILFNSVR  343

Query  157  QSNRSRTESSGPEPMVET  104
            QSN+S+ ESSGPEPMVET
Sbjct  344  QSNKSQAESSGPEPMVET  361



>ref|XP_011045010.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=366

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 1/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQL+HSR GPL+AP QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  290  HAENQLAHSRLGPLMAP-QRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  348

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRSR E+S PEPMVET
Sbjct  349  QSNRSRAETSDPEPMVET  366



>ref|XP_011459046.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=360

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  222  GVHCKQYYSLDITYFKSCLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  281

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAEN LSHSRFGPL+ P QRKK+ EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V
Sbjct  282  QAENHLSHSRFGPLVTPTQRKKDQEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSV  341

Query  160  RQSNRSRTESSGPEPMVET  104
            +QSN+S TE SGPEPM+E+
Sbjct  342  QQSNKSNTEPSGPEPMIES  360



>ref|XP_010048447.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Eucalyptus 
grandis]
 gb|KCW80696.1| hypothetical protein EUGRSUZ_C02093 [Eucalyptus grandis]
Length=375

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  238  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  297

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+H+RFGPLIAP QRKKEE+SQL KIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  298  QAENQLAHTRFGPLIAPPQRKKEEDSQLTKITRDSAKITVEQVHGLMSQVIKDILFNSVR  357

Query  157  QSNRSRTESSGPEPMVET  104
            QS +S +E S PEPMVET
Sbjct  358  QSQKSCSEPSEPEPMVET  375



>ref|XP_007221779.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
 ref|XP_008219932.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Prunus mume]
 gb|EMJ22978.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
Length=366

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/143 (89%), Positives = 130/143 (91%), Gaps = 5/143 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  224  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN LSHSRFGPLI P QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  284  QAENHLSHSRFGPLITPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  343

Query  157  QSNR-----SRTESSGPEPMVET  104
            QSN+     S TE S PEPMVE+
Sbjct  344  QSNKSLTQPSLTEPSDPEPMVES  366



>ref|XP_006382165.1| COP9 complex family protein [Populus trichocarpa]
 gb|ERP59962.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 1/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQL+HSR GPL+ P QRKK+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  HAENQLAHSRLGPLMTP-QRKKDEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVH  348

Query  157  QSNRSRTESSGPEPMVET  104
            QSNRS+TE SGPEPMVET
Sbjct  349  QSNRSQTEPSGPEPMVET  366



>ref|XP_006351153.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   233 bits (593),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLD+TYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDVTYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL HSRFGPL+A  QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  QAENQLPHSRFGPLVAAPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVC  349

Query  157  QSNRSRTESSGPEPMVET  104
            QS +S+TE S PEPM+ET
Sbjct  350  QSGKSQTEPSDPEPMIET  367



>gb|KDO67280.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=360

 Score =   232 bits (592),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQLSHSR+GPLIAP  R+KEE+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  283  QAENQLSHSRYGPLIAPPPRRKEEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  342

Query  157  QSNRSRTESSGPEPMVET  104
            QS ++  E S PEPM+E+
Sbjct  343  QSTKTHAEPSDPEPMIES  360



>ref|XP_010259860.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nelumbo 
nucifera]
Length=363

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 130/141 (92%), Gaps = 3/141 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFG  I P+QRKKEEESQLAKIT DS+KITVEQVHGLMSQVIKDILFN+VR
Sbjct  283  QAENQLAHSRFGAFIFPSQRKKEEESQLAKITRDSSKITVEQVHGLMSQVIKDILFNSVR  342

Query  157  QSNRSR---TESSGPEPMVET  104
            QSNRSR   TE S PEPMVET
Sbjct  343  QSNRSRVVATEQSSPEPMVET  363



>ref|XP_009338826.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Pyrus x 
bretschneideri]
Length=367

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 6/144 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  224  GVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSRFGPLI P QRK+EEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  284  QAENHLAHSRFGPLITPPQRKREEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  343

Query  157  QSNRSRTE------SSGPEPMVET  104
            QSNRS  +      SS PEPMVE+
Sbjct  344  QSNRSLLQPSLTEPSSDPEPMVES  367



>ref|XP_008378244.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=367

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 6/144 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  224  GVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSRFGPLI P QRK+EEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  284  QAENHLAHSRFGPLITPPQRKREEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  343

Query  157  QSNRSRTE------SSGPEPMVET  104
            QSNRS  +      SS PEPMVE+
Sbjct  344  QSNRSLLQPSLTEPSSDPEPMVES  367



>ref|XP_008393958.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=376

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 6/144 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  224  GVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSRFGPLI P QRK+EEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  284  QAENHLAHSRFGPLITPPQRKREEESQLAKITHDSAKITVEQVHGLMSQVIKDILFNSVR  343

Query  157  QSNRSRTE------SSGPEPMVET  104
            QSNRS  +      SS PEPMVE+
Sbjct  344  QSNRSLLQPSLTEPSSDPEPMVES  367



>ref|XP_006450165.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483570.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Citrus sinensis]
 gb|ESR63405.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=360

 Score =   229 bits (585),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQLSHSR+GPLIAP  R+KEE+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  283  QAENQLSHSRYGPLIAPPPRRKEEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  342

Query  157  QSNRSRTESSGPEPMVET  104
            QS ++    S PEPM+E+
Sbjct  343  QSTKTHAGPSDPEPMIES  360



>ref|XP_004241422.1| PREDICTED: COP9 signalosome complex subunit 5b [Solanum lycopersicum]
Length=367

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD  LLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCRLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQLS+SR+  L+AP QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  HAENQLSNSRYASLMAPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVG  349

Query  157  QSNRSRTESSGPEPMVET  104
            +S++S+TESSGPEPM+E+
Sbjct  350  KSSKSQTESSGPEPMIES  367



>gb|KDO67279.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=361

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V
Sbjct  283  QAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSV  342

Query  160  RQSNRSRTESSGPEPMVET  104
            RQS ++  E S PEPM+E+
Sbjct  343  RQSTKTHAEPSDPEPMIES  361



>ref|XP_006347307.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQLS+SR+  L+AP QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  HAENQLSNSRYASLMAPPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVG  349

Query  157  QSNRSRTESSGPEPMVET  104
            +S++S+TE SGPEPM+E+
Sbjct  350  KSSKSQTEPSGPEPMIES  367



>emb|CBL87025.1| CSN5 protein [Solanum lycopersicum]
Length=367

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q EN LSHSRFG L+A  QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  QGENHLSHSRFGHLVAAPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVC  349

Query  157  QSNRSRTESSGPEPMVET  104
            +S +S+TE S PEPMVET
Sbjct  350  KSGKSQTEPSDPEPMVET  367



>ref|XP_011082082.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Sesamum indicum]
Length=357

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEK+E
Sbjct  220  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKIE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSRFG LI    RKKEEESQL KIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  280  QAENQLAHSRFGSLIGGPLRKKEEESQLTKITRDSAKITVEQVHGLMSQVIKDILFNSVR  339

Query  157  QSNRSRTESSGPEPMVET  104
            QSN SR   SGPEPMVE 
Sbjct  340  QSNGSRANLSGPEPMVEA  357



>ref|XP_006450164.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483569.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Citrus sinensis]
 gb|ESR63404.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=361

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V
Sbjct  283  QAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSV  342

Query  160  RQSNRSRTESSGPEPMVET  104
            RQS ++    S PEPM+E+
Sbjct  343  RQSTKTHAGPSDPEPMIES  361



>gb|KHG19604.1| COP9 signalosome complex subunit 5b -like protein [Gossypium 
arboreum]
 gb|KJB55191.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=352

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P ++K +EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  276  QAENQLAHSRIGPL-GPPRKKLQEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  334

Query  157  QSNRSRTESSGPEPMVET  104
            QS+RS+ + SGPEPM+ET
Sbjct  335  QSSRSQNDQSGPEPMIET  352



>ref|NP_001234331.1| JAB [Solanum lycopersicum]
 gb|AAG43411.1| JAB [Solanum lycopersicum]
Length=367

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLL NGDYVAGQISDLAEK+E
Sbjct  230  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLENGDYVAGQISDLAEKME  289

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN LSHSRFG L+A  QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V 
Sbjct  290  QAENHLSHSRFGHLVAAPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVC  349

Query  157  QSNRSRTESSGPEPMVET  104
            +S +S+TE S PEPMVET
Sbjct  350  KSGKSQTEPSDPEPMVET  367



>ref|XP_010477567.1| PREDICTED: COP9 signalosome complex subunit 5b [Camelina sativa]
Length=358

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  338

Query  163  VRQSNRSRTESSGPEPMV  110
             RQSN+  +E+S PEPM+
Sbjct  339  ARQSNKPPSEASDPEPMI  356



>gb|KJB55192.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=350

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P   +K+EESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  276  QAENQLAHSRIGPLGPP---RKKEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  332

Query  157  QSNRSRTESSGPEPMVET  104
            QS+RS+ + SGPEPM+ET
Sbjct  333  QSSRSQNDQSGPEPMIET  350



>ref|XP_007011590.1| COP9-signalosome 5B [Theobroma cacao]
 gb|EOY29209.1| COP9-signalosome 5B [Theobroma cacao]
Length=351

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLG+GDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGSGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P  RKKEEESQLAKIT DSAKITVEQV GLMSQVIKDILFN+VR
Sbjct  276  QAENQLAHSRIGPLGPP--RKKEEESQLAKITRDSAKITVEQVDGLMSQVIKDILFNSVR  333

Query  157  QSNRSRTESSGPEPMVET  104
            QSNR R + SGPEPMVE 
Sbjct  334  QSNRCRNDHSGPEPMVEA  351



>gb|AAO41956.1| putative c-JUN coactivator protein AJH1 [Arabidopsis thaliana]
Length=139

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 128/140 (91%), Gaps = 3/140 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  1    GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  60

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  61   QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  119

Query  163  VRQSNRSRTESSGPEPMVET  104
             RQS +S  +SS PEPM+ +
Sbjct  120  ARQSKKSADDSSDPEPMITS  139



>ref|XP_010669282.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  238  GVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  297

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQ++H+RFG +I P+QRKKEEE  LAKIT DS KITVEQVHGLMSQVIKDILFN+VR
Sbjct  298  QAENQMAHTRFGSIITPSQRKKEEEPALAKITRDSTKITVEQVHGLMSQVIKDILFNSVR  357

Query  157  QSNRSRTESSGPEPMVE  107
              +R + ESS PEPMVE
Sbjct  358  -PDRCQAESSEPEPMVE  373



>ref|XP_010551182.1| PREDICTED: COP9 signalosome complex subunit 5b [Tarenaya hassleriana]
Length=357

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAENQL+HSR G ++ A  Q+KKE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+V
Sbjct  279  QAENQLAHSRIGGIVPATLQKKKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSV  338

Query  160  RQSNRSRTESSGPEPMV  110
            RQSNRS  +SSG +PMV
Sbjct  339  RQSNRSGNDSSGSDPMV  355



>ref|XP_006305189.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
 gb|EOA38087.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
Length=357

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QLSHS+FG L APA  QR+KE+ESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLSHSKFGSL-APAGFQRRKEDESQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  337

Query  163  VRQSNRSRTESSGPEPMV  110
             RQSN+  ++ S PEPM+
Sbjct  338  SRQSNKPSSDPSDPEPMI  355



>ref|XP_002893252.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69511.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 127/138 (92%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QL+HSRFG  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLTHSRFGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  337

Query  163  VRQSNRSRTESSGPEPMV  110
             RQS +S  +SS PEPM+
Sbjct  338  ARQSKKSPNDSSDPEPMI  355



>gb|ABK24758.1| unknown [Picea sitchensis]
Length=363

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE
Sbjct  223  GVHCKHYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLE  282

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QL+HSR G  + P QRKKEEESQLAKIT DS+KITVEQVHGLMSQVIKDILFN+V 
Sbjct  283  QAESQLAHSRVGSFLVPPQRKKEEESQLAKITKDSSKITVEQVHGLMSQVIKDILFNSVH  342

Query  157  QSNRSRT---ESSGPEPMVET  104
            QS +S     E SGPEPMVET
Sbjct  343  QSTKSGIAFGEGSGPEPMVET  363



>gb|KJB55195.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=346

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 124/138 (90%), Gaps = 7/138 (5%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P  RKK     LAKIT DSAKITVEQVHGLMSQVIKDILFN+VR
Sbjct  276  QAENQLAHSRIGPLGPP--RKK-----LAKITRDSAKITVEQVHGLMSQVIKDILFNSVR  328

Query  157  QSNRSRTESSGPEPMVET  104
            QS+RS+ + SGPEPM+ET
Sbjct  329  QSSRSQNDQSGPEPMIET  346



>ref|XP_009115580.1| PREDICTED: COP9 signalosome complex subunit 5b [Brassica rapa]
 emb|CDY21400.1| BnaA09g30270D [Brassica napus]
 emb|CDY04768.1| BnaC05g18210D [Brassica napus]
Length=356

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QL+HSRFG + A   RKKE+E  LAKIT DSAKITVEQVHGLMSQVIKDILFN+ R
Sbjct  279  QAESQLAHSRFGGIPASLHRKKEDEPPLAKITRDSAKITVEQVHGLMSQVIKDILFNSAR  338

Query  157  QSNRSRTESSGPEPMV  110
            QS+++ ++ S PEPM+
Sbjct  339  QSDKTPSDPSDPEPMI  354



>gb|AAM65053.1| putative JUN kinase activator protein [Arabidopsis thaliana]
Length=357

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  337

Query  163  VRQSNRSRTESSGPEPMV  110
             RQS +S  +SS PEPM+
Sbjct  338  ARQSKKSADDSSDPEPMI  355



>ref|NP_173705.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 sp|Q8LAZ7.2|CSN5B_ARATH RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome 
subunit 5b; AltName: Full=Jun activation domain-binding 
homolog 1 [Arabidopsis thaliana]
 gb|AAL58105.1|AF395062_1 CSN complex subunit 5B [Arabidopsis thaliana]
 gb|AAB72159.1| unknown [Arabidopsis thaliana]
 gb|AAB96974.1| JAB1 [Arabidopsis thaliana]
 gb|ABL66743.1| At1g22920 [Arabidopsis thaliana]
 gb|AEE30309.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=357

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  337

Query  163  VRQSNRSRTESSGPEPMV  110
             RQS +S  +SS PEPM+
Sbjct  338  ARQSKKSADDSSDPEPMI  355



>ref|XP_009420301.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKS+LDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE
Sbjct  227  GVHCKQYYALDITYFKSALDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLE  286

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAENQL+H+R G  + P+QRKKE EESQLAKIT DS+KITVEQVHGLMSQVIKDILFN+V
Sbjct  287  QAENQLAHTRLGSFLLPSQRKKEPEESQLAKITRDSSKITVEQVHGLMSQVIKDILFNSV  346

Query  160  RQSN---RSRTESSGPEPMVET  104
              ++    S T+SSGPEPMVE+
Sbjct  347  HHTSCIPPSLTDSSGPEPMVES  368



>ref|XP_002887356.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63615.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSR G + +   RKKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFN++R
Sbjct  279  QAENHLAHSRGGIVPSSLHRKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSIR  338

Query  157  QS-NRSRTESSGPEPMV  110
            QS N+S T+SS PEPM+
Sbjct  339  QSNNKSSTDSSDPEPMI  355



>ref|XP_010914180.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Elaeis guineensis]
Length=360

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN DY+AGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNRDYIAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             AENQL+H+R+G  + P+QRKKE EESQLAK T DS+KITVEQVHGLMSQVIKDILFNTV
Sbjct  279  HAENQLAHTRWGSFLLPSQRKKENEESQLAKTTRDSSKITVEQVHGLMSQVIKDILFNTV  338

Query  160  RQSNR---SRTESSGPEPMVE  107
            R S+    S ++SSGPEPMVE
Sbjct  339  RHSSSTCPSLSDSSGPEPMVE  359



>ref|XP_010498782.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Camelina 
sativa]
Length=360

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 2/126 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  221  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  280

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  281  QAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  340

Query  163  VRQSNR  146
             RQSN+
Sbjct  341  ARQSNK  346



>ref|XP_010460061.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Camelina sativa]
 ref|XP_010460063.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Camelina sativa]
Length=358

 Score =   209 bits (532),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 2/126 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  338

Query  163  VRQSNR  146
             RQSN+
Sbjct  339  ARQSNK  344



>ref|XP_010929274.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Elaeis guineensis]
Length=360

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN +YVAGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNREYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             AENQL+H+R G  + P+QRKKE EESQLAK T DS+KITVEQVHGLMSQVIKDILFN+V
Sbjct  279  HAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDSSKITVEQVHGLMSQVIKDILFNSV  338

Query  160  RQSNRSR---TESSGPEPMVE  107
            R S+ +R   ++SSGPEPM+E
Sbjct  339  RHSSSARGSLSDSSGPEPMIE  359



>gb|KFK41544.1| hypothetical protein AALP_AA2G143000 [Arabis alpina]
Length=357

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ LSHSRFG   + +  RKKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFN+V
Sbjct  279  QAESHLSHSRFGGSASSSLHRKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSV  338

Query  160  RQSNRSRTESSGPEPMV  110
             +SN+S T+SS P+PM+
Sbjct  339  HESNKSPTDSSDPQPMI  355



>ref|XP_008810007.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=360

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             AENQL+H+R G  + P+QRKKE EESQLAK T DS++ITVEQVHGLMSQVIKDILFN+V
Sbjct  279  HAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDSSRITVEQVHGLMSQVIKDILFNSV  338

Query  160  RQSNRSR---TESSGPEPMVE  107
            R S+ +R   ++S GPEPMVE
Sbjct  339  RHSSSTRASLSDSFGPEPMVE  359



>ref|XP_008804896.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=200

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 124/140 (89%), Gaps = 3/140 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE
Sbjct  60   GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLE  119

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
             AENQL+H+R G  + P+QRK+ EESQLAK T DS+KITVEQVHGLMSQVIKDILFNTVR
Sbjct  120  HAENQLAHTRLGSFLLPSQRKENEESQLAKTTRDSSKITVEQVHGLMSQVIKDILFNTVR  179

Query  157  Q---SNRSRTESSGPEPMVE  107
                ++ S ++SSGPEPMVE
Sbjct  180  HSSSTSPSLSDSSGPEPMVE  199



>gb|AAC36344.1| AJH1 [Arabidopsis thaliana]
Length=357

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 3/138 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLL NKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLGNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct  279  QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS  337

Query  163  VRQSNRSRTESSGPEPMV  110
             RQS +S  +SS PEPM+
Sbjct  338  ARQSKKSADDSSDPEPMI  355



>gb|KFK44380.1| hypothetical protein AALP_AA1G249900 [Arabis alpina]
Length=353

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 2/136 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  218  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE QLSHSR  P  +  QR+KE+ESQL KIT DS+KITVEQVHGLMSQVIKDILFN+ R
Sbjct  278  QAEGQLSHSRQMP--STLQRRKEDESQLTKITRDSSKITVEQVHGLMSQVIKDILFNSSR  335

Query  157  QSNRSRTESSGPEPMV  110
            QSN+  +++S PEPM+
Sbjct  336  QSNKPPSDASDPEPMI  351



>ref|XP_006845674.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
 gb|ERN07349.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
Length=364

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLL N DYVAGQISDLAEKLE
Sbjct  224  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLANRDYVAGQISDLAEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN LSHSR G  + P  RKKE++SQLAKIT DS+KITVEQVHGLMSQVIKD LFN+V 
Sbjct  284  QAENHLSHSRMGSFLVPPLRKKEDDSQLAKITRDSSKITVEQVHGLMSQVIKDTLFNSVH  343

Query  157  QSNRS---RTESSGPEPMVET  104
            Q++R     T+ S PEPMVET
Sbjct  344  QASRMLPILTDLSDPEPMVET  364



>gb|EAZ32248.1| hypothetical protein OsJ_16452 [Oryza sativa Japonica Group]
Length=288

 Score =   202 bits (513),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 5/141 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  148  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  207

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  208  QAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  266

Query  160  RQSNRSRT---ESSGPEPMVE  107
              SN++ T   +SSGPEPMVE
Sbjct  267  HPSNKASTSAPDSSGPEPMVE  287



>ref|XP_004960128.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Setaria 
italica]
Length=361

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  220  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSRFG ++ P+QRKKE +ES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  280  QAEGQLAHSRFGGMLMPSQRKKEQDESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  339

Query  160  RQSNRSRT---ESSGPEPMVET  104
              S+++ T   +SSGPEPMVE 
Sbjct  340  HPSSKASTSAPDSSGPEPMVEA  361



>ref|XP_006416142.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
 dbj|BAJ34114.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34495.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
Length=355

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  218  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QL+HSRFG + A  QRKKE+ES LAKIT DSAKITVEQVHGLMSQVIKDILFN+ R
Sbjct  278  QAESQLAHSRFGGIPATLQRKKEDESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSPR  337

Query  157  QSNR  146
            +SN+
Sbjct  338  ESNK  341



>ref|NP_001054112.1| Os04g0654700 [Oryza sativa Japonica Group]
 gb|AAC33765.1| jab1 protein [Oryza sativa Indica Group]
 dbj|BAB72093.1| JUN-activation-domain-binding protein homolog [Oryza sativa]
 dbj|BAC22747.1| JUN-activation-domain-binding protein 1 [Oryza sativa Japonica 
Group]
 emb|CAE01552.2| OSJNBb0022F16.7 [Oryza sativa Japonica Group]
 dbj|BAF16026.1| Os04g0654700 [Oryza sativa Japonica Group]
 emb|CAH66701.1| OSIGBa0147J19.5 [Oryza sativa Indica Group]
Length=360

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 5/142 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  220  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  280  QAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  338

Query  160  RQSNRSRT---ESSGPEPMVET  104
              SN++ T   +SSGPEPMVE 
Sbjct  339  HPSNKASTSAPDSSGPEPMVEA  360



>gb|EEC78160.1| hypothetical protein OsI_17724 [Oryza sativa Indica Group]
Length=385

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 5/142 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  245  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  304

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  305  QAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  363

Query  160  RQSNRSRT---ESSGPEPMVET  104
              SN++ T   +SSGPEPMVE 
Sbjct  364  HPSNKASTSAPDSSGPEPMVEA  385



>emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa Japonica Group]
Length=377

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 5/142 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  237  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  296

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  297  QAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  355

Query  160  RQSNRSRT---ESSGPEPMVET  104
              SN++ T   +SSGPEPMVE 
Sbjct  356  HPSNKASTSAPDSSGPEPMVEA  377



>ref|XP_010415831.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=358

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L+HSRFG ++  +  RKKE+E+QL KIT DS+KITVEQVHGLMSQVIKD+LFN+V
Sbjct  279  QAESHLNHSRFGGIVPSSLHRKKEDETQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSV  338

Query  160  RQS-NRSRTESSGPEPMV  110
            RQS N+S  + S  EPM+
Sbjct  339  RQSNNKSPNDLSDTEPMI  356



>ref|XP_006652935.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Oryza brachyantha]
Length=362

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 5/142 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  222  GVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  281

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  282  QAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  340

Query  160  RQSNRSRT---ESSGPEPMVET  104
              SN++ T   +SSGPEPMVE 
Sbjct  341  HPSNKAGTSAPDSSGPEPMVEA  362



>ref|NP_177279.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
 sp|Q9FVU9.1|CSN5A_ARATH RecName: Full=COP9 signalosome complex subunit 5a; Short=Signalosome 
subunit 5a; AltName: Full=Jun activation domain-binding 
homolog 2 [Arabidopsis thaliana]
 gb|AAG51882.1|AC016162_3 c-Jun coactivator-like protein (AJH2); 90304-88609 [Arabidopsis 
thaliana]
 gb|AAL06468.1|AF411778_1 At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AAL58104.1|AF395061_1 CSN complex subunit 5A [Arabidopsis thaliana]
 gb|AAM70525.1| At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AEE35176.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
Length=358

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLD+TYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L  SRFG ++  +  +KKE+ESQL KIT DSAKITVEQVHGLMSQVIKD LFN++
Sbjct  279  QAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSM  338

Query  160  RQS-NRSRTESSGPEPMV  110
            RQS N+S T+SS P+PM+
Sbjct  339  RQSNNKSPTDSSDPDPMI  356



>gb|AAC36343.1| AJH2 [Arabidopsis thaliana]
Length=358

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLD+TYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L  SRFG ++  +  +KKE+ESQL KIT DSAKITVEQVHGLMSQVIKD LFN++
Sbjct  279  QAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSM  338

Query  160  RQS-NRSRTESSGPEPMV  110
            RQS N+S T+SS P+PM+
Sbjct  339  RQSNNKSPTDSSDPDPMI  356



>ref|XP_010471135.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X1 [Camelina 
sativa]
 ref|XP_010471136.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X2 [Camelina 
sativa]
Length=358

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLG+GDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGSGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L+HSRFG ++  +  +KKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFNTV
Sbjct  279  QAESHLNHSRFGGIVPSSLHKKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNTV  338

Query  160  RQS-NRSRTESSGPEPMV  110
            RQS N+S  + S  EPM+
Sbjct  339  RQSNNKSPNDLSDTEPMI  356



>ref|NP_001149650.1| COP9 signalosome complex subunit 5b [Zea mays]
 gb|ACF85802.1| unknown [Zea mays]
 gb|ACG36237.1| COP9 signalosome complex subunit 5b [Zea mays]
 tpg|DAA35638.1| TPA: COP9 signalosome complex subunit 5b [Zea mays]
Length=362

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YY+LDITYFKSSLDSHLLDLLWNKYWVNTLSSS LLGN DYVAGQI DLA+KLE
Sbjct  220  GVHCKSYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSSLLGNRDYVAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSRFG +I P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  280  QAEGQLAHSRFGGMIMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  339

Query  160  RQSNRSRT----ESSGPEPMVET  104
              S+++ T    +SSGPEPMVE 
Sbjct  340  HPSSKASTSAPPDSSGPEPMVEA  362



>ref|XP_006302454.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
 gb|EOA35352.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
Length=358

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L+HSRFG ++  +  RKKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFN++
Sbjct  279  QAESHLNHSRFGGIVPSSLHRKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSL  338

Query  160  RQS-NRSRTESSGPEPMV  110
             QS N+S  +SS  EPM+
Sbjct  339  PQSNNKSPHDSSDTEPMI  356



>ref|XP_010427950.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=357

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLG+ DYVAGQISDLAEKLE
Sbjct  218  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGSADYVAGQISDLAEKLE  277

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L+HSRFG ++  +  RKKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFN+V
Sbjct  278  QAESHLNHSRFGGIVPSSLHRKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSV  337

Query  160  RQS-NRSRTESSGPEPMV  110
            RQS N+S  E S  EPM+
Sbjct  338  RQSNNKSPNELSDTEPMI  355



>ref|XP_010240543.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brachypodium 
distachyon]
Length=360

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY LDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  220  GVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE QL+HSRFG L++  ++K+ E+S LAK+T DS+KIT EQVHGLMSQVIKDILFN+V 
Sbjct  280  QAEGQLAHSRFGMLMSSQRKKEPEDSPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSVH  339

Query  157  QSNRSRT---ESSGPEPMVET  104
             S+++ T   ES  PEPMVET
Sbjct  340  PSSKASTSAPESPVPEPMVET  360



>ref|XP_001775449.1| predicted protein [Physcomitrella patens]
 gb|EDQ59778.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 12/149 (8%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVH KQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQ++DLAEKLE
Sbjct  223  GVHYKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQVADLAEKLE  282

Query  337  QAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+QL+HS R G    P Q+KKEEESQLAKI+ DS+KITVEQ+HGLMSQVIKD LFN+V
Sbjct  283  QAESQLAHSGRMGGFFMPVQKKKEEESQLAKISRDSSKITVEQLHGLMSQVIKDTLFNSV  342

Query  160  RQSNRS-----------RTESSGPEPMVE  107
              S+ +            T+SSGPEPMVE
Sbjct  343  MSSSNAPVAMSAETSIVATDSSGPEPMVE  371



>gb|EMS48301.1| COP9 signalosome complex subunit 5b [Triticum urartu]
Length=335

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 9/146 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  191  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  250

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSRFG ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  251  QAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  309

Query  160  RQSNRSRTESSG-------PEPMVET  104
              S++S+  +SG       PEPMVE 
Sbjct  310  HPSSKSKASASGTAPDSPVPEPMVEA  335



>gb|EMT09486.1| hypothetical protein F775_29820 [Aegilops tauschii]
Length=364

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 9/146 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DY+AGQI DLA+KLE
Sbjct  220  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYIAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSRFG ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  280  QAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  338

Query  160  RQSNRSRTESSG-------PEPMVET  104
              S++S+  +SG       PEPMVE 
Sbjct  339  HPSSKSKASASGTAPDSPVPEPMVEA  364



>dbj|BAJ93853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99562.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 122/146 (84%), Gaps = 9/146 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGN DYVAGQI DLA+KLE
Sbjct  220  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QL+HSRFG ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V
Sbjct  280  QAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSV  338

Query  160  R-------QSNRSRTESSGPEPMVET  104
                     ++ +  +S  PEPMVE 
Sbjct  339  HPSSKSKASASGAAPDSPVPEPMVEA  364



>ref|XP_001752249.1| predicted protein [Physcomitrella patens]
 gb|EDQ82982.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 121/149 (81%), Gaps = 12/149 (8%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVH KQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLL N DYVAGQ++DLAEKLE
Sbjct  223  GVHYKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLANRDYVAGQVADLAEKLE  282

Query  337  QAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+QL+HS R G    P Q+KKEEESQLAKI+ DS+KITVEQ+HGLMSQVIK+ LFN V
Sbjct  283  QAESQLAHSGRMGGFFMPVQKKKEEESQLAKISRDSSKITVEQLHGLMSQVIKNTLFNVV  342

Query  160  -----------RQSNRSRTESSGPEPMVE  107
                        ++  S T+SSGPEPMVE
Sbjct  343  TSSASASAAASAETPTSATDSSGPEPMVE  371



>emb|CDY25761.1| BnaA07g10210D [Brassica napus]
Length=356

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKL+
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLD  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QL  S FG   A   +KK++E  LAKIT DSAKIT+EQVHGLMSQVIKDILFN+ R
Sbjct  279  QAESQLVQSWFGGKKASLHKKKKDELPLAKITRDSAKITIEQVHGLMSQVIKDILFNSPR  338

Query  157  QSNRSRTESSGPEPMV  110
            QS+++ ++ + PEPM+
Sbjct  339  QSDKTPSDPTDPEPMI  354



>ref|XP_002961002.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
 gb|EFJ38541.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
Length=361

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 119/145 (82%), Gaps = 8/145 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDL-----  353
            GVHCKQYY LDITYFKSSLDSHLLDLLWNKYW+NTLSSSPLLG+ DYVAGQISDL     
Sbjct  216  GVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWLNTLSSSPLLGSRDYVAGQISDLGNSTH  275

Query  352  -AEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKD  179
             AEKLEQ E QL+HS R G    P+Q+KKEEESQLAKIT DS+KITVEQVHGLMSQVIKD
Sbjct  276  AAEKLEQTETQLAHSGRMGGFFMPSQKKKEEESQLAKITKDSSKITVEQVHGLMSQVIKD  335

Query  178  ILFNTVRQ-SNRSRTESSGPEPMVE  107
            ILFN+V   +     +SSGPEPM E
Sbjct  336  ILFNSVTPVATAPSFDSSGPEPMAE  360



>ref|XP_002967006.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
 gb|EFJ31605.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
Length=373

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 119/145 (82%), Gaps = 8/145 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDL-----  353
            GVHCKQYY LDITYFKSSLDSHLLDLLWNKYW+NTLSSSPLLG+ DYVAGQISDL     
Sbjct  228  GVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWLNTLSSSPLLGSRDYVAGQISDLGNSTH  287

Query  352  -AEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKD  179
             AEKLEQ E QL+HS R G    P+Q+KKEEESQLAKIT DS+KITVEQVHGLMSQVIKD
Sbjct  288  AAEKLEQTETQLAHSGRMGGFFMPSQKKKEEESQLAKITKDSSKITVEQVHGLMSQVIKD  347

Query  178  ILFNTVRQ-SNRSRTESSGPEPMVE  107
            ILFN+V   +     +SSGPEPM E
Sbjct  348  ILFNSVTPVATAPSFDSSGPEPMAE  372



>ref|XP_006450163.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 gb|ESR63403.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=337

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 105/139 (76%), Gaps = 25/139 (18%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQY                        WVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  223  GVHCKQY------------------------WVNTLSSSPLLGNGDYVAGQISDLAEKLE  258

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V
Sbjct  259  QAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDSAKITVEQVHGLMSQVIKDILFNSV  318

Query  160  RQSNRSRTESSGPEPMVET  104
            RQS ++    S PEPM+E+
Sbjct  319  RQSTKTHAGPSDPEPMIES  337



>gb|KJB65951.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=335

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 109/122 (89%), Gaps = 3/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+ITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQ+SDLAEKLE
Sbjct  216  GVHCKQYYALNITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQLSDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSR GPL      +K+EES L KIT DS+KITVEQ HGLMSQVIKDILFN+VR
Sbjct  276  QAENHLTHSRIGPL---GTSRKKEESHLGKITRDSSKITVEQAHGLMSQVIKDILFNSVR  332

Query  157  QS  152
            QS
Sbjct  333  QS  334



>ref|XP_009103210.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brassica 
rapa]
Length=356

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKL+
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLD  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE+QL  S FG   A   +KK++E  LAKIT DSAKIT+EQVHGLMSQVIKDILF + R
Sbjct  279  QAESQLVQSWFGGKKASLHKKKKDELPLAKITRDSAKITIEQVHGLMSQVIKDILFISAR  338

Query  157  QSNRSRTESSGPEPMV  110
            QS+++ ++ + PEPM+
Sbjct  339  QSDKTPSDPTDPEPMI  354



>gb|KHG22386.1| COP9 signalosome complex subunit 5a -like protein [Gossypium 
arboreum]
Length=335

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 3/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+I+YFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQ+SDLAEKLE
Sbjct  216  GVHCKQYYALNISYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQLSDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAEN L+HSR GPL      +K+EES L KIT DS+KITVEQ HGLMSQVIKDILFN+VR
Sbjct  276  QAENHLTHSRIGPL---GTSRKKEESHLGKITRDSSKITVEQAHGLMSQVIKDILFNSVR  332

Query  157  QS  152
            QS
Sbjct  333  QS  334



>ref|XP_006390791.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
 gb|ESQ28077.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
Length=352

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLD+TYFKSSLDSHLLDLLW+KYWVNTLSSSPLLGNGDYVAGQI DLAEKLE
Sbjct  214  GVHCKQYYSLDVTYFKSSLDSHLLDLLWSKYWVNTLSSSPLLGNGDYVAGQILDLAEKLE  273

Query  337  QAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+ L+HSRFG  +  +  RKKE+ESQL KIT DS+KITVEQVHGLMSQVIKD+LFN+V
Sbjct  274  QAESHLAHSRFGGSVPSSLHRKKEDESQLTKITRDSSKITVEQVHGLMSQVIKDVLFNSV  333

Query  160  RQSNRSRTESSGPEPMV  110
             QS++S ++SS  EPMV
Sbjct  334  SQSSKSPSDSSDLEPMV  350



>gb|KJB55194.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=333

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 107/120 (89%), Gaps = 3/120 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P ++K +EESQLAKIT DSAKITVEQVHGLMSQV   +LF   R
Sbjct  276  QAENQLAHSRIGPL-GPPRKKLQEESQLAKITRDSAKITVEQVHGLMSQVT--LLFQIFR  332



>ref|NP_973890.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 gb|AEE30310.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=351

 Score =   175 bits (443),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 107/114 (94%), Gaps = 3/114 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  219  GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIK  182
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQV K
Sbjct  279  QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVSK  331



>ref|XP_010929275.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Elaeis guineensis]
Length=339

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN +YVAGQISDLAEKLE
Sbjct  219  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNREYVAGQISDLAEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIK  182
             AENQL+H+R G  + P+QRKKE EESQLAK T DS+KITVEQVHGLMSQ  +
Sbjct  279  HAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDSSKITVEQVHGLMSQCTR  331



>gb|KJB55196.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=324

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 103/138 (75%), Gaps = 29/138 (21%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAENQL+HSR GPL  P  RKK                           VIKDILFN+VR
Sbjct  276  QAENQLAHSRIGPLGPP--RKK---------------------------VIKDILFNSVR  306

Query  157  QSNRSRTESSGPEPMVET  104
            QS+RS+ + SGPEPM+ET
Sbjct  307  QSSRSQNDQSGPEPMIET  324



>ref|XP_004353437.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
 gb|ELR23909.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
Length=342

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY L+++YFKSSLDS LLDLLWNKYWVNTLSSSPLL N DY AG I DL+EKLE
Sbjct  213  GVHCKQYYPLEVSYFKSSLDSQLLDLLWNKYWVNTLSSSPLLANRDYFAGAIHDLSEKLE  272

Query  337  QAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE QLSHS R G  +AP   KK+EESQLAK+T DS K T+EQVHGLM+QV+KDILFN  
Sbjct  273  QAETQLSHSGRMGGYLAP--EKKKEESQLAKLTKDSTKTTIEQVHGLMAQVMKDILFNI-  329

Query  160  RQSNRSRT  137
               N+S T
Sbjct  330  ---NKSET  334



>ref|XP_638491.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 sp|Q54PF3.1|CSN5_DICDI RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Dictyostelium discoideum]
 gb|EAL65137.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 gb|ABC46697.1| COP9 signalosome complex subunit 5 [Dictyostelium discoideum]
Length=332

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%), Gaps = 5/117 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+ITYFKSSLD  LLD LWNKYWVNTLSSSP+  N DY+ GQI+DL+EKLE
Sbjct  214  GVHCKQYYSLEITYFKSSLDQQLLDKLWNKYWVNTLSSSPIFSNRDYITGQINDLSEKLE  273

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFN  167
            QAE QLSHSR   L      KK+EES L+K++ DS+K+T+EQV G+MSQV K+ +FN
Sbjct  274  QAETQLSHSRSSIL-----DKKKEESLLSKVSKDSSKVTIEQVQGIMSQVFKNSIFN  325



>ref|XP_003292126.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
 gb|EGC31350.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
Length=332

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 4/117 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+I+YFKSSLD  LLD LWNKYWVNTLSSSP+  N +Y+ GQI+DL+EKLE
Sbjct  213  GVHCKQYYSLEISYFKSSLDQQLLDKLWNKYWVNTLSSSPIFSNREYITGQINDLSEKLE  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFN  167
            QAE QLS++R   L      KK+EES L+KI+ DS+K+T+EQV G+MSQV K+ +FN
Sbjct  273  QAETQLSNTRSAAL----SDKKKEESLLSKISKDSSKVTIEQVQGIMSQVFKNSIFN  325



>ref|XP_011082083.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Sesamum indicum]
Length=318

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEK+E
Sbjct  220  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKIE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITC  239
            QAENQL+HSRFG LI    RKKE  S     TC
Sbjct  280  QAENQLAHSRFGSLIGGPLRKKEAVSPFKNFTC  312



>gb|AAL82571.1| Jun activation domain binding protein [Homo sapiens]
Length=179

 Score =   134 bits (337),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  60   GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  119

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  120  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  177

Query  157  QS  152
             S
Sbjct  178  IS  179



>gb|KFP72154.1| COP9 signalosome complex subunit 5, partial [Acanthisitta chloris]
Length=196

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  77   GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  136

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  137  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  193



>ref|XP_009074279.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Acanthisitta 
chloris]
Length=195

 Score =   134 bits (337),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  76   GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  135

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  136  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  192



>ref|XP_007248979.1| PREDICTED: COP9 signalosome complex subunit 5 [Astyanax mexicanus]
Length=336

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN V 
Sbjct  275  QAEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQVN  332

Query  157  QS  152
             S
Sbjct  333  TS  334



>ref|XP_009866049.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Apaloderma 
vittatum]
 ref|XP_009916306.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Haliaeetus 
albicilla]
 ref|XP_010071814.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Pterocles 
gutturalis]
 gb|KFP47606.1| COP9 signalosome complex subunit 5, partial [Cathartes aura]
 gb|KFP87179.1| COP9 signalosome complex subunit 5, partial [Apaloderma vittatum]
 gb|KFP94092.1| COP9 signalosome complex subunit 5, partial [Haliaeetus albicilla]
 gb|KFV06934.1| COP9 signalosome complex subunit 5, partial [Pterocles gutturalis]
Length=208

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  89   GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  148

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  149  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  205



>ref|XP_007885057.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Callorhinchus 
milii]
Length=272

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>ref|XP_009491803.1| PREDICTED: COP9 signalosome complex subunit 5 [Pelecanus crispus]
Length=270

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>ref|NP_957019.1| COP9 signalosome complex subunit 5 [Danio rerio]
 sp|Q6PC30.1|CSN5_DANRE RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Danio rerio]
 gb|AAH59493.1| COP9 constitutive photomorphogenic homolog subunit 5 [Danio rerio]
Length=334

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  213  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QAE QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN V 
Sbjct  273  QAEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQVN  330

Query  157  QS  152
             S
Sbjct  331  TS  332



>ref|XP_009512046.1| PREDICTED: COP9 signalosome complex subunit 5 [Phalacrocorax 
carbo]
Length=257

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  138  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  197

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  198  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  254



>ref|XP_009569185.1| PREDICTED: COP9 signalosome complex subunit 5 [Cuculus canorus]
Length=270

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFW95881.1| COP9 signalosome complex subunit 5, partial [Phalacrocorax carbo]
Length=260

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  141  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  200

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  201  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  257



>ref|XP_005019397.1| PREDICTED: COP9 signalosome complex subunit 5 [Anas platyrhynchos]
 ref|XP_005240980.1| PREDICTED: COP9 signalosome complex subunit 5 [Falco peregrinus]
 ref|XP_005443255.1| PREDICTED: COP9 signalosome complex subunit 5 [Falco cherrug]
 ref|XP_005423092.1| PREDICTED: COP9 signalosome complex subunit 5 [Geospiza fortis]
 ref|XP_005506521.1| PREDICTED: COP9 signalosome complex subunit 5 [Columba livia]
 ref|XP_008499986.1| PREDICTED: COP9 signalosome complex subunit 5 [Calypte anna]
 ref|XP_008630179.1| PREDICTED: COP9 signalosome complex subunit 5 [Corvus brachyrhynchos]
 ref|XP_008930421.1| PREDICTED: COP9 signalosome complex subunit 5 [Manacus vitellinus]
 ref|XP_008936970.1| PREDICTED: COP9 signalosome complex subunit 5 [Merops nubicus]
 ref|XP_009469926.1| PREDICTED: COP9 signalosome complex subunit 5 [Nipponia nippon]
 ref|XP_009666687.1| PREDICTED: COP9 signalosome complex subunit 5 [Struthio camelus 
australis]
 ref|XP_009632806.1| PREDICTED: COP9 signalosome complex subunit 5 [Egretta garzetta]
 ref|XP_009694490.1| PREDICTED: COP9 signalosome complex subunit 5 [Cariama cristata]
 ref|XP_009902390.1| PREDICTED: COP9 signalosome complex subunit 5 [Picoides pubescens]
 ref|XP_009938798.1| PREDICTED: COP9 signalosome complex subunit 5 [Opisthocomus hoazin]
 ref|XP_010020192.1| PREDICTED: COP9 signalosome complex subunit 5 [Nestor notabilis]
 ref|XP_009978044.1| PREDICTED: COP9 signalosome complex subunit 5 [Tauraco erythrolophus]
 ref|XP_009993861.1| PREDICTED: COP9 signalosome complex subunit 5 [Chaetura pelagica]
 ref|XP_010166906.1| PREDICTED: COP9 signalosome complex subunit 5 [Caprimulgus carolinensis]
 ref|XP_010183940.1| PREDICTED: COP9 signalosome complex subunit 5 [Mesitornis unicolor]
 ref|XP_010208428.1| PREDICTED: COP9 signalosome complex subunit 5 [Colius striatus]
 ref|XP_010213773.1| PREDICTED: COP9 signalosome complex subunit 5 [Tinamus guttatus]
 ref|XP_010301016.1| PREDICTED: COP9 signalosome complex subunit 5 [Balearica regulorum 
gibbericeps]
 ref|XP_010403428.1| PREDICTED: COP9 signalosome complex subunit 5 [Corvus cornix 
cornix]
 ref|XP_003205144.2| PREDICTED: COP9 signalosome complex subunit 5 [Meleagris gallopavo]
Length=270

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>ref|XP_010134433.1| PREDICTED: COP9 signalosome complex subunit 5 [Buceros rhinoceros 
silvestris]
Length=269

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  150  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  209

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  210  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  266



>ref|XP_001636625.1| predicted protein [Nematostella vectensis]
 gb|EDO44562.1| predicted protein [Nematostella vectensis]
Length=333

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSSLD  LLD+LWNKYWVNTLSSS LL N DY   QI+DL+EKLE
Sbjct  212  GVHCKQYYSLEVSYFKSSLDRKLLDMLWNKYWVNTLSSSSLLTNADYTNHQIADLSEKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            QAE+Q+   R G  +A  + +K +E +LAK+T DS+K  +E VHGLMSQVIK+ LFN V
Sbjct  272  QAESQV--GRMGTFVAGMEERK-DEGKLAKVTRDSSKSAIEAVHGLMSQVIKNRLFNQV  327



>ref|XP_009883867.1| PREDICTED: COP9 signalosome complex subunit 5 [Charadrius vociferus]
Length=270

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--ILGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFQ58471.1| COP9 signalosome complex subunit 5, partial [Pelecanus crispus]
Length=286

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  167  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  226

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  227  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  283



>gb|KFV70073.1| COP9 signalosome complex subunit 5, partial [Picoides pubescens]
Length=283

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  164  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  223

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  224  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  280



>ref|XP_004637626.1| PREDICTED: COP9 signalosome complex subunit 5 [Octodon degus]
Length=232

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  113  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  172

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  173  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  229



>gb|KFR15387.1| COP9 signalosome complex subunit 5, partial [Opisthocomus hoazin]
Length=288

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  169  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  228

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  229  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  285



>ref|XP_004697588.1| PREDICTED: COP9 signalosome complex subunit 5 [Echinops telfairi]
 ref|XP_004814146.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Mustela 
putorius furo]
 ref|XP_005008312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Cavia 
porcellus]
 ref|XP_005008313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Cavia 
porcellus]
 ref|XP_005392182.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005563539.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Macaca 
fascicularis]
 ref|XP_005563540.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Macaca 
fascicularis]
 ref|XP_005613142.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Equus 
caballus]
 ref|XP_005977668.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pantholops 
hodgsonii]
 ref|XP_008253842.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_008524910.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Equus 
przewalskii]
 ref|XP_008565070.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X4 [Galeopterus 
variegatus]
 ref|XP_008704974.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Ursus 
maritimus]
 ref|XP_008980989.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Callithrix 
jacchus]
 ref|XP_009211404.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009211405.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009211406.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009453745.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pan 
troglodytes]
 ref|XP_009453746.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pan 
troglodytes]
 ref|XP_010329035.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Saimiri 
boliviensis boliviensis]
 ref|XP_010810335.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Bos 
taurus]
 ref|XP_010987377.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Camelus 
dromedarius]
 ref|XP_011219514.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Ailuropoda 
melanoleuca]
 ref|XP_011289667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Felis 
catus]
 ref|XP_011362918.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pteropus 
vampyrus]
Length=270

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  211  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  268

Query  157  QS  152
             S
Sbjct  269  IS  270



>gb|EOB01530.1| COP9 signalosome complex subunit 5, partial [Anas platyrhynchos]
Length=291

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  172  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  231

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  232  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  288



>gb|KFO04966.1| COP9 signalosome complex subunit 5, partial [Balearica regulorum 
gibbericeps]
 gb|KFO53023.1| COP9 signalosome complex subunit 5, partial [Corvus brachyrhynchos]
 gb|KFP06973.1| COP9 signalosome complex subunit 5, partial [Calypte anna]
 gb|KFP28656.1| COP9 signalosome complex subunit 5, partial [Colius striatus]
 gb|KFP60727.1| COP9 signalosome complex subunit 5, partial [Cariama cristata]
 gb|KFQ18281.1| COP9 signalosome complex subunit 5, partial [Merops nubicus]
 gb|KFQ74801.1| COP9 signalosome complex subunit 5, partial [Phoenicopterus ruber 
ruber]
 gb|KGL77824.1| COP9 signalosome complex subunit 5, partial [Tinamus guttatus]
Length=286

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  167  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  226

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  227  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  283



>gb|AET43978.1| COP9 signalosome subunit 5, partial [Reishia clavigera]
Length=334

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YYSL+I+YFKSS+D  LLD LWNKYWVNTLSSS LL N DY  GQI+DLA+KLE
Sbjct  209  GVHCKNYYSLEISYFKSSMDRRLLDSLWNKYWVNTLSSSSLLTNADYTTGQINDLAQKLE  268

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E+QL   R G ++    + K+ E +L+K T D  K T+E +HGLMSQVIKD LFN V 
Sbjct  269  QSESQL--GRGGFMLGMDTQDKKTEDKLSKATKDGCKTTIEAIHGLMSQVIKDRLFNQVH  326

Query  157  QS  152
             S
Sbjct  327  CS  328



>ref|XP_008852995.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Nannospalax 
galili]
Length=270

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFR04453.1| COP9 signalosome complex subunit 5, partial [Nipponia nippon]
Length=291

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  172  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  231

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  232  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  288



>gb|KFZ45477.1| COP9 signalosome complex subunit 5, partial [Caprimulgus carolinensis]
Length=292

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  173  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  232

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  233  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  289



>gb|KFO89731.1| COP9 signalosome complex subunit 5, partial [Buceros rhinoceros 
silvestris]
Length=291

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  172  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  231

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  232  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  288



>gb|KFO71148.1| COP9 signalosome complex subunit 5, partial [Cuculus canorus]
Length=291

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  172  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  231

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  232  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  288



>ref|XP_005042220.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Ficedula 
albicollis]
Length=291

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  172  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  231

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  232  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  288



>ref|XP_006006855.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Latimeria 
chalumnae]
Length=334

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQI DL+EKLE
Sbjct  213  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQIFDLSEKLE  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  273  QSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  330

Query  157  QSN  149
             S+
Sbjct  331  TSS  333



>gb|ELU08061.1| hypothetical protein CAPTEDRAFT_163387 [Capitella teleta]
Length=275

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSS D  LL+ LWNKYWVNTLSSS LL N DY  GQ+ DLA+KLE
Sbjct  151  GVHCKQYYSLEVSYFKSSFDRRLLESLWNKYWVNTLSSSSLLTNADYTTGQVFDLADKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F   + P ++K E+  +LAK T D  K T+E +HGLMSQVIKD LFN V
Sbjct  211  QSEAQLGRGGFILGMDPHEKKSED--KLAKATKDGCKNTIEAIHGLMSQVIKDKLFNQV  267



>gb|KFV78011.1| COP9 signalosome complex subunit 5, partial [Struthio camelus 
australis]
Length=294

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  175  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  234

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  235  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  291



>gb|KGL93740.1| COP9 signalosome complex subunit 5, partial [Charadrius vociferus]
Length=286

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  167  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  226

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  227  QSEAQLGRGSF--ILGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  283



>ref|NP_989109.1| COP9 signalosome complex subunit 5 [Xenopus (Silurana) tropicalis]
 sp|Q6P635.1|CSN5_XENTR RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus (Silurana) tropicalis]
 gb|AAH62499.1| COP9 signalosome subunit 5 [Xenopus (Silurana) tropicalis]
 emb|CAJ82897.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Xenopus (Silurana) tropicalis]
Length=334

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>gb|KFP12389.1| COP9 signalosome complex subunit 5, partial [Egretta garzetta]
 gb|KFQ23265.1| COP9 signalosome complex subunit 5, partial [Mesitornis unicolor]
 gb|KFQ43634.1| COP9 signalosome complex subunit 5, partial [Nestor notabilis]
 gb|KFV11049.1| COP9 signalosome complex subunit 5, partial [Tauraco erythrolophus]
Length=292

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  173  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  232

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  233  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  289



>gb|KFU88065.1| COP9 signalosome complex subunit 5, partial [Chaetura pelagica]
Length=292

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  173  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  232

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  233  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  289



>gb|KFZ51066.1| COP9 signalosome complex subunit 5, partial [Podiceps cristatus]
Length=294

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  175  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  234

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  235  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  291



>ref|XP_009957073.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Leptosomus 
discolor]
Length=305

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  186  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  245

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  246  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  302



>ref|XP_008565069.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Galeopterus 
variegatus]
Length=307

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  188  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  247

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  248  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  305

Query  157  QS  152
             S
Sbjct  306  IS  307



>ref|XP_006860136.1| PREDICTED: COP9 signalosome complex subunit 5 [Chrysochloris 
asiatica]
Length=307

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQI DL+EKLE
Sbjct  188  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQIFDLSEKLE  247

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  248  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  305

Query  157  QS  152
             S
Sbjct  306  IS  307



>ref|XP_005392181.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Chinchilla 
lanigera]
Length=293

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  174  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  233

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  234  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  291

Query  157  QS  152
             S
Sbjct  292  IS  293



>ref|XP_009453744.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pan 
troglodytes]
Length=288

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  169  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  228

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  229  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  286

Query  157  QS  152
             S
Sbjct  287  IS  288



>gb|KFW88042.1| COP9 signalosome complex subunit 5, partial [Manacus vitellinus]
Length=310

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  191  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  250

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  251  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  307



>ref|XP_005517166.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005517167.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pseudopodoces 
humilis]
Length=339

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQI DL+EKLE
Sbjct  220  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQIFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  280  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_007885051.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callorhinchus 
milii]
Length=336

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_009083868.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Serinus 
canaria]
Length=317

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  198  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  257

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  258  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  314



>ref|XP_005150844.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Melopsittacus 
undulatus]
Length=317

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  198  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  257

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  258  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  314



>ref|XP_009333319.1| PREDICTED: COP9 signalosome complex subunit 5 [Pygoscelis adeliae]
Length=270

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  151  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  210

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  211  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  267



>ref|XP_010574205.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Haliaeetus 
leucocephalus]
Length=318

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  199  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  258

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  259  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  315



>ref|XP_009575600.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Fulmarus 
glacialis]
Length=261

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  142  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  201

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  202  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  258



>gb|KFW04486.1| COP9 signalosome complex subunit 5, partial [Fulmarus glacialis]
Length=262

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  143  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  202

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  203  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  259



>ref|XP_009957065.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Leptosomus 
discolor]
Length=327

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  208  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  267

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  268  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  324



>gb|AAX37104.1| COP9 constitutive photomorphogenic-like subunit 5 [synthetic 
construct]
Length=335

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QSN  149
             S+
Sbjct  333  ISD  335



>gb|AAD03468.1| 38 kDa Mov34 homolog [Homo sapiens]
Length=334

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_008173762.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Chrysemys 
picta bellii]
Length=319

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  200  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  259

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  260  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  316



>gb|KFP96001.1| COP9 signalosome complex subunit 5, partial [Leptosomus discolor]
Length=337

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  278  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_006131546.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pelodiscus 
sinensis]
Length=319

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  200  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  259

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  260  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  316



>ref|XP_006090662.1| PREDICTED: COP9 signalosome complex subunit 5 [Myotis lucifugus]
Length=336

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  217  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  276

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  277  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  334

Query  157  QS  152
             S
Sbjct  335  VS  336



>ref|XP_535093.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Canis 
lupus familiaris]
 ref|XP_004653361.1| PREDICTED: COP9 signalosome complex subunit 5 [Jaculus jaculus]
 ref|XP_005638087.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Canis 
lupus familiaris]
 ref|XP_007947907.1| PREDICTED: COP9 signalosome complex subunit 5 [Orycteropus afer 
afer]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  VS  334



>ref|XP_005866406.1| PREDICTED: COP9 signalosome complex subunit 5 [Myotis brandtii]
 gb|EPQ07861.1| COP9 signalosome complex subunit 5 [Myotis brandtii]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  VS  334



>ref|NP_001034400.1| COP9 signalosome complex subunit 5 [Gallus gallus]
 emb|CAG31470.1| hypothetical protein RCJMB04_6l21 [Gallus gallus]
Length=338

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  219  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  279  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  335



>ref|NP_001232700.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
 gb|ACH44179.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
Length=339

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  220  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  280  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_009083861.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Serinus 
canaria]
Length=339

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  220  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  280  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_005150843.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005479411.1| PREDICTED: COP9 signalosome complex subunit 5 [Zonotrichia albicollis]
 gb|ACH46430.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
Length=339

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  220  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  280  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_011448116.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Crassostrea 
gigas]
 gb|EKC21935.1| COP9 signalosome complex subunit 5 [Crassostrea gigas]
Length=332

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YYSLD++YFKS  D  LL+ LWNKYWVNTLSSS LL N DY  GQI DLA+KLE
Sbjct  212  GVHCKHYYSLDMSYFKSVADRKLLESLWNKYWVNTLSSSSLLTNADYTTGQIFDLADKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL   R G ++     +K+ E +LAK T D  K T+E +HGLMSQVIKD LFN V 
Sbjct  272  QSEVQL--CRGGFMLGMDTHEKKSEDKLAKATKDGCKTTMEAIHGLMSQVIKDRLFNQVH  329

Query  157  QS  152
             +
Sbjct  330  TT  331



>ref|XP_010574204.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Haliaeetus 
leucocephalus]
Length=340

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  221  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  280

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  281  QSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  337



>ref|XP_003831400.1| PREDICTED: COP9 signalosome complex subunit 5 [Pan paniscus]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_006237820.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Rattus 
norvegicus]
Length=317

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  198  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  257

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  258  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  314



>ref|NP_006828.2| COP9 signalosome complex subunit 5 [Homo sapiens]
 ref|NP_001247609.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 ref|XP_001162723.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pan 
troglodytes]
 ref|XP_002710500.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_002759014.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callithrix 
jacchus]
 ref|XP_002916425.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003274847.1| PREDICTED: COP9 signalosome complex subunit 5 [Nomascus leucogenys]
 ref|XP_003480111.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cavia 
porcellus]
 ref|XP_002819198.2| PREDICTED: COP9 signalosome complex subunit 5 [Pongo abelii]
 ref|XP_003797297.1| PREDICTED: COP9 signalosome complex subunit 5 [Otolemur garnettii]
 ref|XP_003942946.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_003999915.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Felis 
catus]
 ref|XP_004275000.1| PREDICTED: COP9 signalosome complex subunit 5 [Orcinus orca]
 ref|XP_004310611.1| PREDICTED: COP9 signalosome complex subunit 5 [Tursiops truncatus]
 ref|XP_004372600.1| PREDICTED: COP9 signalosome complex subunit 5 [Trichechus manatus 
latirostris]
 ref|XP_004402339.1| PREDICTED: COP9 signalosome complex subunit 5 [Odobenus rosmarus 
divergens]
 ref|XP_004436312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004436313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004481161.1| PREDICTED: COP9 signalosome complex subunit 5 [Dasypus novemcinctus]
 ref|XP_004814145.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_005322997.1| PREDICTED: COP9 signalosome complex subunit 5 [Ictidomys tridecemlineatus]
 ref|XP_005392180.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005563538.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Macaca 
fascicularis]
 ref|XP_006193800.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus ferus]
 ref|XP_006204770.1| PREDICTED: COP9 signalosome complex subunit 5 [Vicugna pacos]
 ref|XP_006150522.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Tupaia 
chinensis]
 ref|XP_006880503.1| PREDICTED: COP9 signalosome complex subunit 5 [Elephantulus edwardii]
 ref|XP_006924076.1| PREDICTED: COP9 signalosome complex subunit 5 [Pteropus alecto]
 ref|XP_007080736.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007130932.1| PREDICTED: COP9 signalosome complex subunit 5 [Physeter catodon]
 ref|XP_007185082.1| PREDICTED: COP9 signalosome complex subunit 5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448551.1| PREDICTED: COP9 signalosome complex subunit 5 [Lipotes vexillifer]
 ref|XP_007998988.1| PREDICTED: COP9 signalosome complex subunit 5 [Chlorocebus sabaeus]
 ref|XP_008565068.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008704972.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ursus 
maritimus]
 ref|XP_009211402.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_009211403.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_010369895.1| PREDICTED: COP9 signalosome complex subunit 5 [Rhinopithecus 
roxellana]
 ref|XP_010609774.1| PREDICTED: COP9 signalosome complex subunit 5 [Fukomys damarensis]
 ref|XP_010968931.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus bactrianus]
 ref|XP_010987306.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Camelus 
dromedarius]
 ref|XP_011362917.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pteropus 
vampyrus]
 sp|Q92905.4|CSN5_HUMAN RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1 [Homo sapiens]
 pdb|4D10|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D10|M Chain M, Crystal Structure Of The Cop9 Signalosome
 gb|AAH01187.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH01859.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH07272.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 emb|CAG46479.1| COPS5 [Homo sapiens]
 gb|EAW86928.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86929.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86931.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 dbj|BAG73052.1| COP9 constitutive photomorphogenic homolog subunit 5 [synthetic 
construct]
 gb|EFB14348.1| hypothetical protein PANDA_004498 [Ailuropoda melanoleuca]
 gb|ADZ15656.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[synthetic construct]
 gb|EHH28550.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 gb|EHH64214.1| COP9 signalosome complex subunit 5 [Macaca fascicularis]
 gb|AFV41219.1| c-Jun activation domain binding protein-1 [Sus scrofa]
 gb|ELK02355.1| COP9 signalosome complex subunit 5 [Pteropus alecto]
 gb|AIC50780.1| COPS5, partial [synthetic construct]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>gb|KFW63060.1| COP9 signalosome complex subunit 5, partial [Pygoscelis adeliae]
Length=286

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  167  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  226

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  227  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  283



>ref|XP_004679877.1| PREDICTED: COP9 signalosome complex subunit 5 [Condylura cristata]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_001494265.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Equus 
caballus]
 ref|XP_008524909.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Equus 
przewalskii]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|NP_001179068.1| COP9 signalosome complex subunit 5 [Bos taurus]
 ref|XP_004011770.1| PREDICTED: COP9 signalosome complex subunit 5 [Ovis aries]
 ref|XP_005689095.1| PREDICTED: COP9 signalosome complex subunit 5 [Capra hircus]
 ref|XP_005892993.1| PREDICTED: COP9 signalosome complex subunit 5 [Bos mutus]
 ref|XP_005977667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_010846758.1| PREDICTED: COP9 signalosome complex subunit 5 [Bison bison bison]
 tpg|DAA22731.1| TPA: COP9 signalosome subunit 5-like [Bos taurus]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|NP_001264030.1| COP9 signalosome complex subunit 5 isoform 2 [Mus musculus]
Length=317

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  198  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  257

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  258  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  314



>gb|ELR58372.1| COP9 signalosome complex subunit 5, partial [Bos mutus]
Length=337

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  278  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  335

Query  157  QS  152
             S
Sbjct  336  IS  337



>gb|AAB16847.1| Jun activation domain binding protein [Homo sapiens]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|NP_001098770.1| COP9 signalosome complex subunit 5 [Sus scrofa]
 gb|ABR13016.1| COP9 constitutive photomorphogenic-like subunit 5 [Sus scrofa]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>gb|AAP36860.1| Homo sapiens COP9 constitutive photomorphogenic homolog subunit 
5 (Arabidopsis) [synthetic construct]
 gb|AAX29363.1| COP9 constitutive photomorphogenic-like subunit 5, partial [synthetic 
construct]
Length=335

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_001512862.1| PREDICTED: COP9 signalosome complex subunit 5 [Ornithorhynchus 
anatinus]
Length=334

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_006131545.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pelodiscus 
sinensis]
Length=337

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  278  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_001368118.1| PREDICTED: COP9 signalosome complex subunit 5 [Monodelphis domestica]
 ref|XP_003759773.1| PREDICTED: COP9 signalosome complex subunit 5 [Sarcophilus harrisii]
 ref|XP_004878903.1| PREDICTED: COP9 signalosome complex subunit 5 [Heterocephalus 
glaber]
 gb|EHA99341.1| COP9 signalosome complex subunit 5 [Heterocephalus glaber]
Length=334

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_008704973.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Ursus 
maritimus]
Length=325

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  206  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  265

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  266  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  323

Query  157  QS  152
             S
Sbjct  324  IS  325



>ref|XP_005311431.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chrysemys 
picta bellii]
Length=337

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  278  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_001179203.2| PREDICTED: COP9 signalosome complex subunit 5-like [Strongylocentrotus 
purpuratus]
Length=268

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+I+YFKS LD  LL+ LWNKYWVNTLSSS LL N DY  GQ+SDL+EKLE
Sbjct  150  GVHCKQYYSLEISYFKSVLDRKLLESLWNKYWVNTLSSSSLLTNADYTIGQVSDLSEKLE  209

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             AE+QL     G  +     +K+ E +L K T DS K T+E +HGLMSQVIK+ LFN V
Sbjct  210  NAESQLGR---GSFMLAVDHEKKAEDKLGKATRDSCKSTIEVIHGLMSQVIKNKLFNQV  265



>ref|XP_007527171.1| PREDICTED: COP9 signalosome complex subunit 5 [Erinaceus europaeus]
Length=334

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_011219513.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Ailuropoda 
melanoleuca]
Length=325

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  206  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  265

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  266  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  323

Query  157  QS  152
             S
Sbjct  324  IS  325



>ref|XP_006262064.1| PREDICTED: COP9 signalosome complex subunit 5 [Alligator mississippiensis]
Length=322

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  203  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  262

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  263  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  319



>ref|XP_004602468.1| PREDICTED: COP9 signalosome complex subunit 5 [Sorex araneus]
Length=334

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_007429682.1| PREDICTED: COP9 signalosome complex subunit 5 [Python bivittatus]
Length=337

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  278  QSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_004814144.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Mustela 
putorius furo]
Length=340

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  221  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  280

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  281  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  338

Query  157  QS  152
             S
Sbjct  339  IS  340



>ref|NP_001020866.1| COP9 signalosome complex subunit 5 [Rattus norvegicus]
 gb|AAH98736.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Rattus norvegicus]
 gb|EDM11550.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Rattus norvegicus]
Length=334

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_007080737.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Panthera 
tigris altaica]
Length=325

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  206  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  265

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  266  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  323

Query  157  QS  152
             S
Sbjct  324  IS  325



>ref|XP_008565067.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Galeopterus 
variegatus]
Length=335

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  216  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  276  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  333

Query  157  QS  152
             S
Sbjct  334  IS  335



>pdb|4D18|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D18|M Chain M, Crystal Structure Of The Cop9 Signalosome
Length=327

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  208  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  267

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  268  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  325

Query  157  QS  152
             S
Sbjct  326  IS  327



>gb|EGW14995.1| COP9 signalosome complex subunit 5 [Cricetulus griseus]
Length=327

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  208  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  267

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  268  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  324



>ref|NP_038743.1| COP9 signalosome complex subunit 5 isoform 1 [Mus musculus]
 ref|XP_005361944.1| PREDICTED: COP9 signalosome complex subunit 5 [Microtus ochrogaster]
 ref|XP_006974748.1| PREDICTED: COP9 signalosome complex subunit 5 [Peromyscus maniculatus 
bairdii]
 ref|XP_008852994.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nannospalax 
galili]
 sp|O35864.3|CSN5_MOUSE RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1; AltName: Full=Kip1 C-terminus-interacting 
protein 2 [Mus musculus]
 gb|AAF61318.1|AF068223_1 Kip1 C-terminus interacting protein-2 [Mus musculus]
 gb|AAD03470.1| 38 kDa Mov34 homolog [Mus musculus]
 gb|AAC17179.1| Jun coactivator Jab1 [Mus musculus]
 dbj|BAB28282.1| unnamed protein product [Mus musculus]
 gb|AAH46753.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Mus musculus]
 dbj|BAE30445.1| unnamed protein product [Mus musculus]
 dbj|BAE27030.1| unnamed protein product [Mus musculus]
 gb|EDL14298.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana), isoform CRA_a [Mus musculus]
Length=334

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_008106749.1| PREDICTED: COP9 signalosome complex subunit 5 [Anolis carolinensis]
Length=343

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  224  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  283

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  284  QSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  340



>ref|XP_006943314.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Felis 
catus]
Length=325

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  206  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  265

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  266  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  323

Query  157  QS  152
             S
Sbjct  324  IS  325



>ref|XP_005663091.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Sus 
scrofa]
Length=358

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  239  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  298

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  299  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  356

Query  157  QS  152
             S
Sbjct  357  IS  358



>ref|XP_011448117.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Crassostrea 
gigas]
Length=361

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YYSLD++YFKS  D  LL+ LWNKYWVNTLSSS LL N DY  GQI DLA+KLE
Sbjct  241  GVHCKHYYSLDMSYFKSVADRKLLESLWNKYWVNTLSSSSLLTNADYTTGQIFDLADKLE  300

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL   R G ++     +K+ E +LAK T D  K T+E +HGLMSQVIKD LFN V 
Sbjct  301  QSEVQL--CRGGFMLGMDTHEKKSEDKLAKATKDGCKTTMEAIHGLMSQVIKDRLFNQVH  358

Query  157  QS  152
             +
Sbjct  359  TT  360



>ref|XP_007066265.1| PREDICTED: COP9 signalosome complex subunit 5 [Chelonia mydas]
 gb|EMP29804.1| COP9 signalosome complex subunit 5 [Chelonia mydas]
Length=338

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  219  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  279  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  335



>ref|NP_001086291.1| COP9 signalosome complex subunit 5 [Xenopus laevis]
 sp|Q6GLM9.1|CSN5_XENLA RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus laevis]
 gb|AAH74434.1| MGC84682 protein [Xenopus laevis]
Length=332

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTLSSS LL N +Y  GQ+ DL+EKLE
Sbjct  213  GVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNAEYTTGQVFDLSEKLE  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  273  QSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  329



>ref|XP_005977666.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pantholops 
hodgsonii]
Length=352

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  233  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  292

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  293  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  350

Query  157  QS  152
             S
Sbjct  351  IS  352



>ref|XP_008072512.1| PREDICTED: COP9 signalosome complex subunit 5 [Tarsius syrichta]
Length=390

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQI DL+EKLE
Sbjct  271  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQIFDLSEKLE  330

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  331  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  388

Query  157  QS  152
             S
Sbjct  389  IS  390



>ref|XP_001200311.2| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Strongylocentrotus 
purpuratus]
Length=554

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+I+YFKS LD  LL+ LWNKYWVNTLSSS LL N DY  GQ+SDL+EKLE
Sbjct  436  GVHCKQYYSLEISYFKSVLDRKLLESLWNKYWVNTLSSSSLLTNADYTIGQVSDLSEKLE  495

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             AE+QL    F  ++A    KK E+ +L K T DS K T+E +HGLMSQVIK+ LFN V
Sbjct  496  NAESQLGRGSF--MLAVDHEKKAED-KLGKATRDSCKSTIEVIHGLMSQVIKNKLFNQV  551



>gb|EAW86930.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_b [Homo sapiens]
Length=379

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  260  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  319

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  320  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  376



>gb|KFM00893.1| COP9 signalosome complex subunit 5, partial [Aptenodytes forsteri]
Length=337

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  218  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  278  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_009274936.1| PREDICTED: COP9 signalosome complex subunit 5 [Aptenodytes forsteri]
Length=339

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  220  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      K+ E +L K T DS K T+E +HGLMSQVIKD LFN +
Sbjct  280  QSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_004638141.1| PREDICTED: COP9 signalosome complex subunit 5-like [Octodon degus]
Length=334

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQ+IKD LFN +
Sbjct  275  QSEAQLGRGSF--MLGLETHDQKSEDKLAKATRDSCKTTIEAIHGLMSQIIKDKLFNQI  331



>gb|ETE60341.1| COP9 signalosome complex subunit 5, partial [Ophiophagus hannah]
Length=379

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  260  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  319

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  320  QSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  376



>ref|XP_006069586.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Bubalus 
bubalis]
Length=404

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  285  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  344

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  345  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  402

Query  157  QS  152
             S
Sbjct  403  IS  404



>ref|XP_007651216.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cricetulus 
griseus]
Length=389

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  270  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  329

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  330  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  386



>gb|ELW64697.1| COP9 signalosome complex subunit 5 [Tupaia chinensis]
Length=477

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  358  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  417

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  418  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  475

Query  157  QS  152
             S
Sbjct  476  IS  477



>ref|XP_007634273.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Cricetulus 
griseus]
Length=421

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  302  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  361

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  362  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  418



>dbj|BAM18530.1| COP9 complex homolog subunit 5 [Papilio xuthus]
Length=348

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 98/138 (71%), Gaps = 9/138 (7%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTLSSS L+ N DY  GQI DL++KLE
Sbjct  219  GVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTLSSSSLITNADYTTGQIFDLSDKLE  278

Query  337  QAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  LS   F  L+A A   +K  E +L+K T D+ K T+E +HGLM+Q+IKD LFN V
Sbjct  279  QSEVCLSRGVF--LVAGADPHEKRSEDKLSKATKDACKTTIEVIHGLMAQMIKDRLFNGV  336

Query  160  RQSNRSRTESSGPEPMVE  107
              S R     + P PM+E
Sbjct  337  --SGR----PAPPTPMIE  348



>gb|KJB55193.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=318

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 76/82 (93%), Gaps = 2/82 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct  216  GVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  275

Query  337  QAENQLSHSRFGPLIAPAQRKK  272
            QAENQL+HSR GPL  P  RKK
Sbjct  276  QAENQLAHSRIGPLGPP--RKK  295



>ref|XP_006901120.1| PREDICTED: COP9 signalosome complex subunit 5-like [Elephantulus 
edwardii]
Length=245

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYW+NTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  126  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWMNTLSSSSLLTNADYTTGQVFDLSEKLE  185

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            ++E QL    F  ++       + E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  186  RSEAQLGRGSF--MLGLETHDLKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  243

Query  157  QS  152
             S
Sbjct  244  IS  245



>ref|XP_006779523.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Myotis 
davidii]
Length=380

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  261  GVHCKXYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  320

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  321  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  378

Query  157  QS  152
             S
Sbjct  379  VS  380



>gb|EHJ73122.1| JAB-MPN domain protein [Danaus plexippus]
Length=397

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 8/137 (6%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTLSSS L+ N DY  GQI DL++KLE
Sbjct  201  GVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTLSSSSLITNADYTTGQIFDLSDKLE  260

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E  L   R G LI     +K  E +L K T D+ K T+E +HGLM+Q+IKD LFN+V 
Sbjct  261  QSEVCL--GRGGFLIGTDPHEKRTEDKLGKATKDACKTTIEVIHGLMAQMIKDRLFNSV-  317

Query  157  QSNRSRTESSGPEPMVE  107
             S R     S P PM++
Sbjct  318  -SGR----PSPPTPMLD  329



>gb|ERE86124.1| COP9 signalosome complex subunit 5 [Cricetulus griseus]
Length=725

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN   
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFN---  329

Query  157  QSNRSRTESSG  125
            Q N  R+  +G
Sbjct  330  QINGFRSPGTG  340



>ref|XP_011297758.1| PREDICTED: COP9 signalosome complex subunit 5 [Fopius arisanus]
Length=343

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY L+++YFKSSLD  +L+ LWNKYWVNTLSSS LL N DY  GQI DLA+KLE
Sbjct  218  GVHCKQYYPLEVSYFKSSLDKRILESLWNKYWVNTLSSSSLLTNADYTTGQIFDLADKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E+ ++ S  G LIA   +  + E +L K T DS K T+E + GLM+Q+IK+ LFN +
Sbjct  278  QSESVVARSSHGFLIAAESQDTKTEDKLTKATRDSCKTTIEVIQGLMTQIIKNKLFNQI  336



>ref|NP_001138802.1| JAB-MPN domain protein [Bombyx mori]
 gb|ACM24339.1| JAB-MPN domain protein [Bombyx mori]
Length=348

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 13/140 (9%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYS++++YFKSSLD  LLD LWNKYWVNTLSSS L+ N DY  GQI DL++KLE
Sbjct  219  GVHCKQYYSMEVSYFKSSLDRRLLDSLWNKYWVNTLSSSSLITNADYTTGQIFDLSDKLE  278

Query  337  QAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  L    F  ++A A   +K  E +L K T D+ K T+E +HGLM+Q+IKD LFN+V
Sbjct  279  QSEVCLGRGAF--VVAGADPHEKRTEDKLGKATKDACKTTIEVIHGLMAQMIKDRLFNSV  336

Query  160  --RQSNRSRTESSGPEPMVE  107
              RQ        + P PM+E
Sbjct  337  CGRQ--------AAPTPMIE  348



>ref|XP_009045703.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
 gb|ESP03615.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
Length=333

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDI+YFKS+LD  LL+ LWNKYWVNTLSSS LL N +Y   QI DLA+KLE
Sbjct  212  GVHCKQYYSLDISYFKSALDCKLLESLWNKYWVNTLSSSSLLTNAEYTTHQIFDLADKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  +   +Q KK E+ +L K   D  K T+E +HGLMSQVIKD LFN V
Sbjct  272  QSEAQLGRGSFMVMGIDSQEKKSED-KLLKAKKDGCKTTIEAIHGLMSQVIKDRLFNQV  329



>gb|KEH17815.1| COP9 signalosome complex subunit 5a-like protein [Medicago truncatula]
Length=77

 Score =   122 bits (306),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = -3

Query  331  ENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS  152
            +N L  +RFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V Q+
Sbjct  2    KNLLGIARFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVHQA  61

Query  151  NRSRTESSGPEPMVET  104
            N+SRTE+S PEPM+E+
Sbjct  62   NKSRTETSDPEPMIES  77



>ref|XP_006752490.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Leptonychotes 
weddellii]
Length=334

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LLWNKY VNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  215  GVHCKQYYALEVSYFKSSLDRKLLELLWNKYXVNTLSSSSLLTNADYTTGQVFDLSEKLE  274

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN + 
Sbjct  275  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQIN  332

Query  157  QS  152
             S
Sbjct  333  IS  334



>ref|XP_008548790.1| PREDICTED: COP9 signalosome complex subunit 5-like [Microplitis 
demolitor]
Length=342

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL++TYFKSSLD  LLD LWNKYWVNTLSSS LL N DY  GQI DL++KLE
Sbjct  218  GVHCKQYYSLEVTYFKSSLDRRLLDSLWNKYWVNTLSSSSLLTNADYTTGQIFDLSDKLE  277

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  L   R G +       +  E +L K T DS K T+E +HGLM+Q+IKD LFN V
Sbjct  278  QSEVAL--GRGGFMSGADSHDRRTEDKLVKATRDSCKTTIEVIHGLMAQIIKDKLFNQV  334



>ref|XP_008989617.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
5-like [Callithrix jacchus]
Length=387

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY+L+++YFKSSLD  LL+LL NKYWVNTLSSS LL N DY  GQ+ DL+EKLE
Sbjct  268  GVHCKQYYALEVSYFKSSLDRKLLELLLNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLE  327

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  328  QSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  384



>ref|XP_002422812.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
 gb|EEB10074.1| COP9 signalosome complex subunit, putative [Pediculus humanus 
corporis]
Length=332

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLD+TYFKSSLD  LLD LWNKYWVNTLSSS LL N DY   QI DL++KLE
Sbjct  209  GVHCKQYYSLDVTYFKSSLDRRLLDSLWNKYWVNTLSSSSLLTNADYTTCQIFDLSDKLE  268

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E  +  S F  L       K  E +L K T DS K T+E +HGLM+Q+IKD LFN ++
Sbjct  269  QSEAAVGRSGF-TLGCSDPLDKRTEDKLMKATKDSCKTTIEIIHGLMAQMIKDRLFNHIK  327

Query  157  QSN  149
            + N
Sbjct  328  RKN  330



>ref|XP_004524030.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Ceratitis capitata]
Length=331

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY L++TYFKS+LD  LLD LWNKYWVNTL SS LL N DY  GQI DL+EKLE
Sbjct  212  GVHCKQYYPLEVTYFKSALDRKLLDSLWNKYWVNTLGSSGLLTNTDYTTGQIFDLSEKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E+ L     GP IA  + +K  E +L+K T D ++ ++E +HGLM+Q+ KD LFN V
Sbjct  272  QSESSLVR---GPFIATGKIEKRTEDKLSKATRDCSRASIELIHGLMAQIAKDKLFNKV  327



>gb|KDR11248.1| COP9 signalosome complex subunit 5 [Zootermopsis nevadensis]
Length=343

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL++TYFKSSLD  LLD LWNKYWVNTLSSS LL N DY  GQI DL++KLE
Sbjct  220  GVHCKQYYSLEVTYFKSSLDRRLLDSLWNKYWVNTLSSSSLLTNADYTTGQIFDLSDKLE  279

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q+E  L    F  L       K  E +L K T DS K T+E +HGLM+Q+IKD LFN ++
Sbjct  280  QSEAALGRGGF-MLGGADPHDKRTEDKLLKATKDSCKTTIEIIHGLMAQMIKDCLFNHIK  338



>dbj|BAN21083.1| jun activation domain binding protein [Riptortus pedestris]
Length=342

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTLSS+ LL N DY  GQI DL++KLE
Sbjct  219  GVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTLSSASLLTNADYTTGQILDLSDKLE  278

Query  337  QAENQLSHSR-FGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E+ L     FG      Q +K  E +L K T DS K TVE +HGLM+Q+IKD LFN +
Sbjct  279  QSESALGRGHMFG---GADQHEKRTEDKLLKATKDSCKTTVEIIHGLMAQMIKDRLFNQI  335

Query  160  RQS  152
            + +
Sbjct  336  KPT  338



>ref|XP_009974671.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Tyto 
alba]
Length=114

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  499  YYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQL  320
            YY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL
Sbjct  1    YYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQL  60

Query  319  SHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
                F  ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  61   GRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  111



>gb|EFZ10471.1| hypothetical protein SINV_14809 [Solenopsis invicta]
Length=142

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 83/119 (70%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKS+LD  LLD LWNKYWVNTLSSS LL N DY  GQI DL++KLE
Sbjct  25   GVHCKQYYSLEVSYFKSALDRRLLDSLWNKYWVNTLSSSSLLTNADYTTGQIFDLSDKLE  84

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             +E+ L          P  R   E  +L K T DS K T+E +HGLM+Q+IKD LFN V
Sbjct  85   HSESALGRGFVLGGTDPHDRSTVE--KLIKATRDSCKTTIEVIHGLMAQIIKDRLFNHV  141



>ref|XP_010601003.1| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Loxodonta 
africana]
Length=129

 Score =   121 bits (304),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = -3

Query  502  QYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQ  323
            +YY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E Q
Sbjct  15   RYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQ  74

Query  322  LSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS  152
            L    F   +    RK E+  +LAK T DS K T+E +HGLMSQVIKD LFN +  S
Sbjct  75   LGRGSFMLGLETHDRKSED--KLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS  129



>gb|AEE62710.1| unknown [Dendroctonus ponderosae]
 gb|ENN70355.1| hypothetical protein YQE_12863, partial [Dendroctonus ponderosae]
 gb|ERL94202.1| hypothetical protein D910_11483 [Dendroctonus ponderosae]
Length=351

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKS+LD  LLD LWNKYWVNTLSSS L+ N DY  GQI DL+EKLE
Sbjct  222  GVHCKQYYSLEVSYFKSTLDRRLLDSLWNKYWVNTLSSSSLITNADYTTGQIFDLSEKLE  281

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  +  + F    A    K+ E+ +L K T DS K T+E +HGLM+Q+IKD LFN++
Sbjct  282  QSEAAIGRAGFLAGSADPTEKRTED-KLLKATKDSCKTTIEIIHGLMAQMIKDRLFNSI  339



>ref|XP_004354957.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
 gb|EGG16557.1| Mov34/MPN/PAD-1 family protein [Dictyostelium fasciculatum]
Length=372

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 3/117 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY L+I+YFKSSLDS LLD LWNKYWVNTLSSSP+  N DY+ GQI D++EKLE
Sbjct  212  GVHCKQYYPLEISYFKSSLDSQLLDKLWNKYWVNTLSSSPIFTNRDYITGQIGDISEKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFN  167
            QAE+QLS+S+   L+     KK+EESQL +I  DS+K+T+EQ  G+MSQV+K+++FN
Sbjct  272  QAESQLSNSKSSLLLG---DKKKEESQLDRIVKDSSKVTIEQAQGIMSQVMKNLVFN  325



>ref|XP_011502813.1| PREDICTED: COP9 signalosome complex subunit 5 [Ceratosolen solmsi 
marchali]
Length=342

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL++TYFKSSLD  LLD LWNKYWVNTLSSS LL N DY  GQI DL++KLE
Sbjct  214  GVHCKQYYSLEVTYFKSSLDRRLLDSLWNKYWVNTLSSSSLLTNTDYTTGQIFDLSDKLE  273

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  L        I P  R   +  +L K T DS+K T+E +HGLM+Q+IKD LFN V
Sbjct  274  QSEQALGRGFVLGGIEPHDRSTVD--KLIKATRDSSKTTIEVIHGLMAQIIKDRLFNQV  330



>ref|XP_972769.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198243.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 ref|XP_008198244.1| PREDICTED: COP9 signalosome complex subunit 5 [Tribolium castaneum]
 gb|EFA09688.1| hypothetical protein TcasGA2_TC011816 [Tribolium castaneum]
Length=344

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTLSSS LL N DY  GQI DL+EKLE
Sbjct  220  GVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTLSSSSLLTNADYTTGQIFDLSEKLE  279

Query  337  QAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E  +   R G ++      +K  E +L K T DS K T+E +HGLM+Q+IKD LFN+ 
Sbjct  280  QSEAAI--GRGGFIVGGTDPHEKRTEDKLLKATKDSCKTTIEIIHGLMAQMIKDRLFNST  337

Query  160  RQSNRS  143
              +N +
Sbjct  338  SLNNST  343



>ref|NP_001156462.1| COP9 complex homolog subunit 5 [Acyrthosiphon pisum]
 dbj|BAH72641.1| ACYPI006786 [Acyrthosiphon pisum]
Length=339

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 89/123 (72%), Gaps = 5/123 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL++ YFKSSLD  LLD LWNKYWVNTLSSS L+ N DY+ GQI+DL++KLE
Sbjct  219  GVHCKQYYSLEVNYFKSSLDRRLLDSLWNKYWVNTLSSSSLITNADYLTGQINDLSDKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QA+  LS + F P+      + + E++L K T DS K T+E + GLMSQ IK+ LFN+  
Sbjct  279  QADTSLSRTFFEPV-----DRTKTENKLVKATKDSNKATIEILCGLMSQTIKEALFNSCT  333

Query  157  QSN  149
              N
Sbjct  334  PKN  336



>ref|XP_005099578.1| PREDICTED: COP9 signalosome complex subunit 5-like [Aplysia californica]
Length=334

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 3/119 (3%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCK YY LDI+YFKSS+D  LL+ LWNKYWVNTLSSS LL N DY  G I DL+EKLE
Sbjct  212  GVHCKAYYPLDISYFKSSMDRRLLESLWNKYWVNTLSSSSLLTNADYTTGMIFDLSEKLE  271

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
            Q+E+QL  S    LI+   + ++ E +L K T D  + T+E + GLMSQVIKD LFN V
Sbjct  272  QSESQLGRSG---LISTDSQDRKTEDKLTKATKDGCRTTMEVLQGLMSQVIKDRLFNQV  327



>emb|CDH56438.1| cop9 signalosome complex subunit 5a-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=333

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVH K YYSL++++FKS LD+ LL++LWNKYWVNTLS SPLL N DY   Q++DLA+KL+
Sbjct  213  GVHAKSYYSLEVSHFKSVLDTQLLEVLWNKYWVNTLSQSPLLTNRDYSTQQMADLAQKLK  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q  N ++  R G       RKK +ESQL+K+T DSAKI+ E +HGL+SQV+KD++FN   
Sbjct  273  QTNNSMT-GRMGGYY--GDRKKNDESQLSKVTKDSAKISGEAMHGLLSQVLKDLVFN---  326

Query  157  QSNRSRT  137
            QS   RT
Sbjct  327  QSGSQRT  333



>ref|XP_008185322.1| PREDICTED: COP9 complex homolog subunit 5 isoform X1 [Acyrthosiphon 
pisum]
Length=339

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 89/123 (72%), Gaps = 5/123 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSL++ YFKSSLD  LLD LWNKYWVNTLSSS L+ N DY+ GQI+DL++KLE
Sbjct  219  GVHCKQYYSLEVNYFKSSLDRRLLDSLWNKYWVNTLSSSSLITNADYLTGQINDLSDKLE  278

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            QA+  LS + F P+      + + E++L K T DS K T+E + GLMSQ IK+ LFN+  
Sbjct  279  QADTSLSRTFFEPV-----DRTKTENKLVKATKDSNKATIEILCGLMSQTIKEALFNSCT  333

Query  157  QSN  149
              N
Sbjct  334  PKN  336



>ref|XP_009029035.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
 gb|ESN92732.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
Length=335

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYY LD++YFKSSLD  LL++LW+KYWVNTLSS  LL N DY  GQI DL +KLE
Sbjct  213  GVHCKQYYPLDVSYFKSSLDRRLLEMLWDKYWVNTLSSCNLLTNADYTTGQIYDLTDKLE  272

Query  337  QAENQLSHSRF--GPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT  164
            Q+E+ L    F  GP    A R    E +L K T DS K T+E +HGLM+QVIKD LFN 
Sbjct  273  QSESFLGRGPFVGGPEQVAADRA---EDKLTKATKDSCKNTIESIHGLMTQVIKDKLFNK  329

Query  163  VR  158
            ++
Sbjct  330  IK  331



>emb|CDS11961.1| Putative COP9 signalosome complex subunit 5a [Absidia idahoensis 
var. thermophila]
Length=333

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVH K YYSL++++FKS LD+ LL++LWNKYWVNTLS SPLL N DY   Q++DLA+KL+
Sbjct  213  GVHAKSYYSLEVSHFKSVLDTQLLEVLWNKYWVNTLSQSPLLTNRDYSTQQMADLAQKLK  272

Query  337  QAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR  158
            Q  N ++  R G       RKK +ESQL+K+T DSAKI+ E +HGL+SQV+KD++FN   
Sbjct  273  QTNNGMT-GRMGGYY--GDRKKNDESQLSKVTKDSAKISGEAMHGLLSQVLKDLVFN---  326

Query  157  QSNRSRT  137
            QS   RT
Sbjct  327  QSGSQRT  333



>gb|ADP30958.1| COP9 constitutive photomorphogenic-like protein subunit 5 [Penaeus 
monodon]
Length=351

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 96/131 (73%), Gaps = 5/131 (4%)
 Frame = -3

Query  517  GVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE  338
            GVHCKQYYSLDI+YFKSSLD  LLD LWNKYWVNTLSSS L+ N +Y+  QI DL++KLE
Sbjct  225  GVHCKQYYSLDISYFKSSLDKKLLDSLWNKYWVNTLSSSSLITNAEYMTRQIFDLSDKLE  284

Query  337  QAENQLSHSR-FGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             +E  L  +  FG  + P ++K E+  +L+++T DS K T+E +HGLM+QV+KD LFN +
Sbjct  285  NSETALGRAGLFG--LDPQEKKTED--KLSRVTRDSCKTTMEALHGLMAQVVKDRLFNQI  340

Query  160  RQSNRSRTESS  128
             Q+ +   E +
Sbjct  341  PQAQQKGQEPA  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000