BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005E23

Length=425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775389.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   2e-46   Nicotiana sylvestris
ref|XP_009598843.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   2e-46   Nicotiana tomentosiformis
ref|XP_009775388.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    169   2e-46   Nicotiana sylvestris
gb|AII20189.1|  glucose-6-phosphate isomerase                           168   5e-46   Nicotiana tabacum [American tobacco]
ref|NP_001275223.1|  glucose-6-phosphate isomerase                      165   3e-45   Solanum tuberosum [potatoes]
emb|CAD79590.1|  cytosolic phosphoglucose isomerase                     156   2e-44   Lopezia grandiflora
emb|CAC85668.1|  cytosolic phosphoglucose isomerase                     153   8e-44   Clarkia similis
ref|XP_003618419.1|  Glucose-6-phosphate isomerase                      161   1e-43   Medicago truncatula
emb|CAC84504.1|  cytosolic phosphoglucose isomerase                     151   2e-43   Clarkia delicata
sp|P54243.1|G6PI_OENME  RecName: Full=Glucose-6-phosphate isomera...    160   3e-43   Oenothera sinuata var. hirsuta
ref|XP_007221807.1|  hypothetical protein PRUPE_ppa003512mg             159   4e-43   Prunus persica
emb|CAC85684.1|  cytosolic phosphoglucose isomerase                     159   6e-43   Clarkia similis
emb|CAC85683.1|  cytosolic phosphoglucose isomerase                     159   6e-43   Clarkia similis
sp|P54236.1|G6PI1_CLAFR  RecName: Full=Glucose-6-phosphate isomer...    159   6e-43   Clarkia franciscana [Presidio clarkia]
emb|CAB55566.1|  cytosolic phosphoglucose isomerase                     159   7e-43   Clarkia gracilis
ref|XP_004152701.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    159   8e-43   Cucumis sativus [cucumbers]
sp|P54240.1|G6PI1_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    159   8e-43   Clarkia xantiana [gusight clarkia]
gb|ABB17077.1|  glucose-6-phosphate isomerase                           147   1e-42   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011083695.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    158   1e-42   Sesamum indicum [beniseed]
sp|P54241.1|G6PI2_CLACO  RecName: Full=Glucose-6-phosphate isomer...    157   2e-42   Clarkia concinna [red ribbons]
emb|CAB55567.1|  cytosolic phosphoglucose isomerase                     157   3e-42   Clarkia gracilis
sp|P54237.1|G6PI1_CLAMI  RecName: Full=Glucose-6-phosphate isomer...    157   3e-42   Clarkia mildrediae
sp|P54234.1|G6PI1_CLAAR  RecName: Full=Glucose-6-phosphate isomer...    157   4e-42   Clarkia arcuata
gb|AFK39110.1|  unknown                                                 157   4e-42   Medicago truncatula
emb|CAC85669.1|  cytosolic phosphoglucose isomerase                     148   4e-42   Clarkia similis
sp|P54242.1|G6PI2_CLAXA  RecName: Full=Glucose-6-phosphate isomer...    156   6e-42   Clarkia xantiana [gusight clarkia]
sp|P54239.1|G6PI1_CLAWI  RecName: Full=Glucose-6-phosphate isomer...    156   6e-42   Clarkia williamsonii
emb|CAC86122.1|  cytosolic phosphoglucose isomerase                     156   7e-42   Clarkia modesta
sp|P34797.1|G6PI3_CLALE  RecName: Full=Glucose-6-phosphate isomer...    151   2e-41   Clarkia lewisii
sp|P54235.1|G6PI1_CLACO  RecName: Full=Glucose-6-phosphate isomer...    154   3e-41   Clarkia concinna [red ribbons]
emb|CAC82578.1|  cytosolic phosphoclucose isomerase                     153   9e-41   Clarkia epilobioides
emb|CAC84508.1|  cytosolic phosphoglucose isomerase                     152   1e-40   Clarkia delicata
emb|CAC84514.1|  cytosolic phosphoglucose isomerase                     152   1e-40   Clarkia delicata
ref|XP_008377469.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    144   1e-40   
sp|P29333.1|G6PI2_CLALE  RecName: Full=Glucose-6-phosphate isomer...    152   2e-40   Clarkia lewisii
ref|XP_006434973.1|  hypothetical protein CICLE_v10000722mg             152   2e-40   Citrus clementina [clementine]
ref|XP_004489355.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    152   2e-40   
emb|CAC84511.1|  cytosolic phosphoglucose isomerase                     152   2e-40   Clarkia delicata
gb|EYU45143.1|  hypothetical protein MIMGU_mgv1a003701mg                152   3e-40   Erythranthe guttata [common monkey flower]
emb|CAC85685.1|  cytosolic phosphoglucose isomerase                     151   3e-40   Clarkia similis
ref|XP_010313627.1|  PREDICTED: glucose-6-phosphate isomerase iso...    152   3e-40   Solanum lycopersicum
ref|NP_001265881.1|  glucose-6-phosphate isomerase                      152   3e-40   Solanum lycopersicum
emb|CAC85686.1|  cytosolic phosphoglucose isomerase                     151   3e-40   Clarkia similis
emb|CAC82579.1|  cytosolic phosphoclucose isomerase                     151   3e-40   Clarkia epilobioides
sp|P34796.1|G6PI1_CLALE  RecName: Full=Glucose-6-phosphate isomer...    151   3e-40   Clarkia lewisii
ref|XP_007017512.1|  Sugar isomerase (SIS) family protein isoform 3     150   7e-40   
ref|XP_007017511.1|  Sugar isomerase (SIS) family protein isoform 2     150   8e-40   
gb|KCW67833.1|  hypothetical protein EUGRSUZ_F01561                     150   8e-40   Eucalyptus grandis [rose gum]
ref|XP_010060937.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    150   8e-40   Eucalyptus grandis [rose gum]
emb|CAC85647.1|  cytosolic phosphoglucose isomerase                     142   9e-40   Clarkia similis
sp|P54238.1|G6PI1_CLARO  RecName: Full=Glucose-6-phosphate isomer...    150   1e-39   Clarkia rostrata
emb|CDP07527.1|  unnamed protein product                                144   1e-39   Coffea canephora [robusta coffee]
gb|KDO84534.1|  hypothetical protein CISIN_1g007374mg                   148   2e-39   Citrus sinensis [apfelsine]
ref|XP_010677508.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    149   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007017510.1|  Sugar isomerase family protein isoform 1           150   2e-39   
ref|XP_006473486.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    149   3e-39   Citrus sinensis [apfelsine]
ref|NP_001242028.1|  uncharacterized protein LOC100807719               149   3e-39   Glycine max [soybeans]
gb|KHN45846.1|  Glucose-6-phosphate isomerase, cytosolic                149   3e-39   Glycine soja [wild soybean]
ref|XP_004291883.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    149   3e-39   Fragaria vesca subsp. vesca
gb|KDP38492.1|  hypothetical protein JCGZ_04417                         149   3e-39   Jatropha curcas
gb|KDO84533.1|  hypothetical protein CISIN_1g007374mg                   149   3e-39   Citrus sinensis [apfelsine]
ref|XP_002510371.1|  glucose-6-phosphate isomerase, putative            149   3e-39   
emb|CAC85670.1|  cytosolic phosphoglucose isomerase                     140   5e-39   Clarkia similis
ref|XP_007136588.1|  hypothetical protein PHAVU_009G057500g             148   6e-39   Phaseolus vulgaris [French bean]
ref|XP_010106007.1|  Glucose-6-phosphate isomerase, cytosolic 1         148   6e-39   
ref|XP_006837344.1|  hypothetical protein AMTR_s00111p00094320          148   6e-39   Amborella trichopoda
ref|XP_008357232.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    144   6e-39   
gb|EYU45142.1|  hypothetical protein MIMGU_mgv1a003701mg                147   1e-38   Erythranthe guttata [common monkey flower]
ref|XP_006582469.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...    146   1e-38   
gb|KHN22258.1|  Glucose-6-phosphate isomerase, cytosolic                145   3e-38   Glycine soja [wild soybean]
gb|EPS71211.1|  glucose-6-phosphate isomerase                           145   4e-38   Genlisea aurea
ref|XP_008377470.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    144   4e-38   
gb|AAY85660.1|  cytosolic glucose-6-phosphate isomerase                 145   6e-38   Helianthus annuus
gb|KJB14513.1|  hypothetical protein B456_002G128400                    145   8e-38   Gossypium raimondii
gb|KJB14509.1|  hypothetical protein B456_002G128400                    145   8e-38   Gossypium raimondii
ref|XP_008377422.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    144   1e-37   
ref|XP_008220896.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    144   1e-37   Prunus mume [ume]
ref|XP_002312387.2|  hypothetical protein POPTR_0008s11770g             143   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008377333.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    143   2e-37   Malus domestica [apple tree]
ref|XP_010263691.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    143   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008444704.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    143   3e-37   Cucumis melo [Oriental melon]
ref|XP_003554193.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    143   4e-37   Glycine max [soybeans]
gb|KHN34179.1|  Glucose-6-phosphate isomerase, cytosolic 1              142   4e-37   Glycine soja [wild soybean]
ref|XP_009365601.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    142   5e-37   Pyrus x bretschneideri [bai li]
emb|CAB55568.1|  cytosolic phosphoglucose isomerase                     138   6e-37   Clarkia gracilis
ref|XP_002282774.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    142   9e-37   Vitis vinifera
ref|XP_011021922.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    141   1e-36   Populus euphratica
gb|AEH27532.1|  putative glucose-6-phosphateisomerase                   135   3e-36   Amorphophallus konjac [devil's-tongue]
ref|XP_009364475.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    140   3e-36   Pyrus x bretschneideri [bai li]
emb|CAC82581.1|  cytosolic phosphoclucose isomerase                     132   4e-36   Clarkia delicata
emb|CAD24788.1|  cytosolic phosphoglucose isomerase                     139   8e-36   Clarkia heterandra
gb|KDO84532.1|  hypothetical protein CISIN_1g007374mg                   136   8e-35   Citrus sinensis [apfelsine]
ref|XP_007151167.1|  hypothetical protein PHAVU_004G023500g             136   1e-34   Phaseolus vulgaris [French bean]
ref|XP_010254873.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    134   4e-34   Nelumbo nucifera [Indian lotus]
sp|O82059.2|G6PI_SPIOL  RecName: Full=Glucose-6-phosphate isomera...    134   7e-34   Spinacia oleracea
gb|KJB14511.1|  hypothetical protein B456_002G128400                    132   2e-33   Gossypium raimondii
dbj|BAA23177.1|  cytosolic phosphoglucose isomerase                     130   1e-32   Dioscorea tokoro [shan bei xie]
dbj|BAA23176.1|  phosphoglucose isomerase                               130   1e-32   Dioscorea tokoro [shan bei xie]
dbj|BAA23181.1|  cytosolic phosphoglucose isomerase                     130   1e-32   Dioscorea tokoro [shan bei xie]
dbj|BAA23180.1|  cytosolic phosphoglucose isomerase                     130   1e-32   Dioscorea tokoro [shan bei xie]
dbj|BAA23179.1|  cytosolic phosphoglucose isomerase                     130   1e-32   Dioscorea tokoro [shan bei xie]
dbj|BAA23185.2|  phosphoglucose isomerase                               130   1e-32   Dioscorea tokoro [shan bei xie]
ref|XP_009407687.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    128   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA23182.1|  cytosolic phosphoglucose isomerase                     127   1e-31   Dioscorea tokoro [shan bei xie]
dbj|BAB83916.1|  cytosolic phosphoglucose isomerase                     125   1e-31   Dryopteris caudipinna
gb|ABK24817.1|  unknown                                                 125   1e-31   Picea sitchensis
ref|XP_008353564.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    123   4e-31   
ref|XP_010519111.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    125   6e-31   Tarenaya hassleriana [spider flower]
ref|XP_010942803.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    125   9e-31   Elaeis guineensis
ref|XP_010935387.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    119   4e-30   
emb|CDX95171.1|  BnaC09g16990D                                          118   6e-30   
dbj|BAB17655.1|  cytosolic phosphoglucose isomerase                     121   3e-29   Arabidopsis halleri subsp. gemmifera
ref|XP_002865489.1|  glucose-6-phosphate isomerase                      121   3e-29   Arabidopsis lyrata subsp. lyrata
sp|Q9FXM5.2|G6PI_ARAHG  RecName: Full=Glucose-6-phosphate isomera...    121   3e-29   Arabidopsis halleri subsp. gemmifera
sp|Q9FXM4.1|G6PI_ARALP  RecName: Full=Glucose-6-phosphate isomera...    121   3e-29   Arabidopsis lyrata subsp. petraea
tpg|DAA51693.2|  TPA: glucose-6-phosphate isomerase, cytosolic(Ph...    116   4e-29   
ref|XP_008783474.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    120   5e-29   Phoenix dactylifera
dbj|BAB17637.1|  cytosolic phosphoglucose isomerase                     120   7e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17635.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAK50107.1|AF372970_1  AT5g42740/MJB21_12                            120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17639.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442128.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    120   8e-29   Camelina sativa [gold-of-pleasure]
dbj|BAB17643.1|  cytosolic phosphoglucose isonerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199088.1|  glucose-6-phosphate isomerase                         120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17646.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17650.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17654.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17649.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17648.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17636.1|  cytosolic phosphoglucose isomerase                     120   8e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17645.1|  cytosolic phosphoglucose isomerase                     120   9e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC77715.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77709.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77720.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77710.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77716.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77708.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC11915.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77717.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77713.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
dbj|BAC77714.1|  cytosolic phosphoglucose isomerase                     119   1e-28   Arabidopsis halleri subsp. gemmifera
ref|XP_010494215.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010481956.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010481952.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010481955.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006281946.1|  hypothetical protein CARUB_v10028158mg             119   2e-28   Capsella rubella
gb|KJB14514.1|  hypothetical protein B456_002G128400                    119   2e-28   Gossypium raimondii
emb|CDY64430.1|  BnaA09g16190D                                          118   3e-28   Brassica napus [oilseed rape]
ref|XP_009114042.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    118   3e-28   Brassica rapa
gb|AAC08411.1|  cytosolic phosphoglucose isomerase                      118   4e-28   Leavenworthia crassa
dbj|BAC77719.1|  cytosolic phosphoglucose isomerase                     118   4e-28   Arabidopsis halleri subsp. gemmifera
ref|XP_009381882.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    118   5e-28   
ref|XP_004981572.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    117   7e-28   Setaria italica
gb|AED99453.1|  PgiC protein                                            117   8e-28   Poa palustris
gb|AED99454.1|  PgiC protein                                            117   8e-28   Festuca ovina
ref|XP_002968611.1|  hypothetical protein SELMODRAFT_89539              117   8e-28   
ref|NP_001105368.1|  glucose-6-phosphate isomerase, cytosolic           116   1e-27   Zea mays [maize]
dbj|BAC11914.1|  cytosolic phosphoglucose isomerase                     116   1e-27   Crucihimalaya himalaica
ref|XP_001760206.1|  predicted protein                                  116   2e-27   
ref|XP_002975871.1|  hypothetical protein SELMODRAFT_104526             115   3e-27   
gb|AED99455.1|  PgiC2-3 protein                                         115   3e-27   Festuca ovina
ref|XP_006403357.1|  hypothetical protein EUTSA_v10003173mg             115   4e-27   
gb|ABK00059.1|  cytosolic glucose-6-phosphate isomerase                 114   1e-26   Marchantia polymorpha
gb|ABK00065.1|  cytosolic glucose-6-phosphate isomerase                 114   1e-26   Marchantia polymorpha
ref|XP_006651865.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    114   3e-26   
ref|XP_001782795.1|  predicted protein                                  112   5e-26   
gb|ABE41790.1|  glucose-6-phosphate isomerase                           112   5e-26   Triticum aestivum [Canadian hard winter wheat]
gb|EMT10058.1|  Glucose-6-phosphate isomerase, cytosolic                112   5e-26   
gb|EMS52088.1|  Glucose-6-phosphate isomerase, cytosolic                112   5e-26   Triticum urartu
gb|ABE41789.1|  glucose-6-phosphate isomerase                           112   6e-26   Hordeum vulgare [barley]
dbj|BAC11913.1|  cytosolic phosphoglucose isomerase                     111   1e-25   Turritis glabra
dbj|BAA08149.1|  phosphoglucose isomerase (Pgi-b)                       110   2e-25   Oryza sativa [red rice]
ref|NP_001057316.1|  Os06g0256500                                       110   2e-25   
gb|ABB90111.1|  phosphoglucoisomerase                                   110   2e-25   Festuca ovina
gb|AED99456.1|  PgiC2-4 protein                                         110   2e-25   Festuca ovina
dbj|BAA08148.1|  phosphoglucose isomerase (Pgi-a)                       110   2e-25   Oryza sativa [red rice]
gb|EEC76262.1|  hypothetical protein OsI_13718                          110   2e-25   Oryza sativa Indica Group [Indian rice]
gb|AGT38452.1|  phosphoglucose isomerase                                110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051434.1|  Os03g0776000                                       110   3e-25   
ref|XP_003569006.1|  PREDICTED: glucose-6-phosphate isomerase, cy...    110   4e-25   Brachypodium distachyon [annual false brome]
ref|XP_005718631.1|  glucose-6-phosphate isomerase                      109   8e-25   Chondrus crispus [carageen]
gb|ABH11444.1|  cytosolic glucose-6-phosphate isomerase                 108   9e-25   Chondrus crispus [carageen]
ref|XP_007509641.1|  cytosolic phosphoglucose isomerase                 108   1e-24   Bathycoccus prasinos
ref|XP_001778143.1|  predicted protein                                  108   1e-24   
ref|XP_002509192.1|  phosphoglucose isomerase                           108   2e-24   Micromonas commoda
emb|CBK23535.2|  unnamed protein product                                108   2e-24   Blastocystis hominis
ref|XP_003082100.1|  cytosolic phosphoglucose isomerase (ISS)           108   2e-24   
emb|CEF99714.1|  Phosphoglucose isomerase, C-terminal                   107   3e-24   Ostreococcus tauri
gb|ABK00069.1|  cytosolic glucose-6-phosphate isomerase                 107   4e-24   Chara vulgaris
ref|XP_003061563.1|  predicted protein                                  107   6e-24   Micromonas pusilla CCMP1545
ref|XP_002185232.1|  isomerase glucose-6-phosphate isomerase            105   3e-23   Phaeodactylum tricornutum CCAP 1055/1
gb|EEC80343.1|  hypothetical protein OsI_22416                          105   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_001420367.1|  predicted protein                                  104   3e-23   Ostreococcus lucimarinus CCE9901
ref|XP_008876241.1|  hypothetical protein H310_11362                    104   5e-23   Aphanomyces invadans
ref|XP_001703279.1|  phosphoglucose isomerase                           104   6e-23   Chlamydomonas reinhardtii
emb|CBN74985.1|  conserved unknown protein                              103   8e-23   Ectocarpus siliculosus
ref|XP_005851258.1|  hypothetical protein CHLNCDRAFT_138008             103   9e-23   Chlorella variabilis
ref|XP_005713157.1|  glucose-6-phosphate isomerase                      102   2e-22   Chondrus crispus [carageen]
gb|ABH11442.1|  cytosolic glucose-6-phosphate isomerase                 102   3e-22   Chondrus crispus [carageen]
ref|XP_001754629.1|  predicted protein                                  102   3e-22   
gb|ACI29026.1|  glucose-6-phosphate isomerase                           102   4e-22   Dunaliella salina
ref|XP_005707296.1|  glucose-6-phosphate isomerase                      100   9e-22   Galdieria sulphuraria
gb|ABK00064.1|  cytosolic glucose-6-phosphate isomerase                 100   1e-21   Mesostigma viride
ref|XP_002946940.1|  hypothetical protein VOLCADRAFT_103185             100   1e-21   Volvox carteri f. nagariensis
emb|CCI49830.1|  unnamed protein product                              99.8    1e-21   Albugo candida
emb|CCI49829.1|  unnamed protein product                              99.8    2e-21   Albugo candida
gb|ETK96016.1|  hypothetical protein L915_01139                       99.0    3e-21   Phytophthora parasitica
gb|ETP54025.1|  hypothetical protein F442_01139                       99.0    4e-21   Phytophthora parasitica P10297
ref|XP_008890866.1|  hypothetical protein PPTG_01022                  99.0    4e-21   Phytophthora parasitica INRA-310
gb|ETP26016.1|  hypothetical protein F441_01181                       99.0    4e-21   Phytophthora parasitica CJ01A1
ref|XP_009825599.1|  hypothetical protein H257_03289                  98.6    5e-21   Aphanomyces astaci
ref|XP_002288430.1|  glucose-6-phosphate isomerase                    98.6    6e-21   Thalassiosira pseudonana CCMP1335
gb|AAP51061.1|  glucose-6-phosphate isomerase                         98.2    8e-21   Phytophthora infestans [potato late blight]
gb|KIY94551.1|  glucose-6-phosphate isomerase                         94.4    9e-21   Monoraphidium neglectum
gb|AAP51062.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51071.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51066.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora infestans [potato late blight]
emb|CCA13931.1|  unnamed protein product                              97.8    1e-20   Albugo laibachii Nc14
gb|AAP51070.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51074.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora cactorum
gb|AAP51075.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora erythroseptica
gb|AAP51072.1|  glucose-6-phosphate isomerase                         97.8    1e-20   Phytophthora infestans [potato late blight]
ref|XP_002908462.1|  glucose-6-phosphate isomerase                    97.8    1e-20   Phytophthora infestans T30-4
gb|AAP51077.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora erythroseptica
gb|AAP51067.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51076.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora erythroseptica
gb|AAP51063.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora mirabilis
gb|AAP51065.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51068.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51080.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
gb|AAP51069.1|  glucose-6-phosphate isomerase                         97.4    1e-20   Phytophthora infestans [potato late blight]
ref|XP_005650466.1|  cytosolic phosphoglucose isomerase               97.4    1e-20   Coccomyxa subellipsoidea C-169
ref|XP_009523844.1|  glucose-6-phosphate isomerase                    97.1    2e-20   Phytophthora sojae
gb|ABH11443.1|  cytosolic glucose-6-phosphate isomerase               97.1    2e-20   Pyropia yezoensis
gb|AAP51073.1|  glucose-6-phosphate isomerase                         95.9    4e-20   Phytophthora cactorum
gb|AAP51060.1|  glucose-6-phosphate isomerase                         95.9    4e-20   Phytophthora infestans [potato late blight]
gb|AAP51079.1|  glucose-6-phosphate isomerase                         95.9    4e-20   Phytophthora infestans [potato late blight]
ref|XP_005537531.1|  glucose-6-phosphate isomerase                    96.3    4e-20   Cyanidioschyzon merolae strain 10D
gb|EWM30292.1|  glucose-6-phosphate isomerase                         95.5    6e-20   Nannochloropsis gaditana
gb|AFW69306.1|  hypothetical protein ZEAMMB73_008996                  92.4    6e-20   
ref|XP_005537536.1|  glucose-6-phosphate isomerase                    96.3    6e-20   Cyanidioschyzon merolae strain 10D
ref|XP_008611761.1|  glucose-6-phosphate isomerase, cytosolic 2       94.0    2e-19   Saprolegnia diclina VS20
gb|ABH11446.1|  cytosolic glucose-6-phosphate isomerase               93.2    3e-19   Cyanophora paradoxa
gb|KDO30887.1|  glucose-6-phosphate isomerase                         92.8    5e-19   Saprolegnia parasitica CBS 223.65
emb|CBJ33821.1|  cytosolic glucose-6-phosphate isomerase              89.7    9e-19   Ectocarpus siliculosus
gb|ABH11441.1|  cytosolic glucose-6-phosphate isomerase               89.4    1e-18   Cyanophora paradoxa
ref|XP_002967787.1|  hypothetical protein SELMODRAFT_409075           92.0    3e-18   
gb|KDD75199.1|  phosphoglucose isomerase                              90.9    3e-18   Helicosporidium sp. ATCC 50920
ref|XP_002185275.1|  isomerase glucose-6-phosphate isomerase          90.9    4e-18   Phaeodactylum tricornutum CCAP 1055/1
gb|EJK76543.1|  hypothetical protein THAOC_01690                      87.8    4e-18   Thalassiosira oceanica
gb|ABH11437.1|  cytosolic glucose-6-phosphate isomerase               89.4    8e-18   Lingulodinium polyedra
ref|XP_011397571.1|  Glucose-6-phosphate isomerase, cytosolic         89.4    1e-17   Auxenochlorella protothecoides
ref|XP_009033908.1|  hypothetical protein AURANDRAFT_69676            88.2    2e-17   Aureococcus anophagefferens
gb|KIZ06944.1|  glucose-6-phosphate isomerase                         87.8    3e-17   Monoraphidium neglectum
ref|XP_005703455.1|  glucose-6-phosphate isomerase                    85.5    2e-16   Galdieria sulphuraria
gb|ABH11438.1|  cytosolic glucose-6-phosphate isomerase               84.7    4e-16   Pyrocystis lunula
emb|CDJ39851.1|  glucose-6-phosphate isomerase, putative              81.3    5e-16   Eimeria tenella
ref|XP_001030227.1|  Glucose-6-phosphate isomerase                    80.1    1e-15   
gb|EAR82564.2|  glucose-6-phosphate isomerase                         79.7    1e-15   Tetrahymena thermophila SB210
ref|WP_040824413.1|  glucose-6-phosphate isomerase                    82.4    2e-15   
ref|XP_743359.1|  hypothetical protein                                76.6    3e-15   
emb|CDI80540.1|  glucose-6-phosphate isomerase, putative              82.0    3e-15   Eimeria acervulina
ref|XP_002289565.1|  predicted protein                                82.4    4e-15   Thalassiosira pseudonana CCMP1335
ref|WP_034269526.1|  glucose-6-phosphate isomerase                    81.6    4e-15   Amycolatopsis halophila
gb|ADI59420.1|  glucose-6-phosphate isomerase                         81.6    4e-15   Eimeria tenella
gb|ADI59419.1|  glucose-6-phosphate isomerase                         81.6    4e-15   Eimeria tenella
ref|XP_001238687.1|  glucose-6-phosphate isomerase                    81.6    4e-15   
gb|AAL04447.1|  cytosolic phosphoglucoisomerase                       77.8    5e-15   Beta vulgaris [beet]
emb|CDJ56388.1|  glucose-6-phosphate isomerase, putative              81.6    5e-15   Eimeria maxima
gb|EJY71796.1|  Glucose-6-phosphate isomerase                         81.6    5e-15   Oxytricha trifallax
gb|EKD87833.1|  hypothetical protein ACD_35C00182G0002                80.5    8e-15   uncultured bacterium
ref|XP_004030003.1|  hypothetical protein IMG5_169030                 80.5    8e-15   Ichthyophthirius multifiliis
emb|CDW86601.1|  glucose-6-phosphate isomerase                        80.5    1e-14   Stylonychia lemnae
ref|XP_001030231.2|  glucose-6-phosphate isomerase family protein     80.5    1e-14   Tetrahymena thermophila SB210
ref|XP_008888055.1|  glucose-6-phosphate isomerase GPI                80.5    1e-14   
emb|CDJ62718.1|  glucose-6-phosphate isomerase, putative              80.1    2e-14   Eimeria necatrix
gb|KDD74481.1|  phosphoglucose isomerase                              79.7    2e-14   Helicosporidium sp. ATCC 50920
gb|ESS30496.1|  glucose-6-phosphate isomerase GPI                     79.3    4e-14   Toxoplasma gondii VEG
gb|EPT30938.1|  glucose-6-phosphate isomerase GPI                     79.3    4e-14   Toxoplasma gondii ME49
gb|EPR59303.1|  glucose-6-phosphate isomerase GPI                     79.3    4e-14   
ref|WP_019645013.1|  hypothetical protein                             79.0    4e-14   
ref|XP_005845944.1|  hypothetical protein CHLNCDRAFT_135927           79.0    5e-14   
ref|XP_007151166.1|  hypothetical protein PHAVU_004G023500g           78.2    6e-14   
ref|WP_031106905.1|  glucose-6-phosphate isomerase                    74.3    7e-14   
ref|WP_003928063.1|  glucose-6-phosphate isomerase                    78.2    7e-14   
ref|XP_002369127.1|  glucose-6-phosphate isomerase                    78.2    8e-14   
gb|AAD30265.1|AF065160_1  glucose-6-phosphate isomerase               78.2    8e-14   
pdb|3UJH|A  Chain A, Crystal Structure Of Substrate-Bound Glucose...  78.2    8e-14   
gb|EFK99103.1|  LOW QUALITY PROTEIN: glucose-6-phosphate isomerase    76.6    9e-14   
gb|KHG04166.1|  Glucose-6-phosphate isomerase, cytosolic              71.2    1e-13   
ref|XP_003883126.1|  Glucose-6-phosphate isomerase,related            77.0    1e-13   
gb|EWM29429.1|  cytosolic phosphoglucose isomerase                    78.2    1e-13   
ref|WP_012508252.1|  glucose-6-phosphate isomerase                    77.4    1e-13   
ref|XP_005539460.1|  glucose-6-phosphate isomerase                    77.0    2e-13   
ref|WP_026182490.1|  glucose-6-phosphate isomerase                    77.0    2e-13   
ref|WP_030852741.1|  glucose-6-phosphate isomerase                    74.7    2e-13   
ref|XP_001443059.1|  hypothetical protein                             76.6    2e-13   
gb|ABH11440.1|  cytosolic glucose-6-phosphate isomerase               76.6    2e-13   
ref|WP_006134380.1|  glucose-6-phosphate isomerase                    73.9    3e-13   
gb|ACB69778.1|  phosphoglucose isomerase                              75.9    3e-13   
ref|XP_667249.1|  glucose-6-phosphate isomerase                       76.3    3e-13   
ref|WP_003989460.1|  glucose-6-phosphate isomerase                    75.9    4e-13   
ref|WP_037757031.1|  glucose-6-phosphate isomerase                    75.9    4e-13   
ref|WP_043256418.1|  glucose-6-phosphate isomerase                    75.5    5e-13   
ref|WP_010261375.1|  MULTISPECIES: glucose-6-phosphate isomerase      75.5    5e-13   
ref|WP_022653684.1|  glucose-6-phosphate isomerase                    75.5    5e-13   
ref|WP_003795496.1|  glucose-6-phosphate isomerase                    75.5    5e-13   
gb|EGJ78231.1|  putative glucose-6-phosphate isomerase                75.5    5e-13   
ref|WP_022903014.1|  glucose-6-phosphate isomerase                    75.5    6e-13   
ref|WP_029289585.1|  glucose-6-phosphate isomerase                    75.1    8e-13   
ref|XP_725749.1|  phosphoglucose isomerase                            74.7    1e-12   
ref|WP_019527493.1|  MULTISPECIES: hypothetical protein               70.9    1e-12   
emb|CDU21573.1|  glucose-6-phosphate isomerase, putative              74.7    1e-12   
ref|WP_030378789.1|  MULTISPECIES: glucose-6-phosphate isomerase      74.7    1e-12   
gb|EDY43803.2|  glucose-6-phosphate isomerase                         74.7    1e-12   
ref|WP_037870485.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
ref|WP_030996660.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
ref|WP_038553301.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
ref|WP_034509388.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
ref|WP_022895842.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
ref|WP_026416622.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
gb|ETO06866.1|  glucose-6-phosphate isomerase, cytosolic (PGIC)       74.7    1e-12   
ref|WP_007492394.1|  glucose-6-phosphate isomerase                    74.7    1e-12   
emb|CDW59684.1|  glucose 6 phosphate isomerase                        74.3    1e-12   
ref|WP_044441683.1|  glucose-6-phosphate isomerase                    74.3    1e-12   
gb|ADB85510.1|  glucose-6-phosphate isomerase                         72.0    1e-12   
gb|AHH17915.1|  glucose-6-phosphate isomerase                         74.3    1e-12   
gb|EUD71947.1|  glucose-6-phosphate isomerase                         74.3    2e-12   
ref|WP_040701253.1|  glucose-6-phosphate isomerase                    74.3    2e-12   
ref|WP_031057623.1|  glucose-6-phosphate isomerase                    70.9    2e-12   
gb|ACB69787.1|  phosphoglucose isomerase                              73.6    2e-12   
ref|WP_042539871.1|  glucose-6-phosphate isomerase                    72.8    2e-12   
gb|ACB69780.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ACB69777.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ACB69786.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ACB69781.1|  phosphoglucose isomerase                              73.6    2e-12   
ref|WP_012502461.1|  glucose-6-phosphate isomerase                    73.9    2e-12   
gb|ACB69784.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ACB69788.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ACB69779.1|  phosphoglucose isomerase                              73.6    2e-12   
gb|ADB85504.1|  glucose-6-phosphate isomerase                         71.2    2e-12   
ref|WP_030178167.1|  glucose-6-phosphate isomerase                    69.3    2e-12   
ref|WP_009538809.1|  Glucose-6-phosphate isomerase                    73.6    2e-12   
ref|WP_009295362.1|  glucose-6-phosphate isomerase                    73.6    3e-12   
ref|WP_019101650.1|  glucose-6-phosphate isomerase                    72.4    3e-12   
emb|CBY30959.1|  unnamed protein product                              73.6    3e-12   
emb|CBY12265.1|  unnamed protein product                              73.2    3e-12   
ref|WP_040316835.1|  glucose-6-phosphate isomerase                    73.6    3e-12   
ref|WP_037391166.1|  glucose-6-phosphate isomerase                    70.5    3e-12   
emb|CAL94136.1|  putative glucose-6-phosphate isomerase               73.6    3e-12   
gb|EPD29503.1|  glucose-6-phosphate isomerase                         73.2    3e-12   
ref|XP_680147.1|  glucose-6-phosphate isomerase                       73.2    3e-12   
ref|WP_037776166.1|  glucose-6-phosphate isomerase                    70.5    3e-12   
ref|WP_043592584.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|WP_043463241.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|WP_041642438.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|WP_029132792.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
gb|ADB85503.1|  glucose-6-phosphate isomerase                         70.9    4e-12   
ref|WP_039821828.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|WP_030544636.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|WP_013770502.1|  glucose-6-phosphate isomerase                    73.2    4e-12   
ref|XP_626511.1|  glucose-6-phosphate isomerase, cytosolic (GPI) ...  73.2    4e-12   
gb|ADB85506.1|  glucose-6-phosphate isomerase                         70.5    4e-12   
ref|WP_040283521.1|  glucose-6-phosphate isomerase                    72.8    4e-12   
emb|CDU21159.1|  glucose-6-phosphate isomerase, putative              73.2    4e-12   
emb|CDR96067.1|  glucose-6-phosphate isomerase protein, putative      72.8    5e-12   
ref|XP_008625120.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_029394669.1|  hypothetical protein                             69.7    5e-12   
ref|WP_003776981.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_034228245.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_031007114.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_003790399.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_009148503.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_030670385.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
ref|WP_030017961.1|  glucose-6-phosphate isomerase                    72.8    5e-12   
gb|AFW69307.1|  hypothetical protein ZEAMMB73_008996                  70.5    6e-12   
gb|KHJ42712.1|  glucose-6-phosphate isomerase                         72.8    6e-12   
ref|WP_017617837.1|  glucose-6-phosphate isomerase                    72.8    6e-12   
gb|AEV25639.1|  glucose-6-phosphate isomerase                         72.4    6e-12   
ref|WP_004519350.1|  glucose-6-phosphate isomerase                    72.4    6e-12   
ref|WP_027285435.1|  glucose-6-phosphate isomerase                    72.4    6e-12   
gb|KFD52717.1|  hypothetical protein M513_06373                       73.2    6e-12   
ref|WP_041646440.1|  glucose-6-phosphate isomerase                    72.4    6e-12   
gb|ADB85496.1|  glucose-6-phosphate isomerase                         70.1    6e-12   
ref|WP_003745746.1|  glucose-6-phosphate isomerase                    72.4    6e-12   
ref|WP_024091438.1|  glucose-6-phosphate isomerase                    72.4    6e-12   
ref|WP_013652183.1|  glucose-6-phosphate isomerase                    72.4    7e-12   
ref|WP_028425996.1|  glucose-6-phosphate isomerase                    72.4    7e-12   
ref|WP_043798853.1|  glucose-6-phosphate isomerase                    72.4    7e-12   
gb|EPJ38620.1|  putative Glucose-6-phosphate isomerase 2              72.8    7e-12   
emb|CAI09080.1|  Glucose-6-phosphate isomerase                        72.4    7e-12   
ref|WP_017509126.1|  glucose-6-phosphate isomerase                    72.4    7e-12   
ref|WP_031052937.1|  glucose-6-phosphate isomerase                    69.3    7e-12   
ref|WP_027256053.1|  glucose-6-phosphate isomerase                    72.4    7e-12   
gb|KIC09759.1|  glucose-6-phosphate isomerase                         72.0    8e-12   
ref|WP_036491645.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_003686189.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_031182000.1|  glucose-6-phosphate isomerase                    69.3    8e-12   
ref|WP_037860228.1|  hypothetical protein                             67.4    8e-12   
ref|WP_039406460.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_003768546.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_009312377.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_035060621.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_024285228.1|  glucose-6-phosphate isomerase                    72.0    8e-12   
ref|WP_031191410.1|  MULTISPECIES: glucose-6-phosphate isomerase      72.0    8e-12   
ref|XP_006682229.1|  hypothetical protein BATDEDRAFT_36092            72.0    8e-12   
ref|WP_037202893.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_030634049.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_030372277.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_006385899.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_030651695.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_003986539.1|  MULTISPECIES: glucose-6-phosphate isomerase      72.0    9e-12   
ref|WP_005223971.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_030597904.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
ref|WP_008166667.1|  glucose-6-phosphate isomerase                    72.0    9e-12   
dbj|BAM15604.1|  glucose-6-phosphate isomerase                        72.0    9e-12   
gb|EKT84454.1|  glucose-6-phosphate isomerase                         72.0    9e-12   
ref|WP_043341299.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_003678682.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
gb|KEP74587.1|  glucose-6-phosphate isomerase                         72.0    1e-11   
ref|WP_027762429.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_016687399.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_041696679.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_010932668.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_043639165.1|  glucose-6-phosphate isomerase                    72.0    1e-11   
ref|WP_030237178.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|AFN45318.1|  glucose-6-phosphate isomerase                         72.0    1e-11   
ref|WP_029762255.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_022907516.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_019527367.1|  hypothetical protein                             67.8    1e-11   
ref|WP_024706296.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|XP_002142843.1|  glucose-6-phosphate isomerase family protein     71.6    1e-11   
ref|WP_028644195.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|ADB85499.1|  glucose-6-phosphate isomerase                         69.3    1e-11   
ref|WP_026623713.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_030933688.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|EOY46970.1|  Glucose-6-phosphate isomerase                         68.6    1e-11   
ref|WP_031065265.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_037488493.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|AHK78428.1|  glucose-6-phosphate isomerase                         71.6    1e-11   
ref|WP_037491042.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_007039426.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
emb|CDO66827.1|  glucose-6-phosphate isomerase                        71.6    1e-11   
ref|WP_023410312.1|  hypothetical protein                             71.6    1e-11   
ref|XP_001348515.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
ref|WP_037407143.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|ETW28474.1|  glucose-6-phosphate isomerase                         71.6    1e-11   
ref|WP_003741558.1|  glucose-6-phosphate isomerase                    71.6    1e-11   
gb|EET44591.1|  glucose-6-phosphate isomerase                         70.5    1e-11   
ref|WP_028435595.1|  hypothetical protein                             67.8    1e-11   
gb|EWC73854.1|  glucose-6-phosphate isomerase                         71.6    1e-11   
ref|XP_003140934.1|  hypothetical protein LOAG_05350                  67.8    1e-11   
ref|WP_039703121.1|  hypothetical protein                             71.2    1e-11   
ref|WP_025139418.1|  glucose-6-phosphate isomerase                    71.2    1e-11   
ref|WP_019330694.1|  hypothetical protein                             68.2    2e-11   
ref|WP_027466004.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_006226224.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_003754725.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_020121485.1|  hypothetical protein                             70.1    2e-11   
pdb|3PR3|A  Chain A, Crystal Structure Of Plasmodium Falciparum G...  71.2    2e-11   
ref|WP_018065721.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
gb|EFA76252.1|  glucose-6-phosphate isomerase                         71.2    2e-11   
ref|WP_030619207.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
gb|EUT78863.1|  glucose-6-phosphate isomerase                         71.2    2e-11   
ref|WP_030979197.1|  glucose-6-phosphate isomerase                    68.9    2e-11   
ref|WP_017885418.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_043258404.1|  glucose-6-phosphate isomerase                    68.2    2e-11   
ref|WP_043771803.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_039655377.1|  glucose-6-phosphate isomerase                    68.6    2e-11   
ref|WP_024301892.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|XP_011129807.1|  glucose-6-phosphate isomerase                    71.2    2e-11   
ref|WP_036949028.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
gb|EEI94209.1|  putative glucose-6-phosphate isomerase                68.6    2e-11   
ref|WP_007381235.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_039700964.1|  hypothetical protein                             70.9    2e-11   
ref|WP_039686810.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_006130719.1|  glucose-6-phosphate isomerase                    68.6    2e-11   
ref|WP_007020878.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_019137664.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_009758244.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_006303784.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_018985401.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_006391389.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_009213293.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_030792318.1|  glucose-6-phosphate isomerase                    70.5    2e-11   
gb|ACB69783.1|  phosphoglucose isomerase                              70.5    2e-11   
ref|XP_004224301.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_017836261.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_030858695.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_007193052.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_014875694.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_012250911.1|  glucose-6-phosphate isomerase                    70.5    2e-11   
ref|WP_005986928.1|  glucose-6-phosphate isomerase                    70.9    2e-11   
ref|WP_027140297.1|  glucose-6-phosphate isomerase                    70.9    3e-11   
ref|WP_004345003.1|  glucose-6-phosphate isomerase                    70.9    3e-11   
ref|WP_027246307.1|  glucose-6-phosphate isomerase                    70.5    3e-11   
ref|WP_002241709.1|  MULTISPECIES: glucose-6-phosphate isomerase      70.5    3e-11   
ref|WP_003712123.1|  glucose-6-phosphate isomerase                    70.5    3e-11   
ref|WP_030967987.1|  glucose-6-phosphate isomerase                    68.2    3e-11   
ref|WP_003707659.1|  glucose-6-phosphate isomerase                    70.5    3e-11   



>ref|XP_009775389.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
 ref|XP_009775390.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
Length=568

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS A+QVRKQL ASRKK
Sbjct  473  SILLPSLNAYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTL++ YLEAS+D+P DP T LPKI
Sbjct  533  GESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|XP_009598843.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
 ref|XP_009598848.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
Length=568

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS A+QVRKQL ASRKK
Sbjct  473  SILLPSLNAYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTL++ YLEAS+D+P DP T LPKI
Sbjct  533  GESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|XP_009775388.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Nicotiana sylvestris]
Length=576

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS A+QVRKQL ASRKK
Sbjct  481  SILLPSLNAYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKK  540

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTL++ YLEAS+D+P DP T LPKI
Sbjct  541  GESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  576



>gb|AII20189.1| glucose-6-phosphate isomerase [Nicotiana tabacum]
Length=568

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS A+QVR+QL ASRKK
Sbjct  473  SILLPSLNAYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRRQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTL++ YLEAS+D+P DP T LPKI
Sbjct  533  GESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|NP_001275223.1| glucose-6-phosphate isomerase [Solanum tuberosum]
 gb|AAU00726.1| glucose-6-phosphate isomerase [Solanum tuberosum]
Length=568

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAVQGF+W INSFDQWGVELGKS ATQVRKQL ASRKK
Sbjct  473  SILLPSLNAYNIGQLLAIYEHRVAVQGFVWCINSFDQWGVELGKSLATQVRKQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTL++ YLEAS+D+P DP T LP I
Sbjct  533  GESVEGFNFSTKTLITRYLEASADVPSDPSTLLPNI  568



>emb|CAD79590.1| cytosolic phosphoglucose isomerase, partial [Lopezia grandiflora]
Length=230

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR  
Sbjct  135  SILLPTLDAYRIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVN  194

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE++EG NFSTKTLL+ YL+ +SD+P DP T LPKI
Sbjct  195  GEAVEGFNFSTKTLLTRYLKETSDVPADPSTLLPKI  230



>emb|CAC85668.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=178

 Score =   153 bits (387),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  82   SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  141

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  142  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  178



>ref|XP_003618419.1| Glucose-6-phosphate isomerase [Medicago truncatula]
 gb|AES74637.1| glucose-6-phosphate isomerase [Medicago truncatula]
Length=568

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLPSLNAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SLLLPSLNAYNVGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE I+G NFST T+++ YL+AS+D+P DPPT LP+I
Sbjct  533  GEPIQGFNFSTTTMITRYLQASADVPADPPTTLPQI  568



>emb|CAC84504.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=150

 Score =   151 bits (382),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  54   SILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  113

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  114  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  150



>sp|P54243.1|G6PI_OENME RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Oenothera sinuata 
var. hirsuta]
 emb|CAA61577.1| glucose-6-phosphate isomerase [Oenothera sinuata var. hirsuta]
Length=568

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GES+EG NFSTKTLL+ YLEA+SD+P  P T LPKI
Sbjct  533  GESVEGFNFSTKTLLTRYLEATSDVPAAPSTLLPKI  568



>ref|XP_007221807.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|EMJ23006.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|AGH25539.1| phosphoglucose isomerase [Prunus persica]
Length=568

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SIL PSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILFPSLNAYNIGQLLAIYEHRVAVQGFLWGINSFDQWGVELGKSLATQVRKQLNASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            G+ IEG N+ST TLL  YLEASSDIP D PT LP+I
Sbjct  533  GQPIEGFNYSTTTLLKKYLEASSDIPADLPTLLPRI  568



>emb|CAC85684.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  431  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  490

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  491  GEPVEGFNFSTKTLLTRYLEATSDVPTDPSTLLPNI  526



>emb|CAC85683.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  431  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  490

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  491  GEPVEGFNFSTKTLLTRYLEATSDVPTDPSTLLPNI  526



>sp|P54236.1|G6PI1_CLAFR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia franciscana]
 emb|CAA61576.1| glucose-6-phosphate isomerase [Clarkia franciscana]
Length=568

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>emb|CAB55566.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=568

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>ref|XP_004152701.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 ref|XP_004160034.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 gb|KGN62593.1| hypothetical protein Csa_2G361580 [Cucumis sativus]
Length=566

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  471  SILLPSLNAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLSASRTK  530

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE IEG N ST TLL  YLEASSD+P D PT LP+I
Sbjct  531  GEPIEGFNHSTTTLLKRYLEASSDVPSDLPTLLPRI  566



>sp|P54240.1|G6PI1_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56693.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61566.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=568

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>gb|ABB17077.1| glucose-6-phosphate isomerase [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=85

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = -2

Query  388  GQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXNFSTK  209
            GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS A+QVRKQL ASRKKGES+EG NFSTK
Sbjct  2    GQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGFNFSTK  61

Query  208  TLLSXYLEASSDIPXDPPTALPKI  137
            TL++ YLEAS+D+P DP T LPKI
Sbjct  62   TLITTYLEASADVPSDPSTLLPKI  85



>ref|XP_011083695.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
 ref|XP_011083696.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
Length=568

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHRVAV+GF+WGINSFDQWGVELGKS ATQVRKQL ASRKK
Sbjct  473  SILLPSLNAYNVGQLLAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE++EG NFST T+L  YLEAS+D+P +  T LPK+
Sbjct  533  GEAVEGFNFSTTTVLKRYLEASADVPKEDCTILPKM  568



>sp|P54241.1|G6PI2_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61571.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLA+ EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAVYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE++ EG NFSTKTLL+ YLEASSD+P DP T LPKI
Sbjct  533  GEAVEEGFNFSTKTLLTRYLEASSDVPADPSTLLPKI  569



>emb|CAB55567.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=569

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 85/97 (88%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE++ EG NFSTKTLL+ YLEA+SD+P DP T LPKI
Sbjct  533  GEAVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>sp|P54237.1|G6PI1_CLAMI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia mildrediae]
 emb|CAA61569.1| glucose-6-phosphate isomerase [Clarkia mildrediae]
Length=568

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL  SR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLTKYLEATSDVPADPSTLLPNI  568



>sp|P54234.1|G6PI1_CLAAR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia arcuata]
 emb|CAA61575.1| glucose-6-phosphate isomerase [Clarkia arcuata]
Length=568

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+ Y  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDGYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL  YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLERYLEATSDVPADPSTLLPNI  568



>gb|AFK39110.1| unknown [Medicago truncatula]
Length=568

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLPSLNAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL A R K
Sbjct  473  SLLLPSLNAYNVGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNAFRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE I+G NFS  T+++ YL+AS+D+P DPPT LP+I
Sbjct  533  GEPIQGFNFSATTMITRYLQASADVPADPPTTLPQI  568



>emb|CAC85669.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85648.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=168

 Score =   148 bits (374),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  82   SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  141

Query  244  GESIEGXNFSTKTLLSXYLEASSDIP  167
            GE +EG NFSTKTLL+ YLEA+SD+P
Sbjct  142  GEPVEGFNFSTKTLLTRYLEATSDVP  167



>sp|P54242.1|G6PI2_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56694.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61567.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=569

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YLEA+SD+P DP T LPKI
Sbjct  533  GEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>sp|P54239.1|G6PI1_CLAWI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia williamsonii]
 emb|CAA61574.1| glucose-6-phosphate isomerase [Clarkia williamsonii]
Length=568

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL  SR K
Sbjct  473  SLLLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>emb|CAC86122.1| cytosolic phosphoglucose isomerase [Clarkia modesta]
Length=569

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YLEA+SD+P DP T LPKI
Sbjct  533  GEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>sp|P34797.1|G6PI3_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2B; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI, 
partial [Clarkia lewisii]
 emb|CAA50403.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
Length=317

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  221  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  280

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A++D+P DP T LP I
Sbjct  281  GEPVEEGFNFSTKTLLTRYLQATTDVPADPSTLLPNI  317



>sp|P54235.1|G6PI1_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61570.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YLEA+SD+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  569



>emb|CAC82578.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>emb|CAC84508.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
 emb|CAC85681.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85682.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  431  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  490

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  491  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  527



>emb|CAC84514.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=527

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR  
Sbjct  431  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVN  490

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LPKI
Sbjct  491  GEPVEEGFNFSTKTLLTRYLKATSDVPADPSTLLPKI  527



>ref|XP_008377469.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=156

 Score =   144 bits (363),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  68   NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  127

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEA+ DIP D PT LP+I
Sbjct  128  NYSTTTLLTKYLEATKDIPADLPTLLPQI  156



>sp|P29333.1|G6PI2_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2A; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA45616.1| glucose-6-phosphate isomerase [Clarkia lewisii]
 emb|CAA61565.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A++D+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLQATTDVPADPSTLLPNI  569



>ref|XP_006434973.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
 gb|ESR48213.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
Length=568

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K E IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DPPT LP+I
Sbjct  540  NFSTTTLLTRYLEASSDIPSDPPTLLPRI  568



>ref|XP_004489355.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489356.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004489357.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X3 [Cicer arietinum]
Length=568

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR KGE I+G 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YLEAS+DIP DPPT LP+I
Sbjct  540  NFSTTTMLTRYLEASADIPADPPTTLPQI  568



>emb|CAC84511.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=526

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL  SR K
Sbjct  431  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVK  490

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
             + +EG NFSTKTLL  YLEA+SD+P DP T LP I
Sbjct  491  AKPVEGFNFSTKTLLIRYLEATSDVPADPSTLLPNI  526



>gb|EYU45143.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=568

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLPSLNAYN GQLLAI EHRVAV+GF+WGINSFDQWGVELGKS ATQVRKQL ASRKK
Sbjct  473  SLLLPSLNAYNIGQLLAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
             E +EG NFST  LL+ YLEAS+DI  +  T LPK+
Sbjct  533  AEPVEGFNFSTTALLTRYLEASTDISKEDCTVLPKM  568



>emb|CAC85685.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=516

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  420  SILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  479

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  480  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  516



>ref|XP_010313627.1| PREDICTED: glucose-6-phosphate isomerase isoform X1 [Solanum 
lycopersicum]
Length=574

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASRKKGES+EG N
Sbjct  487  AYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFN  546

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FSTK L++ YLEAS+D+P DP T LP I
Sbjct  547  FSTKMLITRYLEASADVPSDPSTLLPNI  574



>ref|NP_001265881.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
 gb|ABE03628.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
Length=568

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASRKKGES+EG N
Sbjct  481  AYNIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FSTK L++ YLEAS+D+P DP T LP I
Sbjct  541  FSTKMLITRYLEASADVPSDPSTLLPNI  568



>emb|CAC85686.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  431  SILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  490

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  491  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  527



>emb|CAC82579.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>sp|P34796.1|G6PI1_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1A; Short=GPI; 
AltName: Full=PGI2; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA50402.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
 emb|CAA61564.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL  SR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>ref|XP_007017512.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
 gb|EOY14737.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
Length=537

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR KG+ +EG 
Sbjct  449  NAYNIGQLLASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGF  508

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DPPT LP+I
Sbjct  509  NFSTTTLLTRYLEASSDIPADPPTLLPRI  537



>ref|XP_007017511.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
 gb|EOY14736.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
Length=568

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR KG+ +EG 
Sbjct  480  NAYNIGQLLASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DPPT LP+I
Sbjct  540  NFSTTTLLTRYLEASSDIPADPPTLLPRI  568



>gb|KCW67833.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=566

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE +EG N
Sbjct  479  AYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFN  538

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            +ST T+L+ YLEA+SD+P DPPT LP+I
Sbjct  539  YSTATMLTRYLEATSDVPSDPPTLLPRI  566



>ref|XP_010060937.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 ref|XP_010060938.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 gb|KCW67834.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
 gb|KCW67835.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=568

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE +EG N
Sbjct  481  AYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            +ST T+L+ YLEA+SD+P DPPT LP+I
Sbjct  541  YSTATMLTRYLEATSDVPSDPPTLLPRI  568



>emb|CAC85647.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score =   142 bits (359),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  82   SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  141

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIP  167
            GE + EG NFSTKTLL+ YL+A+SD+P
Sbjct  142  GEPVEEGFNFSTKTLLTRYLQATSDVP  168



>sp|P54238.1|G6PI1_CLARO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia rostrata]
 emb|CAA61572.1| glucose-6-phosphate isomerase [Clarkia rostrata]
Length=570

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQ+LAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL  SR K
Sbjct  473  SILLPTLDAYRIGQVLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHGSRVK  532

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE + EG NFSTKTLL+ YL+A+SD+P DP T LP I
Sbjct  533  GEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>emb|CDP07527.1| unnamed protein product [Coffea canephora]
Length=210

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR+KGE IEG N
Sbjct  123  AYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHVSRRKGEPIEGFN  182

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FST T+LS YL+AS+D+P DP T LPK+
Sbjct  183  FSTTTVLSRYLQASADVPSDPSTLLPKM  210



>gb|KDO84534.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=441

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K E IEG 
Sbjct  353  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGF  412

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DP T LP+I
Sbjct  413  NFSTTTLLTRYLEASSDIPSDPSTLLPRI  441



>ref|XP_010677508.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=568

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLPSL AYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS A+QVRKQL ASR  
Sbjct  473  SLLLPSLTAYNVGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLHASRSN  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE+I+G NFST T+L+ YL+ SSD+P + PT LP++
Sbjct  533  GEAIQGFNFSTTTVLTKYLQGSSDVPAELPTKLPQV  568



>ref|XP_007017510.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY14735.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
Length=714

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR KG+ +EG 
Sbjct  626  NAYNIGQLLASYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTKGDPVEGF  685

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DPPT LP+I
Sbjct  686  NFSTTTLLTRYLEASSDIPADPPTLLPRI  714



>ref|XP_006473486.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Citrus 
sinensis]
Length=568

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K E IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DP T LP+I
Sbjct  540  NFSTTTLLTRYLEASSDIPSDPSTLLPRI  568



>ref|NP_001242028.1| uncharacterized protein LOC100807719 [Glycine max]
 gb|ACU20878.1| unknown [Glycine max]
Length=568

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE ++G 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YL+ASSD+P D PT LPKI
Sbjct  540  NFSTTTMLTRYLQASSDVPADLPTVLPKI  568



>gb|KHN45846.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE ++G 
Sbjct  462  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGF  521

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YL+ASSD+P D PT LPKI
Sbjct  522  NFSTTTMLTRYLQASSDVPADLPTVLPKI  550



>ref|XP_004291883.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
 ref|XP_011459557.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR +G+S+EG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRTEGKSVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFSTKTL++ YLEASSDIP + PT LP+I
Sbjct  540  NFSTKTLMTKYLEASSDIPAELPTLLPRI  568



>gb|KDP38492.1| hypothetical protein JCGZ_04417 [Jatropha curcas]
Length=568

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILL +L+AY  GQLLAI EHRV VQGFIWGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLSALDAYKIGQLLAIYEHRVVVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFST +LL  YLE SSD+P +P T LP+I
Sbjct  533  GEPVEGFNFSTTSLLKRYLEESSDVPKNPQTLLPRI  568



>gb|KDO84533.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=606

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K E IEG 
Sbjct  518  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGF  577

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEASSDIP DP T LP+I
Sbjct  578  NFSTTTLLTRYLEASSDIPSDPSTLLPRI  606



>ref|XP_002510371.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF52558.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
Length=568

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILL SL+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLSSLDAYKIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLNASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG NFST T+L+ YLE +S++P  P T LP+I
Sbjct  533  GEPVEGFNFSTTTMLTRYLEETSEVPAKPQTLLPRI  568



>emb|CAC85670.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85671.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score =   140 bits (354),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  82   SILLPTLDAYRIGQLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  141

Query  244  GESI-EGXNFSTKTLLSXYLEASSDIP  167
            GE + EG NFSTKTLL+ YL+A+SD+P
Sbjct  142  GEPVEEGFNFSTKTLLTRYLQATSDVP  168



>ref|XP_007136588.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
 gb|ESW08582.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
Length=568

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE ++G N
Sbjct  481  AYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPVQGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FST T+L+ YL+ASSDIP D PTALPKI
Sbjct  541  FSTTTMLNRYLQASSDIPADLPTALPKI  568



>ref|XP_010106007.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
 gb|EXC07277.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
Length=547

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE ++G 
Sbjct  459  NAYNIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRTKGEPVQGF  518

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N ST TLL+ YLEASSD+P D PT LP+I
Sbjct  519  NCSTTTLLTRYLEASSDVPSDLPTLLPRI  547



>ref|XP_006837344.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
 gb|ERN00198.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
Length=568

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
             +LLPSLNAYN GQLLAI EHRVAV+GF WGINSFDQWGVELGKS A+QVRKQL  SR K
Sbjct  473  CLLLPSLNAYNIGQLLAIYEHRVAVEGFTWGINSFDQWGVELGKSLASQVRKQLNLSRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE +EG N+ST T+L+ YLEA S IP +P T LPK+
Sbjct  533  GEPVEGFNYSTTTMLTKYLEAKSPIPSEPCTILPKV  568



>ref|XP_008357232.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=288

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  200  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  259

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEA+ DIP D PT LP+I
Sbjct  260  NYSTTTLLTKYLEATKDIPADLPTLLPQI  288



>gb|EYU45142.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=569

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQ-LLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRK  248
            S+LLPSLNAYN GQ LLAI EHRVAV+GF+WGINSFDQWGVELGKS ATQVRKQL ASRK
Sbjct  473  SLLLPSLNAYNIGQVLLAIYEHRVAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRK  532

Query  247  KGESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            K E +EG NFST  LL+ YLEAS+DI  +  T LPK+
Sbjct  533  KAEPVEGFNFSTTALLTRYLEASTDISKEDCTVLPKM  569



>ref|XP_006582469.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase, 
cytosolic 2-like [Glycine max]
Length=462

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE I+G 
Sbjct  374  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGF  433

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YL+ASSD+P D  T LPKI
Sbjct  434  NFSTTTMLTRYLQASSDVPADLSTVLPKI  462



>gb|KHN22258.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE I+G 
Sbjct  462  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNASRTKGEPIQGF  521

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YL+ASSD+P D  T LPKI
Sbjct  522  NFSTTTMLTRYLQASSDVPADLSTVLPKI  550



>gb|EPS71211.1| glucose-6-phosphate isomerase [Genlisea aurea]
Length=569

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSLNAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASRKK
Sbjct  473  SILLPSLNAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLHASRKK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIP-XDPPTALPK  140
            GE+I G NFST  LL  YL+ASS+ P  +  T LPK
Sbjct  533  GEAIRGFNFSTTKLLEKYLQASSEDPHTEEITVLPK  568



>ref|XP_008377470.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B [Malus 
domestica]
Length=389

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  301  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  360

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEA+ DIP D PT LP+I
Sbjct  361  NYSTTTLLTKYLEATKDIPADLPTLLPQI  389



>gb|AAY85660.1| cytosolic glucose-6-phosphate isomerase [Helianthus annuus]
Length=566

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            +AY  GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASRKKGES+EG 
Sbjct  478  DAYRIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHASRKKGESVEGF  537

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST  LL+ YLEAS+D+P +P T LPKI
Sbjct  538  NFSTTKLLTRYLEASADVPSEPTTLLPKI  566



>gb|KJB14513.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=569

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHRV V+GF+WGINSFDQWGVELGKS ATQVRKQL ASR K E +EG 
Sbjct  481  NAYNIGQLLASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGF  540

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YL+ASSDIP +PPT LP+I
Sbjct  541  NFSTTTLLTRYLQASSDIPAEPPTLLPRI  569



>gb|KJB14509.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14510.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14512.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=568

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHRV V+GF+WGINSFDQWGVELGKS ATQVRKQL ASR K E +EG 
Sbjct  480  NAYNIGQLLASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YL+ASSDIP +PPT LP+I
Sbjct  540  NFSTTTLLTRYLQASSDIPAEPPTLLPRI  568



>ref|XP_008377422.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Malus 
domestica]
Length=568

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEA+ DIP D PT LP+I
Sbjct  540  NYSTTTLLTKYLEATKDIPADLPTLLPQI  568



>ref|XP_008220896.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic, partial 
[Prunus mume]
Length=556

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SIL PSLNAYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILFPSLNAYNIGQLLAIYEHRVAVQGFLWGINSFDQWGVELGKSLATQVRKQLNASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLEASSD  173
            G+ IEG N+ST TLL  YLEASSD
Sbjct  533  GQPIEGFNYSTTTLLKKYLEASSD  556



>ref|XP_002312387.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
 gb|EEE89754.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
Length=568

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            +AY  GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE +EG 
Sbjct  480  DAYKIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YL+ SS++P +PPT LP+I
Sbjct  540  NFSTTTMLTKYLKESSEVPANPPTILPRI  568



>ref|XP_008377333.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
 ref|XP_008377335.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
Length=568

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST +LL+ YLEAS DIP D PT LP+I
Sbjct  540  NYSTTSLLTKYLEASKDIPADLPTLLPQI  568



>ref|XP_010263691.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010263692.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
Length=568

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS A+QVRKQL ASR KGE +EG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+L+ YLEA S +P +P T LPK+
Sbjct  540  NFSTTTMLNKYLEAKSRVPANPTTVLPKV  568



>ref|XP_008444704.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444705.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444706.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
Length=566

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS ATQVRKQL ASR KG+ IEG N
Sbjct  479  AYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKGQPIEGFN  538

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST TLL  YLEASSD+P D PT LP+I
Sbjct  539  HSTTTLLKRYLEASSDVPSDLPTLLPRI  566



>ref|XP_003554193.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Glycine 
max]
Length=568

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHRVAV+GFIWGINSFDQWGVELGKS A+QVRKQL ASR KGE ++G 
Sbjct  480  NAYNIGQLLAIYEHRVAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVQGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST  +L+ YL+AS+D+P D PT LP+I
Sbjct  540  NFSTTAMLTRYLQASADVPADLPTRLPQI  568



>gb|KHN34179.1| Glucose-6-phosphate isomerase, cytosolic 1 [Glycine soja]
Length=552

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHRVAV+GFIWGINSFDQWGVELGKS A+QVRKQL ASR KGE ++G 
Sbjct  464  NAYNIGQLLAIYEHRVAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRTKGEPVQGF  523

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST  +L+ YL+AS+D+P D PT LP+I
Sbjct  524  NFSTTAMLTRYLQASADVPADLPTRLPQI  552



>ref|XP_009365601.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
 ref|XP_009365602.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
Length=568

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR +G+ IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTEGQPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEA+ DIP D PT LP+I
Sbjct  540  NYSTTTLLTKYLEATKDIPADLPTLLPQI  568



>emb|CAB55568.1| cytosolic phosphoglucose isomerase, partial [Clarkia gracilis]
Length=256

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  177  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  236

Query  244  GESIEGXNFSTKTLLSXYLE  185
            GE++EG NFSTKTLL+ YLE
Sbjct  237  GETVEGFNFSTKTLLTRYLE  256



>ref|XP_002282774.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 ref|XP_010664679.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI19685.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ++R KG+ +EG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNSARTKGKPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL  YLEASSDIP DP T LP++
Sbjct  540  NYSTTTLLKRYLEASSDIPSDPCTLLPQM  568



>ref|XP_011021922.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Populus 
euphratica]
Length=568

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            +AY  GQLLAI EHRVAVQGFIWGINSFDQWGVELGKS ATQVRKQL ASR KGE ++G 
Sbjct  480  DAYKIGQLLAIYEHRVAVQGFIWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVDGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST T+LS +L+ SS++P +PPT LP+I
Sbjct  540  NFSTTTMLSKFLKESSEVPANPPTILPRI  568



>gb|AEH27532.1| putative glucose-6-phosphateisomerase [Amorphophallus konjac]
Length=210

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AYN G+LLA+ EHR+AV+GFIWGINSFDQWGVELGKS A+QVRKQL  SR  
Sbjct  115  SILLPALSAYNIGELLAMYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLHLSRTA  174

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            GE ++G N+ST  LL+ YLEA + +P    T LPK+
Sbjct  175  GEPVKGFNYSTTALLTRYLEAETGLPSGSSTVLPKV  210



>ref|XP_009364475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
 ref|XP_009364484.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
Length=568

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N+ST TLL+ YLEAS+D P   PT LP+I
Sbjct  540  NYSTATLLTKYLEASTDFPAYLPTLLPQI  568



>emb|CAC82581.1| cytosolic phosphoclucose isomerase, partial [Clarkia delicata]
Length=127

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -2

Query  385  QLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESI-EGXNFSTK  209
            +LL I EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR KGE + EG NFSTK
Sbjct  44   KLLGIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVKGEPVEEGFNFSTK  103

Query  208  TLLSXYLEASSDIPXDPPTALPKI  137
            TLL+ YL+A+SD+P DP T LP I
Sbjct  104  TLLTRYLQATSDVPADPSTLLPNI  127



>emb|CAD24788.1| cytosolic phosphoglucose isomerase, partial [Clarkia heterandra]
Length=559

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS ATQVRKQL ASR K
Sbjct  473  SILLPTLDAYRIGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATQVRKQLHASRVK  532

Query  244  GESI--EGXNFSTKTLLSXYLEASSDI  170
            GE +  EG NFSTKTLL+ YL+A+SD+
Sbjct  533  GEPVEEEGFNFSTKTLLTRYLQATSDV  559



>gb|KDO84532.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=583

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -2

Query  385  QLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXNFSTKT  206
            +LLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL ASR K E IEG NFST T
Sbjct  501  KLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLHASRMKREPIEGFNFSTTT  560

Query  205  LLSXYLEASSDIPXDPPTALPKI  137
            LL+ YLEASSDIP DP T LP+I
Sbjct  561  LLTRYLEASSDIPSDPSTLLPRI  583



>ref|XP_007151167.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23161.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=568

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS A+QVRKQL  SR +GE ++G 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNVSRTQGEPVQGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            N ST ++L+ YL+AS+D+P D PT LP+I
Sbjct  540  NSSTTSMLTRYLQASADVPADLPTRLPQI  568



>ref|XP_010254873.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nelumbo 
nucifera]
Length=568

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS A+QVRKQL ASR KGE +EG 
Sbjct  480  NAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLASQVRKQLNASRIKGEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST  +L+ YLEA S +   P T LPK+
Sbjct  540  NFSTTKMLNKYLEAKSRVLAHPSTILPKM  568



>sp|O82059.2|G6PI_SPIOL RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Spinacia oleracea]
 emb|CAA03983.1| glucose-6-phosphate isomerase [Spinacia oleracea]
Length=566

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAV+GF+WGINSFDQWGVELGKS A QVRKQL ASR  GE+++G N
Sbjct  481  AYNVGQLLAIYEHRVAVEGFVWGINSFDQWGVELGKSLANQVRKQLHASRTNGEAVKGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALP  143
            FST T+++ YL+ +SD+P + PT LP
Sbjct  541  FSTTTVMAKYLQETSDVPAELPTKLP  566



>gb|KJB14511.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=545

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -2

Query  385  QLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXNFSTKT  206
            +LLA  EHRV V+GF+WGINSFDQWGVELGKS ATQVRKQL ASR K E +EG NFST T
Sbjct  463  KLLASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGFNFSTTT  522

Query  205  LLSXYLEASSDIPXDPPTALPKI  137
            LL+ YL+ASSDIP +PPT LP+I
Sbjct  523  LLTRYLQASSDIPAEPPTLLPRI  545



>dbj|BAA23177.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23178.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23176.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23181.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23183.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23180.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23179.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23184.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23185.2| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>ref|XP_009407687.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407688.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=567

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLPS +AYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGK  ATQVRKQL  SR +
Sbjct  473  SLLLPSFDAYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKVLATQVRKQLHLSRTE  532

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            G  ++G NFST TLL+ YLE     P D    LP++
Sbjct  533  GGPVQGFNFSTTTLLTKYLEVEPGNPSD-SNELPRL  567



>dbj|BAA23182.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+W INSFDQWGVELGKS A+QVRKQL  SR K E +EG 
Sbjct  480  NAYNVGQLLAIYEHRIAVEGFVWXINSFDQWGVELGKSLASQVRKQLHLSRTKAEPVEGF  539

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLEA + +P D  + LPK+
Sbjct  540  NFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAB83916.1| cytosolic phosphoglucose isomerase, partial [Dryopteris caudipinna]
Length=293

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 73/99 (74%), Gaps = 5/99 (5%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP L  Y  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+ VRKQ+ ASR +
Sbjct  193  SILLPKLTPYTLGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASHVRKQINASRSQ  252

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXD-----PPTALP  143
            G+S+ G N+ST TLL+ YL+  S++        PP  LP
Sbjct  253  GKSVAGFNYSTSTLLNHYLKVKSNVYTSTHDSFPPAILP  291



>gb|ABK24817.1| unknown [Picea sitchensis]
Length=346

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLPSL AYN GQLLA+ EHR+AVQGFIWGINSFDQWGVELGKS A++VR QL  SR +
Sbjct  253  SILLPSLTAYNVGQLLAMYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRAQLNMSRTE  312

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPXD  161
            G+ +EG N ST  L+  YL+ ++ IP D
Sbjct  313  GKPVEGFNHSTAMLIKRYLKENAPIPVD  340



>ref|XP_008353564.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=281

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLAI EHR+AV+GF+WGINSFDQWGVELGKS A+QVRKQL ASR KG+ IEG 
Sbjct  200  NAYNIGQLLAIYEHRIAVEGFVWGINSFDQWGVELGKSLASQVRKQLNASRTKGQPIEGF  259

Query  223  NFSTKTLLSXYLEA  182
            N+ST TLL+ YLE 
Sbjct  260  NYSTTTLLTKYLEV  273



>ref|XP_010519111.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Tarenaya hassleriana]
 ref|XP_010519112.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Tarenaya hassleriana]
Length=561

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -2

Query  397  YNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXNF  218
            YN GQLLAI EHRVAVQGF+WGINSFDQWGVELGKS AT+VRKQL ASR +G +I+G NF
Sbjct  483  YNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKSLATRVRKQLNASRTEGAAIDGFNF  542

Query  217  STKTLLSXYLEASSD  173
            ST TLL  YLEASSD
Sbjct  543  STTTLLQRYLEASSD  557



>ref|XP_010942803.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Elaeis 
guineensis]
Length=567

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL  SR KGE + G N
Sbjct  481  AYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNLSRTKGEPVAGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FST TLL+ YLE  S +  +  T LPK+
Sbjct  541  FSTSTLLTRYLEGDSGVQSN-STMLPKM  567



>ref|XP_010935387.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Elaeis 
guineensis]
Length=224

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+ FI GINSFDQWGVELGKS ATQVRKQL  SR KGE + G N
Sbjct  138  AYNIGQLLAIYEHRIAVEDFIRGINSFDQWGVELGKSLATQVRKQLNLSRTKGEPVVGFN  197

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            FST TLL+ YLEA S +  +  T LPK+
Sbjct  198  FSTSTLLTRYLEADSGVQSN-STMLPKM  224



>emb|CDX95171.1| BnaC09g16990D [Brassica napus]
Length=201

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  123  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFN  182

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE S +
Sbjct  183  YSTTTLLKRYLETSPE  198



>dbj|BAB17655.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=552

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  474  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  533

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  534  YSTTTLLKRYLETSSE  549



>ref|XP_002865489.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41748.1| glucose-6-phosphate isomerase [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>sp|Q9FXM5.2|G6PI_ARAHG RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis halleri 
subsp. gemmifera]
Length=560

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>sp|Q9FXM4.1|G6PI_ARALP RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis lyrata 
subsp. petraea]
 dbj|BAB17656.1| cytosolic phosphoglucose isomerase [Arabidopsis lyrata subsp. 
petraea]
Length=560

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>tpg|DAA51693.2| TPA: glucose-6-phosphate isomerase, cytosolic(Phosphoglucose 
isomerase)(PGI) [Zea mays]
Length=209

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL  +R +G+ +EG N
Sbjct  123  AYEVGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGTRMEGKPVEGFN  182

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P D  T LPK+
Sbjct  183  HSTSSLLARYLAVKPSTPYD-TTVLPKV  209



>ref|XP_008783474.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
 ref|XP_008783475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Phoenix 
dactylifera]
Length=567

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHR+AV+GFIWGINSFDQWGVELGKS ATQVRKQL  SR +G+ + G N
Sbjct  481  AYNIGQLLAIYEHRIAVEGFIWGINSFDQWGVELGKSLATQVRKQLNLSRTQGKPVVGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
            F T TLL+ YLE  S +  +  T LPK+
Sbjct  541  FGTSTLLTRYLEVDSGVQSE-STVLPKM  567



>dbj|BAB17637.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17635.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17640.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>gb|AAK50107.1|AF372970_1 AT5g42740/MJB21_12 [Arabidopsis thaliana]
 gb|AAM16223.1| AT5g42740/MJB21_12 [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17639.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=559

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  481  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  540

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  541  YSTTTLLKRYLETSSE  556



>ref|XP_010442128.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G +IEG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAIEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17643.1| cytosolic phosphoglucose isonerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|NP_199088.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 sp|P34795.1|G6PI_ARATH RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Arabidopsis thaliana]
 emb|CAA48940.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
 dbj|BAB10630.1| glucose-6-phosphate isomerase, cytosolic [Arabidopsis thaliana]
 dbj|BAB17638.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17641.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17642.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17644.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17647.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17651.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17652.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 dbj|BAB17653.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 emb|CAD11677.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
 gb|AED94855.1| glucose-6-phosphate isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17646.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17650.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17654.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17649.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLQSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17648.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17636.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAB17645.1| cytosolic phosphoglucose isomerase [Arabidopsis thaliana]
Length=560

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77715.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77709.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77720.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77710.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77716.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77721.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77708.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77711.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77712.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC11915.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
 dbj|BAC77718.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77717.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77713.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77714.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_010494215.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494216.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494217.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
 ref|XP_010494218.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Camelina 
sativa]
Length=560

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_010481956.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X3 
[Camelina sativa]
Length=560

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_010481952.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
 ref|XP_010481958.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Camelina sativa]
Length=560

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_010481955.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
 ref|XP_010481957.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Camelina sativa]
Length=560

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_006281946.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
 gb|EOA14844.1| hypothetical protein CARUB_v10028158mg [Capsella rubella]
Length=560

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY+ GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G  +EG N
Sbjct  482  AYSVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTPLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>gb|KJB14514.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=584

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            NAYN GQLLA  EHRV V+GF+WGINSFDQWGVELGKS ATQVRKQL ASR K E +EG 
Sbjct  480  NAYNIGQLLASYEHRVTVEGFVWGINSFDQWGVELGKSLATQVRKQLNASRTKSEPVEGF  539

Query  223  NFSTKTLLSXYLE  185
            NFST TLL+ YL+
Sbjct  540  NFSTTTLLTRYLQ  552



>emb|CDY64430.1| BnaA09g16190D [Brassica napus]
Length=568

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  490  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFN  549

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE S +
Sbjct  550  YSTTTLLKRYLETSPE  565



>ref|XP_009114042.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brassica 
rapa]
Length=560

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGAAPEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE S +
Sbjct  542  YSTTTLLKRYLETSPE  557



>gb|AAC08411.1| cytosolic phosphoglucose isomerase [Leavenworthia crassa]
Length=560

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  A+QVRKQL +SR +G  ++G N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLASQVRKQLHSSRTQGTELDGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>dbj|BAC77719.1| cytosolic phosphoglucose isomerase [Arabidopsis halleri subsp. 
gemmifera]
Length=560

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+WGINSFDQWGVELG+  AT VRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGRVLATHVRKQLHSSRTQGTTLEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLIRYLETSSE  557



>ref|XP_009381882.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -2

Query  403  NAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGX  224
            +AYN G+LLAI EHR+AV+GFIWGINSFDQWGVELGK  A+QVRKQL  S  K E ++G 
Sbjct  539  DAYNIGKLLAIYEHRIAVEGFIWGINSFDQWGVELGKVLASQVRKQLHLSHTKREPVQGF  598

Query  223  NFSTKTLLSXYLEASSDIPXDPPTALPKI  137
            NFST TLL+ YLE     P D  T LP++
Sbjct  599  NFSTTTLLTRYLEVEPGTPSD-STMLPRV  626



>ref|XP_004981572.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Setaria 
italica]
Length=567

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL  SR +G+ +EG N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGSRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P D  T LPK+
Sbjct  541  HSTSSLLARYLAVKPSTPYD-TTVLPKV  567



>gb|AED99453.1| PgiC protein [Poa palustris]
Length=567

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ YL      P D  T LPK+
Sbjct  541  PSSASLLARYLAVEPSTPYD-TTVLPKV  567



>gb|AED99454.1| PgiC protein [Festuca ovina]
Length=567

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ YL      PXD  T LPK+
Sbjct  541  PSSASLLARYLAVKPSTPXD-TTVLPKV  567



>ref|XP_002968611.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
 gb|EFJ30865.1| hypothetical protein SELMODRAFT_89539 [Selaginella moellendorffii]
Length=564

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP+L  Y  GQLLA+ EHR+AVQGFIWGINSFDQWGVELGK  A++VR Q+ ASR K
Sbjct  475  SMLLPTLKPYTVGQLLALYEHRIAVQGFIWGINSFDQWGVELGKVLASRVRTQMNASRTK  534

Query  244  GESIEGXNFSTKTLLSXYLE  185
            G+ +EG N ST TLL+ YL+
Sbjct  535  GKPVEGFNHSTTTLLNRYLK  554



>ref|NP_001105368.1| glucose-6-phosphate isomerase, cytosolic [Zea mays]
 sp|P49105.1|G6PI_MAIZE RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Zea mays]
 gb|AAA82734.1| glucose-6 phosphate isomerase [Zea mays]
 gb|ACF87923.1| unknown [Zea mays]
 gb|ACG35658.1| glucose-6-phosphate isomerase, cytosolic B [Zea mays]
 gb|ACN30887.1| unknown [Zea mays]
Length=567

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL  +R +G+ +EG N
Sbjct  481  AYEVGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHGTRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P D  T LPK+
Sbjct  541  HSTSSLLARYLAVKPSTPYD-TTVLPKV  567



>dbj|BAC11914.1| cytosolic phosphoglucose isomerase [Crucihimalaya himalaica]
Length=560

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI EHRVAVQGF+W INSFDQWGVELGK  A QVRKQL +SR +G+++EG N
Sbjct  482  AYNVGQLLAIYEHRVAVQGFVWVINSFDQWGVELGKVLAAQVRKQLHSSRTQGKALEGFN  541

Query  220  FSTKTLLSXYLEASSD  173
            +ST TLL  YLE SS+
Sbjct  542  YSTTTLLKRYLETSSE  557



>ref|XP_001760206.1| predicted protein [Physcomitrella patens]
 gb|EDQ74962.1| predicted protein [Physcomitrella patens]
Length=571

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+LNAY  GQLL++ E+R+AVQGF+WGINSFDQWGVELGKS AT+VR QL  +R K
Sbjct  472  SILLPALNAYTVGQLLSLYENRIAVQGFVWGINSFDQWGVELGKSLATKVRSQLNEARTK  531

Query  244  GESIEGXNFSTKTLLSXYLEASSDIP-XDPPTALP  143
               ++G N+ST  LL  YL+  + +   DP    P
Sbjct  532  DAPVQGFNYSTTYLLKHYLKGKTSVANSDPKNVFP  566



>ref|XP_002975871.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
 gb|EFJ22776.1| hypothetical protein SELMODRAFT_104526 [Selaginella moellendorffii]
Length=562

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP+L  Y  GQLLA+ EHR+AVQGFIWGINSFDQWGVELGK  A++VR Q+ ASR K
Sbjct  473  SMLLPTLKPYTVGQLLALYEHRIAVQGFIWGINSFDQWGVELGKVLASRVRTQMNASRTK  532

Query  244  GESIEGXNFSTKTLLSXYLE  185
            G+ ++G N ST TLL+ YL+
Sbjct  533  GKPVQGFNHSTTTLLNRYLK  552



>gb|AED99455.1| PgiC2-3 protein [Festuca ovina]
Length=567

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A++VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ YL      P D  T LPK+
Sbjct  541  PSSASLLARYLAVEPSTPYD-TTVLPKV  567



>ref|XP_006403357.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403358.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 ref|XP_006403359.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44810.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44811.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
 gb|ESQ44812.1| hypothetical protein EUTSA_v10003173mg [Eutrema salsugineum]
Length=560

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHRVAVQGF+WGINSFDQWGVELGK  ATQVRKQL +SR +G + EG N
Sbjct  482  AYTVGQLLAIYEHRVAVQGFVWGINSFDQWGVELGKVLATQVRKQLHSSRTQGTAPEGFN  541

Query  220  FSTKTLLSXYLEASS  176
            FST TLL  YLE + 
Sbjct  542  FSTTTLLKRYLETNP  556



>gb|ABK00059.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=614

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L  Y  GQLLA+ EHRVAVQG+IWGINSFDQWGVELGKS A +VR Q+ A+R K
Sbjct  511  SILLPNLTPYTVGQLLALYEHRVAVQGWIWGINSFDQWGVELGKSLAGKVRTQMNAARTK  570

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPX-DPPTALP  143
             + + G N+ST TLL+ YL+  + +   DP    P
Sbjct  571  TQPLSGFNYSTTTLLTRYLQGKTQLLYPDPHDVFP  605



>gb|ABK00065.1| cytosolic glucose-6-phosphate isomerase [Marchantia polymorpha]
Length=653

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L  Y  GQLLA+ EHRVAVQG+IWGINSFDQWGVELGKS A +VR Q+ A+R K
Sbjct  550  SILLPNLTPYTVGQLLALYEHRVAVQGWIWGINSFDQWGVELGKSLAGKVRTQMNAARTK  609

Query  244  GESIEGXNFSTKTLLSXYLEASSDIPX-DPPTALP  143
             + + G N+ST TLL+ YL+  + +   DP    P
Sbjct  610  TQPLSGFNYSTTTLLTRYLQGKTQLLYPDPHDVFP  644



>ref|XP_006651865.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic B-like [Oryza 
brachyantha]
Length=907

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ ++G N
Sbjct  821  AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVQGFN  880

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL     IP +  T LPK+
Sbjct  881  SSTASLLTRYLAVEPSIPFN-TTTLPKV  907



>ref|XP_001782795.1| predicted protein [Physcomitrella patens]
 gb|EDQ52372.1| predicted protein [Physcomitrella patens]
Length=577

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+A+  GQLL++ EHR+AVQGFIW +NSFDQWGVELGKS A++VR QL ASR +
Sbjct  491  SILLPTLDAFTIGQLLSLYEHRIAVQGFIWNVNSFDQWGVELGKSLASRVRTQLNASRTR  550

Query  244  GESIEGXNFSTKTLLSXYLEASSDI  170
               ++G N+ST  LL+ YL+  + +
Sbjct  551  DAPLQGFNYSTTYLLTHYLKGKTPV  575



>gb|ABE41790.1| glucose-6-phosphate isomerase [Triticum aestivum]
Length=567

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+ VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ +L      P D  T LPK+
Sbjct  541  PSSASLLTRFLAVKPSTPYD-TTVLPKV  567



>gb|EMT10058.1| Glucose-6-phosphate isomerase, cytosolic [Aegilops tauschii]
Length=567

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+ VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ +L      P D  T LPK+
Sbjct  541  PSSASLLTRFLAVKPSTPYD-TTVLPKV  567



>gb|EMS52088.1| Glucose-6-phosphate isomerase, cytosolic [Triticum urartu]
Length=567

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+ VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ +L      P D  T LPK+
Sbjct  541  PSSASLLTRFLAVKPSTPYD-TTVLPKV  567



>gb|ABE41789.1| glucose-6-phosphate isomerase [Hordeum vulgare]
 dbj|BAJ88324.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=567

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGFIWGINSFDQWGVELGKS A+ VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFIWGINSFDQWGVELGKSLASTVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+ +LL+ +L      P D  T LPK+
Sbjct  541  PSSASLLTRFLAVKPSTPYD-TTVLPKV  567



>dbj|BAC11913.1| cytosolic phosphoglucose isomerase [Turritis glabra]
Length=560

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AYN GQLLAI E RVAVQGF+WGINSFDQ GVELGK  ATQVRKQL +SR +G ++EG N
Sbjct  482  AYNVGQLLAIYERRVAVQGFVWGINSFDQLGVELGKVLATQVRKQLHSSRTQGTALEGFN  541

Query  220  FSTKTLLSXYLEASS  176
            +ST TLL  +LE SS
Sbjct  542  YSTTTLLKRFLETSS  556



>dbj|BAA08149.1| phosphoglucose isomerase (Pgi-b) [Oryza sativa]
Length=568

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ ++G N
Sbjct  482  AYEIGQLLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFN  541

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T +PK+
Sbjct  542  SSTASLLTRYLAVEPSTPYN-TTTMPKV  568



>ref|NP_001057316.1| Os06g0256500 [Oryza sativa Japonica Group]
 sp|P42863.2|G6PIB_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic B; Short=GPI-B; 
AltName: Full=Phosphoglucose isomerase B; Short=PGI-B; 
AltName: Full=Phosphohexose isomerase B; Short=PHI-B [Oryza 
sativa Japonica Group]
 dbj|BAD46305.1| glucose-6-phosphate isomerase b [Oryza sativa Japonica Group]
 dbj|BAF19230.1| Os06g0256500 [Oryza sativa Japonica Group]
 dbj|BAG90817.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65472.1| hypothetical protein OsJ_20863 [Oryza sativa Japonica Group]
 gb|AGT38453.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ ++G N
Sbjct  481  AYEIGQLLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T +PK+
Sbjct  541  SSTASLLTRYLAVEPSTPYN-TTTMPKV  567



>gb|ABB90111.1| phosphoglucoisomerase [Festuca ovina]
Length=552

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A++VRKQL ASR +G+ +EG N
Sbjct  472  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFN  531

Query  220  FSTKTLLSXYLEASSDIPXD  161
             S+ +LL+ YL      P +
Sbjct  532  PSSASLLARYLAVEPSTPYN  551



>gb|AED99456.1| PgiC2-4 protein [Festuca ovina]
Length=561

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A++VRKQL ASR +G+ +EG N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASRVRKQLHASRMEGKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIP  167
             S+ +LL+ YL      P
Sbjct  541  PSSASLLARYLAVEPSTP  558



>dbj|BAA08148.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa]
Length=567

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ + G N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T LPK+
Sbjct  541  SSTTSLLTRYLAVEPSTPYN-TTTLPKV  567



>gb|EEC76262.1| hypothetical protein OsI_13718 [Oryza sativa Indica Group]
Length=567

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ + G N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T LPK+
Sbjct  541  SSTTSLLTRYLAVEPSTPYN-TTTLPKV  567



>gb|AGT38452.1| phosphoglucose isomerase [Oryza sativa Japonica Group]
Length=567

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ + G N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T LPK+
Sbjct  541  SSTTSLLTRYLAVEPSTPYN-TTTLPKV  567



>ref|NP_001051434.1| Os03g0776000 [Oryza sativa Japonica Group]
 sp|P42862.2|G6PIA_ORYSJ RecName: Full=Glucose-6-phosphate isomerase, cytosolic A; Short=GPI-A; 
AltName: Full=Phosphoglucose isomerase A; Short=PGI-A; 
AltName: Full=Phosphohexose isomerase A; Short=PHI-A [Oryza 
sativa Japonica Group]
 gb|AAN65024.1| phosphoglucose isomerase (Pgi-a) [Oryza sativa Japonica Group]
 gb|ABF99131.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99132.1| Glucose-6-phosphate isomerase, cytosolic A, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13348.1| Os03g0776000 [Oryza sativa Japonica Group]
 gb|EEE60024.1| hypothetical protein OsJ_12779 [Oryza sativa Japonica Group]
Length=567

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ + G N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRVEGKPVLGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             ST +LL+ YL      P +  T LPK+
Sbjct  541  SSTTSLLTRYLAVEPSTPYN-TTTLPKV  567



>ref|XP_003569006.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Brachypodium 
distachyon]
Length=567

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 65/88 (74%), Gaps = 1/88 (1%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR+AVQGFIWGINSFDQWGVELGKS A+QVRKQL ASR + + +EG N
Sbjct  481  AYEIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKSLASQVRKQLHASRMEKKPVEGFN  540

Query  220  FSTKTLLSXYLEASSDIPXDPPTALPKI  137
             S+  LL+ +L      P +  T LPK+
Sbjct  541  PSSAGLLARFLAVEPSTPYN-TTVLPKV  567



>ref|XP_005718631.1| glucose-6-phosphate isomerase, partial [Chondrus crispus]
 emb|CDF38726.1| glucose-6-phosphate isomerase, partial [Chondrus crispus]
Length=583

 Score =   109 bits (272),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L+P LN+Y  GQLL+I EHR AVQGFIW INSFDQWGVELGK  AT+VRKQL  SR  
Sbjct  490  SLLMPVLNSYTCGQLLSIFEHRTAVQGFIWDINSFDQWGVELGKVLATKVRKQLNQSRYH  549

Query  244  GESIEGXNFSTKTLLSXYLEAS  179
             + +EG N S++ L+  Y+  S
Sbjct  550  DKKVEGFNASSRRLVERYIHGS  571



>gb|ABH11444.1| cytosolic glucose-6-phosphate isomerase, partial [Chondrus crispus]
Length=544

 Score =   108 bits (271),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L+P LN+Y  GQLL+I EHR AVQGFIW INSFDQWGVELGK  AT+VRKQL  SR  
Sbjct  451  SLLMPVLNSYTCGQLLSIFEHRTAVQGFIWDINSFDQWGVELGKVLATKVRKQLNQSRYH  510

Query  244  GESIEGXNFSTKTLLSXYLEAS  179
             + +EG N S++ L+  Y+  S
Sbjct  511  DKKVEGFNASSRRLVERYIHGS  532



>ref|XP_007509641.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
 emb|CCO19444.1| cytosolic phosphoglucose isomerase [Bathycoccus prasinos]
Length=635

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 3/94 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP LNAY  GQLL++ EHRVAVQGF+WG+NSFDQWGVELGK  AT+VR  +   R +
Sbjct  522  SIMLPELNAYTTGQLLSLYEHRVAVQGFVWGLNSFDQWGVELGKVLATRVRATMHDKRNE  581

Query  244  G---ESIEGXNFSTKTLLSXYLEASSDIPXDPPT  152
            G   +S +G N ST+ +L+ YL+  + +  D P+
Sbjct  582  GKMLDSSDGYNHSTERMLNRYLQGKAQLKYDTPS  615



>ref|XP_001778143.1| predicted protein [Physcomitrella patens]
 gb|EDQ57033.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+++A+  GQLL++ E+R+AVQGFIW +NSFDQWGVELGKS A++VR QL A+R K
Sbjct  493  SILLPNVDAFTVGQLLSLYENRIAVQGFIWNVNSFDQWGVELGKSLASRVRSQLNAARTK  552

Query  244  GESIEGXNFSTKTLLSXYLEASSDI  170
              ++EG N+ST  LL  YL+  + +
Sbjct  553  EAAVEGFNYSTTFLLQHYLKGKTPV  577



>ref|XP_002509192.1| phosphoglucose isomerase [Micromonas sp. RCC299]
 gb|ACO70450.1| phosphoglucose isomerase [Micromonas sp. RCC299]
Length=598

 Score =   108 bits (270),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP+LNAY  GQ+LAI EHRVA QGFIWG+NSFDQWGVELGK  A++VR  +   R K
Sbjct  485  SIMLPALNAYTTGQILAIYEHRVATQGFIWGLNSFDQWGVELGKVLASKVRATMNEKRTK  544

Query  244  GESI---EGXNFSTKTLLSXYLEASSDIPXDPP  155
            GE +   +G N ST  +L+ YLE  + +    P
Sbjct  545  GEKMSDKDGFNPSTTAMLNRYLEGKAQLKYAEP  577



>emb|CBK23535.2| unnamed protein product [Blastocystis hominis]
Length=567

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L P LNAY  G+LLAI EHR AVQGF+WG+ SFDQWGVELGK  AT VRKQL  SRK+
Sbjct  484  SLLFPELNAYTCGELLAIYEHRTAVQGFVWGLCSFDQWGVELGKVLATSVRKQLHGSRKE  543

Query  244  GESIEGXNFSTKTLLSXYLEA  182
               + G N ST  +L  YL A
Sbjct  544  NAEVSGFNPSTTAMLKKYLSA  564



>ref|XP_003082100.1| cytosolic phosphoglucose isomerase (ISS) [Ostreococcus tauri]
Length=590

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP LNAY  GQLL++ EHRVAVQGF+WGINSFDQWGVELGK  A++VR  +   R K
Sbjct  477  SIMLPELNAYTTGQLLSLYEHRVAVQGFVWGINSFDQWGVELGKVLASRVRATMNDKRTK  536

Query  244  GESI---EGXNFSTKTLLSXYLEASSD-IPXDPPTALP  143
            GE++   EG N ST  LL+ YL   +  I  +P    P
Sbjct  537  GETMSGGEGYNPSTTRLLNRYLAGKAKLIYPEPKDVFP  574



>emb|CEF99714.1| Phosphoglucose isomerase, C-terminal [Ostreococcus tauri]
Length=628

 Score =   107 bits (268),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/98 (56%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP LNAY  GQLL++ EHRVAVQGF+WGINSFDQWGVELGK  A++VR  +   R K
Sbjct  515  SIMLPELNAYTTGQLLSLYEHRVAVQGFVWGINSFDQWGVELGKVLASRVRATMNDKRTK  574

Query  244  GESI---EGXNFSTKTLLSXYLEASSD-IPXDPPTALP  143
            GE++   EG N ST  LL+ YL   +  I  +P    P
Sbjct  575  GETMSGGEGYNPSTTRLLNRYLAGKAKLIYPEPKDVFP  612



>gb|ABK00069.1| cytosolic glucose-6-phosphate isomerase [Chara vulgaris]
Length=561

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L  Y  GQLLA+ EH+VAVQGF+WGINSFDQWGVELGK  A +VRK++  +R +
Sbjct  472  SILLPTLTPYTVGQLLAMYEHQVAVQGFVWGINSFDQWGVELGKVLALKVRKEVSLARNQ  531

Query  244  GESIEGXNFSTKTLLSXYLEASSDI  170
            G  +   N+ST  LL+ YL+   ++
Sbjct  532  GTKVTAFNYSTNFLLNQYLKEKEEV  556



>ref|XP_003061563.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54193.1| predicted protein [Micromonas pusilla CCMP1545]
Length=625

 Score =   107 bits (266),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP+LNAY+ GQLLAI EHRVAVQGF+WG+NSFDQWGVELGK  A++VR  +   R  
Sbjct  512  SIMLPALNAYSTGQLLAIYEHRVAVQGFVWGLNSFDQWGVELGKVLASKVRVSMSQKRTT  571

Query  244  GE---SIEGXNFSTKTLLSXYLEASSDI  170
            GE   S +G N ST  +L+ YL+  + +
Sbjct  572  GELEGSSDGFNSSTTAMLNRYLKGKAQL  599



>ref|XP_002185232.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC43364.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=601

 Score =   105 bits (261),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SIL+  L+A+  GQL+A+ EHR AVQGFIWGINS+DQ+GVELGK  AT +R QL ASRK 
Sbjct  508  SILMTRLDAFAVGQLIAMYEHRTAVQGFIWGINSWDQFGVELGKVLATHIRSQLSASRKT  567

Query  244  GESIEGXNFSTKTLLSXYL  188
            G S++G N ST +LL  +L
Sbjct  568  GASVQGFNSSTSSLLEHFL  586



>gb|EEC80343.1| hypothetical protein OsI_22416 [Oryza sativa Indica Group]
Length=682

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ ++G N
Sbjct  530  AYEIGQLLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFN  589

Query  220  FSTKTLLSXYL  188
             ST +LL+ YL
Sbjct  590  SSTASLLTRYL  600


 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  382  LLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXNFSTKTL  203
            LL+I EHR+AVQGF+WGINSFDQWGVELGKS A+QVRK L ASR +G+ ++G N ST +L
Sbjct  602  LLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKSLHASRMEGKPVQGFNSSTASL  661

Query  202  LSXYLEASSDIPXDPPTALPKI  137
            L+ YL      P +  T +PK+
Sbjct  662  LTRYLAVEPSTPYN-TTTMPKV  682



>ref|XP_001420367.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98660.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=590

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP LNAY  GQLL++ EHRVA QGF+WG+NSFDQWGVELGK  A++VR  + + R K
Sbjct  477  SILLPELNAYTTGQLLSLYEHRVATQGFVWGLNSFDQWGVELGKVLASRVRTSMNSKRTK  536

Query  244  GESI---EGXNFSTKTLLSXYLEASSD-IPXDPPTALP  143
            GE +   +G N ST  LL+ YL   +  I  +P    P
Sbjct  537  GEIMTPGDGFNPSTTALLNRYLAGKAKLIYPEPKDVFP  574



>ref|XP_008876241.1| hypothetical protein H310_11362 [Aphanomyces invadans]
 gb|ETV95068.1| hypothetical protein H310_11362 [Aphanomyces invadans]
Length=555

 Score =   104 bits (259),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = -2

Query  406  LNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEG  227
            LNA++ GQLLA+ EHR  VQG +WGINSFDQWGVELGK  ATQVR QL ASRK    ++G
Sbjct  481  LNAFSAGQLLALYEHRTVVQGAVWGINSFDQWGVELGKVLATQVRNQLSASRKSSAPVQG  540

Query  226  XNFSTKTLLSXYL  188
             N ST TLL+ YL
Sbjct  541  FNSSTSTLLNKYL  553



>ref|XP_001703279.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
 gb|EDP05961.1| phosphoglucose isomerase [Chlamydomonas reinhardtii]
Length=646

 Score =   104 bits (259),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LPS  AY  GQLLAI EHR+AVQGFIW INSFDQWGVELGK  A++VR  + ++R +
Sbjct  541  SIMLPSCTAYTVGQLLAIYEHRIAVQGFIWNINSFDQWGVELGKVLASKVRTVMNSARTR  600

Query  244  GESI---EGXNFSTKTLLSXYLEASSDI  170
               I   +G N+ST  +++ YLE  + +
Sbjct  601  DRKILPQDGFNYSTTRMINKYLEGKTQV  628



>emb|CBN74985.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   103 bits (257),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L P L+A++ GQLLAI EHR AVQGF+WG+NSFDQWGVELGK  AT+VR  L  +R  
Sbjct  473  SLLFPKLDAFSCGQLLAIYEHRTAVQGFVWGLNSFDQWGVELGKKLATKVRTALSTARTS  532

Query  244  GESI-EGXNFSTKTLLSXYL  188
            G  + EG N ST TL++ YL
Sbjct  533  GGDVSEGFNPSTSTLMTYYL  552



>ref|XP_005851258.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
 gb|EFN59156.1| hypothetical protein CHLNCDRAFT_138008 [Chlorella variabilis]
Length=521

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP LNAY  GQLL++ EHRVA  GF+WGINSFDQWGVELGK  A +VR ++  +R  
Sbjct  420  SILLPELNAYTLGQLLSMYEHRVATSGFVWGINSFDQWGVELGKVLANKVRSKVQEARSA  479

Query  244  GESI---EGXNFSTKTLLSXYLEASSDIPXDPPTALP  143
            G  +   +G N ST  LL+ +LEA +  P       P
Sbjct  480  GRQVSKADGFNASTVRLLNRFLEAKTQPPAQGKHTFP  516



>ref|XP_005713157.1| glucose-6-phosphate isomerase [Chondrus crispus]
 emb|CDF33354.1| glucose-6-phosphate isomerase [Chondrus crispus]
Length=553

 Score =   102 bits (254),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L+  LNA+  GQLLA+ EHR  V+GFIWGINSFDQWGVELGK  A  VR QL ASR  
Sbjct  473  SMLIDELNAFTVGQLLALFEHRTVVEGFIWGINSFDQWGVELGKVLAKDVRTQLTASRSD  532

Query  244  GESIEGXNFSTKTLLSXYL  188
            G  + G N ST  LL  YL
Sbjct  533  GADVSGFNPSTTMLLKKYL  551



>gb|ABH11442.1| cytosolic glucose-6-phosphate isomerase [Chondrus crispus]
Length=553

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L+  LNA+  GQLLA+ EHR  V+GFIWGINSFDQWGVELGK  A  VR QL ASR  
Sbjct  473  SMLIDELNAFTVGQLLALFEHRTVVEGFIWGINSFDQWGVELGKVLAKDVRTQLTASRSD  532

Query  244  GESIEGXNFSTKTLLSXYL  188
            G  + G N ST  LL  YL
Sbjct  533  GADVSGFNPSTTMLLKKYL  551



>ref|XP_001754629.1| predicted protein [Physcomitrella patens]
 gb|EDQ80599.1| predicted protein, partial [Physcomitrella patens]
Length=575

 Score =   102 bits (253),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQ   + EHR+AVQGF+WGINSFDQWGVELGKS AT+VR+ +   R K
Sbjct  468  SILLPTLDAYTAGQA-TLYEHRIAVQGFVWGINSFDQWGVELGKSLATKVRQTMHNFRTK  526

Query  244  GESIEGXNFSTKTLLSXYLE  185
            GES+   N+ST  +L+ +L+
Sbjct  527  GESVCDYNYSTTFMLNRFLQ  546



>gb|ACI29026.1| glucose-6-phosphate isomerase [Dunaliella salina]
Length=659

 Score =   102 bits (253),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SI+LP+  A   GQ+LA+ EHRVAVQGFIWGINSFDQWGVELGK  A++VR  +  SR K
Sbjct  557  SIMLPACTARTVGQILALYEHRVAVQGFIWGINSFDQWGVELGKVLASKVRTTMHQSRTK  616

Query  244  GESI---EGXNFSTKTLLSXYLEASSDI  170
              ++   +G N+ST  +++ YLE  + +
Sbjct  617  SRTVSITDGFNYSTTRMMNKYLEGKTQM  644



>ref|XP_005707296.1| glucose-6-phosphate isomerase [Galdieria sulphuraria]
 gb|EME30776.1| glucose-6-phosphate isomerase [Galdieria sulphuraria]
Length=629

 Score =   100 bits (250),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  421  ILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKG  242
            +L+P L+AY  GQLLA+ EHR AVQGF+W INSFDQ+GVELGK  A +VRKQL  SR   
Sbjct  535  LLMPVLDAYVTGQLLALYEHRTAVQGFLWEINSFDQFGVELGKVLANKVRKQLNESRYFN  594

Query  241  ESIEGXNFSTKTLLSXYLEAS  179
            + I G N ST  LL+ YLE S
Sbjct  595  KEISGFNHSTTKLLNRYLEGS  615



>gb|ABK00064.1| cytosolic glucose-6-phosphate isomerase [Mesostigma viride]
Length=580

 Score =   100 bits (249),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            SILLP+L+AY  GQLL+  EHRVAV GFI+GINSFDQWGVELGK  A +VR  +  +R K
Sbjct  459  SILLPTLDAYTVGQLLSHYEHRVAVAGFIYGINSFDQWGVELGKVLAGKVRTTMNQARTK  518

Query  244  GESIEGXNFSTKTLLSXYLEASS  176
            G  I G N ST  L++ YL   +
Sbjct  519  GVPITGYNSSTIALMNRYLSGKT  541



>ref|XP_002946940.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
 gb|EFJ52166.1| hypothetical protein VOLCADRAFT_103185 [Volvox carteri f. nagariensis]
Length=584

 Score =   100 bits (249),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S++LPS  AY  GQLL++ EHR+AVQGFIW INSFDQWGVELGK  A++VR  + ++R +
Sbjct  479  SVMLPSCTAYTVGQLLSMYEHRIAVQGFIWNINSFDQWGVELGKVLASKVRTVMNSARTR  538

Query  244  GESI---EGXNFSTKTLLSXYLEASSDI  170
               +   +G N+ST  +++ YLE  + +
Sbjct  539  DRKVLPQDGFNYSTTRMINKYLEGKTQV  566



>emb|CCI49830.1| unnamed protein product [Albugo candida]
Length=501

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+ ++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL  SRKK
Sbjct  421  SLLFEKLDPFSCGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEQSRKK  480

Query  244  GESIEGXNFSTKTLLSXYL  188
               +EG N ST  L+S YL
Sbjct  481  HAKVEGFNPSTSYLMSKYL  499



>emb|CCI49829.1| unnamed protein product [Albugo candida]
Length=555

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+ ++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL  SRKK
Sbjct  475  SLLFEKLDPFSCGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEQSRKK  534

Query  244  GESIEGXNFSTKTLLSXYL  188
               +EG N ST  L+S YL
Sbjct  535  HAKVEGFNPSTSYLMSKYL  553



>gb|ETK96016.1| hypothetical protein L915_01139 [Phytophthora parasitica]
Length=556

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+AY  GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAYTTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|ETP54025.1| hypothetical protein F442_01139 [Phytophthora parasitica P10297]
Length=556

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+AY  GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAYTTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>ref|XP_008890866.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETI56214.1| hypothetical protein F443_01209 [Phytophthora parasitica P1569]
 gb|ETL49396.1| hypothetical protein L916_01121 [Phytophthora parasitica]
 gb|ETM02446.1| hypothetical protein L917_01091 [Phytophthora parasitica]
 gb|ETM55689.1| hypothetical protein L914_01128 [Phytophthora parasitica]
 gb|ETN24837.1| hypothetical protein PPTG_01022 [Phytophthora parasitica INRA-310]
 gb|ETO84955.1| hypothetical protein F444_01204 [Phytophthora parasitica P1976]
Length=556

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+AY  GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAYTTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|ETP26016.1| hypothetical protein F441_01181 [Phytophthora parasitica CJ01A1]
Length=556

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+AY  GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAYTTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLNASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>ref|XP_009825599.1| hypothetical protein H257_03289 [Aphanomyces astaci]
 gb|ETV85581.1| hypothetical protein H257_03289 [Aphanomyces astaci]
Length=556

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = -2

Query  406  LNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRK-KGESIE  230
            L A++ GQLLA+ EHR  VQG +WGINSFDQWGVELGK  ATQVR QL ASRK K  S++
Sbjct  481  LTAFSCGQLLALYEHRTVVQGAVWGINSFDQWGVELGKVLATQVRNQLSASRKNKATSVD  540

Query  229  GXNFSTKTLLSXYL  188
            G N +T TLL  YL
Sbjct  541  GFNSATATLLQTYL  554



>ref|XP_002288430.1| glucose-6-phosphate isomerase [Thalassiosira pseudonana CCMP1335]
 gb|EED93866.1| glucose-6-phosphate isomerase [Thalassiosira pseudonana CCMP1335]
Length=649

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            +IL+  L+A+  GQLLAI EHR  VQGF+WGINSFDQ+G E+GK  A +VR QL ASR++
Sbjct  564  AILMTKLDAFALGQLLAIYEHRTVVQGFVWGINSFDQYGTEIGKVLAKRVRAQLSASRRR  623

Query  244  GESIEGXNFSTKTLLSXYL  188
            G S++G N S+  +L  YL
Sbjct  624  GASVQGFNSSSGFMLEAYL  642



>gb|AAP51061.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL A R +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSAPRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               +EG N +T ++L  YL
Sbjct  534  NAPVEGFNSATTSMLEAYL  552



>gb|KIY94551.1| glucose-6-phosphate isomerase [Monoraphidium neglectum]
Length=217

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP LNAY  GQ+L++ EH+VAVQGF+W INSFDQWGVELGK  A++VR ++  +R  
Sbjct  108  SVLLPELNAYTVGQILSLYEHQVAVQGFVWNINSFDQWGVELGKVLASKVRTKINEARNG  167

Query  244  GESI---EGXNFSTKTLLSXYL  188
               +   +G N+ST  +++ YL
Sbjct  168  ARFMAGSDGFNYSTTRMINKYL  189



>gb|AAP51062.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSTTTSMLEAYL  552



>gb|AAP51071.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKELDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51066.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>emb|CCA13931.1| unnamed protein product [Albugo laibachii Nc14]
Length=555

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+ ++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL  SRK 
Sbjct  475  SLLFEKLDPFSCGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRNQLEGSRKH  534

Query  244  GESIEGXNFSTKTLLSXYL  188
               IEG N ST  LL+ YL
Sbjct  535  QAKIEGFNPSTSYLLNRYL  553



>gb|AAP51070.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51074.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51075.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51072.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>ref|XP_002908462.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
 gb|AAM28239.1| glucose 6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51064.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|AAP51078.1| glucose-6-phosphate isomerase [Phytophthora infestans]
 gb|EEY61545.1| glucose-6-phosphate isomerase [Phytophthora infestans T30-4]
Length=556

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51077.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51067.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51076.1| glucose-6-phosphate isomerase [Phytophthora erythroseptica]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51063.1| glucose-6-phosphate isomerase [Phytophthora mirabilis]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51065.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51068.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51080.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51069.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>ref|XP_005650466.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25922.1| cytosolic phosphoglucose isomerase [Coccomyxa subellipsoidea 
C-169]
Length=594

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQ-GFIWGINSFDQWGVELGKSSATQVRKQLXASRK  248
            SILLP LNA+  GQ+LA+ E+R+AVQ GFIWGINSFDQWGVELGK  A++VR ++   R 
Sbjct  480  SILLPELNAFTVGQILALYENRIAVQQGFIWGINSFDQWGVELGKVLASKVRAEMHTCRT  539

Query  247  KGESI---EGXNFSTKTLLSXYLEASSDIPXDPP  155
            K  ++   +G N ST  LL+ YLE  + +    P
Sbjct  540  KDRNVSPTDGFNHSTTKLLNRYLEGKARLLYPEP  573



>ref|XP_009523844.1| glucose-6-phosphate isomerase [Phytophthora sojae]
 gb|EGZ21127.1| glucose-6-phosphate isomerase [Phytophthora sojae]
Length=556

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+AY+ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL  SR +
Sbjct  474  SLLFKKLDAYSTGQLLALYEHRTVVQGSIWGINSFDQWGVELGKVLAKQVRAQLNVSRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|ABH11443.1| cytosolic glucose-6-phosphate isomerase [Pyropia yezoensis]
Length=635

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP  NAY+ GQLLA+ EHR AV+GFIW INSFDQWGVELGK  A +VR+Q+  +R  
Sbjct  541  SLLLPICNAYSCGQLLALYEHRTAVEGFIWNINSFDQWGVELGKVLAIKVRQQINQTRYH  600

Query  244  GESI-EGXNFSTKTLLSXYLEAS  179
               I E  N ST  LL  +L  S
Sbjct  601  NRPIKESFNVSTARLLDRFLNGS  623



>gb|AAP51073.1| glucose-6-phosphate isomerase [Phytophthora cactorum]
Length=556

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ G+LLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR QL ASR +
Sbjct  474  SLLFKKLDAFSTGRLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51060.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A Q R QL ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQARAQLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>gb|AAP51079.1| glucose-6-phosphate isomerase [Phytophthora infestans]
Length=556

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+A++ GQLLA+ EHR  VQG IWGINSFDQWGVELGK  A QVR  L ASR +
Sbjct  474  SLLFKKLDAFSTGQLLALYEHRTVVQGAIWGINSFDQWGVELGKVLAKQVRAHLSASRTE  533

Query  244  GESIEGXNFSTKTLLSXYL  188
               ++G N +T ++L  YL
Sbjct  534  NAPVKGFNSATTSMLEAYL  552



>ref|XP_005537531.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81495.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
Length=648

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            ++LL  L+ Y  GQLLA+ EHR AVQGFIW INSFDQWGVELGK  A +VRKQL  SR  
Sbjct  544  TLLLQRLDPYATGQLLALYEHRTAVQGFIWDINSFDQWGVELGKVLAKRVRKQLNESRYF  603

Query  244  GESI-EGXNFSTKTLLSXYLEA  182
            G  I E  N ST+ L+  YL  
Sbjct  604  GRPISEEFNASTRDLMERYLRG  625



>gb|EWM30292.1| glucose-6-phosphate isomerase [Nannochloropsis gaditana]
Length=563

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L   L+ +  GQLLA+ EHRV VQG IWGINSFDQWGVELGK  A QVR QL ASR+ 
Sbjct  474  SLLFGQLDPFTTGQLLALYEHRVFVQGAIWGINSFDQWGVELGKVLAKQVRTQLTASRQG  533

Query  244  GESIEGXNFSTKTLLSXYL  188
             + I G N ST  +L+ YL
Sbjct  534  EKIISGFNSSTAAMLNFYL  552



>gb|AFW69306.1| hypothetical protein ZEAMMB73_008996, partial [Zea mays]
Length=222

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLL+I EHR+AVQGF+WGINSFDQWGVELGKS A+QVRKQL  +R + + +EG N
Sbjct  163  AYEVGQLLSIYEHRIAVQGFLWGINSFDQWGVELGKSLASQVRKQLHGTRMEVKPVEGFN  222



>ref|XP_005537536.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81500.1| glucose-6-phosphate isomerase [Cyanidioschyzon merolae strain 
10D]
Length=773

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            ++LL  L+ Y  GQLLA+ EHR AVQGFIW INSFDQWGVELGK  A +VRKQL  SR  
Sbjct  669  TLLLQRLDPYATGQLLALYEHRTAVQGFIWDINSFDQWGVELGKVLAKRVRKQLNESRYF  728

Query  244  GESI-EGXNFSTKTLLSXYLEA  182
            G  I E  N ST+ L+  YL  
Sbjct  729  GRPISEEFNASTRDLMERYLRG  750



>ref|XP_008611761.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
 gb|EQC34889.1| glucose-6-phosphate isomerase, cytosolic 2 [Saprolegnia diclina 
VS20]
Length=555

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  409  SLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGES-I  233
            SL+A+  GQLLA+ EHR  VQG IWG+NSFDQWGVELGK  ATQVR QL ASR    + +
Sbjct  480  SLDAFACGQLLALYEHRTVVQGAIWGLNSFDQWGVELGKVLATQVRNQLSASRTNAAAPL  539

Query  232  EGXNFSTKTLLSXYL  188
            +G N ST  LL  YL
Sbjct  540  QGFNSSTSALLKRYL  554



>gb|ABH11446.1| cytosolic glucose-6-phosphate isomerase [Cyanophora paradoxa]
Length=484

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  424  SILLP-SLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRK  248
            SIL P S+  +  GQ+L++ EHR AV+GF+WG+NSFDQWGVELGK  ATQVR QL  +RK
Sbjct  400  SILFPESVTPFAVGQVLSLYEHRTAVEGFVWGLNSFDQWGVELGKVLATQVRMQLAKTRK  459

Query  247  KGESIEGXNFSTKTLLSXYLEASSD  173
            +  +IEG    T  L+  Y+  + +
Sbjct  460  EKAAIEGFVAPTTRLMERYINLTKN  484



>gb|KDO30887.1| glucose-6-phosphate isomerase [Saprolegnia parasitica CBS 223.65]
Length=555

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -2

Query  409  SLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGES-I  233
            +L+A+  GQLLA+ EHR  VQG IWG+NSFDQWGVELGK  ATQVR QL ASR    + +
Sbjct  480  TLDAFACGQLLALYEHRTVVQGAIWGLNSFDQWGVELGKVLATQVRNQLSASRANASAPL  539

Query  232  EGXNFSTKTLLSXYL  188
            +G N ST  LL  YL
Sbjct  540  QGFNSSTSALLKRYL  554



>emb|CBJ33821.1| cytosolic glucose-6-phosphate isomerase [Ectocarpus siliculosus]
Length=305

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -2

Query  406  LNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASR-KKGESIE  230
            +NAY+ GQ+LA+ EHR AV+GF+W INSFDQWGVELGKS AT +R+++   R  + E+  
Sbjct  208  VNAYHLGQILALYEHRTAVEGFMWDINSFDQWGVELGKSLATDIREKMQRFRSPEQEAPS  267

Query  229  GXNFSTKTLLSXYLEASSDI  170
            G N ST  L+S YL+ S  +
Sbjct  268  GLNPSTYRLMSRYLQQSDSL  287



>gb|ABH11441.1| cytosolic glucose-6-phosphate isomerase, partial [Cyanophora 
paradoxa]
Length=263

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 2/83 (2%)
 Frame = -2

Query  421  ILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKG  242
            +LLP L+AY  GQLLA+ EHR  V+GF+WGINSFDQ+GVELGK  ATQVRK+L A+R   
Sbjct  177  LLLPRLDAYTTGQLLALFEHRTVVEGFVWGINSFDQYGVELGKVLATQVRKELQAARAAP  236

Query  241  ESIEGXNF--STKTLLSXYLEAS  179
            ++    +F  ST  LL  YL+ S
Sbjct  237  KAALSRSFNASTDALLLRYLKQS  259



>ref|XP_002967787.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
 gb|EFJ31134.1| hypothetical protein SELMODRAFT_409075 [Selaginella moellendorffii]
Length=1477

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 57/93 (61%), Gaps = 21/93 (23%)
 Frame = -2

Query  400   AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGK---------------------SSA  284
              Y  GQLLAI EHR+AVQGFIWGINSFDQWGVELGK                     S A
Sbjct  1384  PYTIGQLLAIYEHRIAVQGFIWGINSFDQWGVELGKVILSPNSSITLSLTSAPSKNQSLA  1443

Query  283   TQVRKQLXASRKKGESIEGXNFSTKTLLSXYLE  185
              +VR Q+   R KG+ +EG N+ST TLL+ YL+
Sbjct  1444  GKVRNQMHLWRTKGKVVEGFNYSTTTLLNRYLK  1476



>gb|KDD75199.1| phosphoglucose isomerase [Helicosporidium sp. ATCC 50920]
Length=579

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+LLP ++AY  GQLLA+ EHRVAV GF+WGINSFDQWGVELGK+ AT+VR  +  +R +
Sbjct  472  SLLLPRVDAYTVGQLLALYEHRVAVAGFLWGINSFDQWGVELGKALATRVRSSVALARGQ  531

Query  244  GESI---EGXNFSTKTLLSXYLEASSDIP  167
               I   +G   +T  LL+  L  +  +P
Sbjct  532  NRVIVPEDGFLPATTRLLNKALRLAPAVP  560



>ref|XP_002185275.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC43144.1| isomerase glucose-6-phosphate isomerase [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=786

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = -2

Query  400  AYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKKGESIEGXN  221
            AY  GQLLAI EHR AVQGF+W INSFDQWGVELGK  A  V+  L  +R+  E +E  N
Sbjct  670  AYACGQLLAIYEHRTAVQGFMWDINSFDQWGVELGKKLAIDVKGHLLNARRSEEEVETSN  729

Query  220  FSTKTLLSXYLEASSDI----PXDPPTALPK  140
             +T  LL+ Y+  S  I    P +P T++ +
Sbjct  730  PATTRLLNYYVNNSRRICQEAPYNPITSVTR  760



>gb|EJK76543.1| hypothetical protein THAOC_01690 [Thalassiosira oceanica]
Length=269

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = -2

Query  424  SILLPSLNAYNXGQLLAIXEHRVAVQGFIWGINSFDQWGVELGKSSATQVRKQLXASRKK  245
            S+L P L+AY  GQ+L++ EHR AVQGFIW +NSFDQWGVELGK  A  +++ L  +R  
Sbjct  141  SLLFPQLSAYVTGQILSLYEHRTAVQGFIWDLNSFDQWGVELGKKLALDIKEHLMEARNN  200

Query  244  --GE-SIEGXNFSTKTLLSXYLEASSD  173
              G+  I   N +T  +L+ Y+E S+D
Sbjct  201  EIGDYEIAADNAATSRILNYYVENSAD  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555628969350