BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005E21

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB17077.1|  glucose-6-phosphate isomerase                         68.2    5e-13   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004489355.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  70.9    2e-12   
ref|XP_009775388.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  69.3    9e-12   Nicotiana sylvestris
ref|XP_009775389.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  68.9    1e-11   Nicotiana sylvestris
ref|XP_009598843.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  68.9    1e-11   Nicotiana tomentosiformis
ref|XP_007136588.1|  hypothetical protein PHAVU_009G057500g           68.6    1e-11   Phaseolus vulgaris [French bean]
ref|NP_001275223.1|  glucose-6-phosphate isomerase                    68.6    1e-11   Solanum tuberosum [potatoes]
ref|XP_007017512.1|  Sugar isomerase (SIS) family protein isoform 3   68.6    2e-11   
ref|XP_007017511.1|  Sugar isomerase (SIS) family protein isoform 2   68.2    2e-11   
gb|AII20189.1|  glucose-6-phosphate isomerase                         68.2    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_003618419.1|  Glucose-6-phosphate isomerase                    67.8    3e-11   Medicago truncatula
ref|XP_007017510.1|  Sugar isomerase family protein isoform 1         67.8    4e-11   
gb|KHN45846.1|  Glucose-6-phosphate isomerase, cytosolic              67.0    5e-11   Glycine soja [wild soybean]
ref|NP_001242028.1|  uncharacterized protein LOC100807719             67.0    5e-11   Glycine max [soybeans]
ref|NP_001265881.1|  glucose-6-phosphate isomerase                    66.6    7e-11   Solanum lycopersicum
ref|XP_010313627.1|  PREDICTED: glucose-6-phosphate isomerase iso...  66.6    8e-11   Solanum lycopersicum
gb|KJB14513.1|  hypothetical protein B456_002G128400                  66.2    9e-11   Gossypium raimondii
gb|KJB14509.1|  hypothetical protein B456_002G128400                  66.2    9e-11   Gossypium raimondii
gb|KJB14511.1|  hypothetical protein B456_002G128400                  66.2    1e-10   Gossypium raimondii
ref|XP_006434973.1|  hypothetical protein CICLE_v10000722mg           66.2    1e-10   Citrus clementina [clementine]
ref|XP_008377469.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  63.2    1e-10   
sp|P54243.1|G6PI_OENME  RecName: Full=Glucose-6-phosphate isomera...  65.9    1e-10   Oenothera sinuata var. hirsuta
ref|XP_007221807.1|  hypothetical protein PRUPE_ppa003512mg           65.9    2e-10   Prunus persica
emb|CAB55566.1|  cytosolic phosphoglucose isomerase                   65.5    2e-10   Clarkia gracilis
ref|XP_004291883.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  65.5    2e-10   Fragaria vesca subsp. vesca
sp|P54240.1|G6PI1_CLAXA  RecName: Full=Glucose-6-phosphate isomer...  65.5    2e-10   Clarkia xantiana [gusight clarkia]
sp|P54236.1|G6PI1_CLAFR  RecName: Full=Glucose-6-phosphate isomer...  65.1    2e-10   Clarkia franciscana [Presidio clarkia]
gb|KCW67833.1|  hypothetical protein EUGRSUZ_F01561                   65.1    3e-10   Eucalyptus grandis [rose gum]
ref|XP_010060937.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  65.1    3e-10   Eucalyptus grandis [rose gum]
gb|AAY85660.1|  cytosolic glucose-6-phosphate isomerase               65.1    3e-10   Helianthus annuus
sp|P54237.1|G6PI1_CLAMI  RecName: Full=Glucose-6-phosphate isomer...  64.7    3e-10   Clarkia mildrediae
sp|P54234.1|G6PI1_CLAAR  RecName: Full=Glucose-6-phosphate isomer...  64.7    4e-10   Clarkia arcuata
ref|XP_008357232.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  63.2    4e-10   
ref|XP_008377470.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  63.5    5e-10   
emb|CDP07527.1|  unnamed protein product                              61.6    5e-10   Coffea canephora [robusta coffee]
gb|KHN22258.1|  Glucose-6-phosphate isomerase, cytosolic              64.3    5e-10   Glycine soja [wild soybean]
sp|P54241.1|G6PI2_CLACO  RecName: Full=Glucose-6-phosphate isomer...  64.3    5e-10   Clarkia concinna [red ribbons]
ref|XP_006582469.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph...  63.9    6e-10   
ref|XP_008377422.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  63.9    6e-10   
gb|KDO84534.1|  hypothetical protein CISIN_1g007374mg                 63.5    7e-10   Citrus sinensis [apfelsine]
emb|CAC85684.1|  cytosolic phosphoglucose isomerase                   63.5    8e-10   Clarkia similis
sp|P54239.1|G6PI1_CLAWI  RecName: Full=Glucose-6-phosphate isomer...  63.5    8e-10   Clarkia williamsonii
emb|CAD79590.1|  cytosolic phosphoglucose isomerase                   61.2    8e-10   Lopezia grandiflora
emb|CAC85683.1|  cytosolic phosphoglucose isomerase                   63.5    8e-10   Clarkia similis
emb|CAB55567.1|  cytosolic phosphoglucose isomerase                   63.5    8e-10   Clarkia gracilis
ref|XP_008377333.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  63.5    9e-10   Malus domestica [apple tree]
gb|AFK39110.1|  unknown                                               63.2    1e-09   Medicago truncatula
gb|KDO84533.1|  hypothetical protein CISIN_1g007374mg                 63.2    1e-09   Citrus sinensis [apfelsine]
gb|KDO84532.1|  hypothetical protein CISIN_1g007374mg                 63.2    1e-09   Citrus sinensis [apfelsine]
ref|XP_006473486.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  62.8    2e-09   Citrus sinensis [apfelsine]
gb|KHN34179.1|  Glucose-6-phosphate isomerase, cytosolic 1            62.8    2e-09   Glycine soja [wild soybean]
ref|XP_003554193.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  62.4    2e-09   Glycine max [soybeans]
emb|CAC82581.1|  cytosolic phosphoclucose isomerase                   59.7    2e-09   Clarkia delicata
emb|CAC86122.1|  cytosolic phosphoglucose isomerase                   62.4    2e-09   Clarkia modesta
ref|XP_009365601.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  62.4    2e-09   Pyrus x bretschneideri [bai li]
sp|P54242.1|G6PI2_CLAXA  RecName: Full=Glucose-6-phosphate isomer...  62.4    2e-09   Clarkia xantiana [gusight clarkia]
ref|XP_010263691.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  62.0    3e-09   Nelumbo nucifera [Indian lotus]
emb|CAC84504.1|  cytosolic phosphoglucose isomerase                   59.3    3e-09   Clarkia delicata
ref|XP_008444704.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  62.0    3e-09   Cucumis melo [Oriental melon]
emb|CAC85668.1|  cytosolic phosphoglucose isomerase                   59.3    3e-09   Clarkia similis
ref|XP_002312387.2|  hypothetical protein POPTR_0008s11770g           61.6    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011021922.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  60.8    8e-09   Populus euphratica
gb|KHG04166.1|  Glucose-6-phosphate isomerase, cytosolic              60.8    8e-09   Gossypium arboreum [tree cotton]
ref|XP_010106007.1|  Glucose-6-phosphate isomerase, cytosolic 1       60.8    8e-09   
ref|XP_004152701.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  60.5    1e-08   Cucumis sativus [cucumbers]
ref|XP_009364475.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  60.1    1e-08   Pyrus x bretschneideri [bai li]
sp|P54235.1|G6PI1_CLACO  RecName: Full=Glucose-6-phosphate isomer...  60.1    1e-08   Clarkia concinna [red ribbons]
ref|XP_010677508.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  60.1    1e-08   Beta vulgaris subsp. vulgaris [field beet]
emb|CAC85686.1|  cytosolic phosphoglucose isomerase                   59.7    2e-08   Clarkia similis
ref|XP_002510371.1|  glucose-6-phosphate isomerase, putative          59.7    2e-08   
emb|CAC85685.1|  cytosolic phosphoglucose isomerase                   59.3    2e-08   Clarkia similis
emb|CAC84508.1|  cytosolic phosphoglucose isomerase                   59.3    2e-08   Clarkia delicata
emb|CAC82579.1|  cytosolic phosphoclucose isomerase                   59.3    2e-08   Clarkia epilobioides
emb|CAC84514.1|  cytosolic phosphoglucose isomerase                   59.3    3e-08   Clarkia delicata
ref|XP_002282774.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  59.3    3e-08   Vitis vinifera
emb|CAC82578.1|  cytosolic phosphoclucose isomerase                   59.3    3e-08   Clarkia epilobioides
sp|P34797.1|G6PI3_CLALE  RecName: Full=Glucose-6-phosphate isomer...  58.2    3e-08   Clarkia lewisii
sp|P29333.1|G6PI2_CLALE  RecName: Full=Glucose-6-phosphate isomer...  58.5    4e-08   Clarkia lewisii
emb|CAC84511.1|  cytosolic phosphoglucose isomerase                   58.2    6e-08   Clarkia delicata
gb|KDP38492.1|  hypothetical protein JCGZ_04417                       58.2    6e-08   Jatropha curcas
ref|XP_011083695.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  58.2    8e-08   Sesamum indicum [beniseed]
sp|P54238.1|G6PI1_CLARO  RecName: Full=Glucose-6-phosphate isomer...  57.8    8e-08   Clarkia rostrata
sp|P34796.1|G6PI1_CLALE  RecName: Full=Glucose-6-phosphate isomer...  57.8    9e-08   Clarkia lewisii
ref|XP_006837344.1|  hypothetical protein AMTR_s00111p00094320        57.0    2e-07   Amborella trichopoda
ref|XP_007151167.1|  hypothetical protein PHAVU_004G023500g           55.8    4e-07   Phaseolus vulgaris [French bean]
sp|O82059.2|G6PI_SPIOL  RecName: Full=Glucose-6-phosphate isomera...  55.1    7e-07   Spinacia oleracea
gb|EYU45142.1|  hypothetical protein MIMGU_mgv1a003701mg              54.7    1e-06   Erythranthe guttata [common monkey flower]
gb|EYU45143.1|  hypothetical protein MIMGU_mgv1a003701mg              54.3    1e-06   Erythranthe guttata [common monkey flower]
emb|CAC85669.1|  cytosolic phosphoglucose isomerase                   51.6    2e-06   Clarkia similis
ref|XP_010254873.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  52.8    4e-06   Nelumbo nucifera [Indian lotus]
gb|EPS71211.1|  glucose-6-phosphate isomerase                         50.1    4e-05   Genlisea aurea
emb|CAC85647.1|  cytosolic phosphoglucose isomerase                   47.4    6e-05   Clarkia similis
emb|CAC85670.1|  cytosolic phosphoglucose isomerase                   47.4    6e-05   Clarkia similis
ref|XP_010935387.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  47.0    2e-04   
ref|XP_008220896.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  47.4    4e-04   Prunus mume [ume]
dbj|BAA23179.1|  cytosolic phosphoglucose isomerase                   46.2    7e-04   Dioscorea tokoro [shan bei xie]
dbj|BAA23185.2|  phosphoglucose isomerase                             46.2    7e-04   Dioscorea tokoro [shan bei xie]
dbj|BAA23176.1|  phosphoglucose isomerase                             46.2    8e-04   Dioscorea tokoro [shan bei xie]
dbj|BAA23181.1|  cytosolic phosphoglucose isomerase                   46.2    8e-04   Dioscorea tokoro [shan bei xie]
dbj|BAA23177.1|  cytosolic phosphoglucose isomerase                   46.2    8e-04   Dioscorea tokoro [shan bei xie]
dbj|BAA23182.1|  cytosolic phosphoglucose isomerase                   46.2    8e-04   Dioscorea tokoro [shan bei xie]
ref|XP_010519111.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  46.2    8e-04   Tarenaya hassleriana [spider flower]
dbj|BAA23180.1|  cytosolic phosphoglucose isomerase                   46.2    8e-04   Dioscorea tokoro [shan bei xie]
ref|XP_010942803.1|  PREDICTED: glucose-6-phosphate isomerase, cy...  46.2    9e-04   Elaeis guineensis
gb|AEH27532.1|  putative glucose-6-phosphateisomerase                 44.7    9e-04   Amorphophallus konjac [devil's-tongue]



>gb|ABB17077.1| glucose-6-phosphate isomerase [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=85

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTKTL++ Y EAS+D+P+DP T LPKI
Sbjct  41   KQLHASRKKGESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  85



>ref|XP_004489355.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489356.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004489357.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1-like isoform 
X3 [Cicer arietinum]
Length=568

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE I G  FST T+L++Y EAS+DIPADPPT LP+I
Sbjct  524  KQLNASRTKGEPIQGFNFSTTTMLTRYLEASADIPADPPTTLPQI  568



>ref|XP_009775388.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Nicotiana sylvestris]
Length=576

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTKTL++ Y EAS+D+P+DP T LPKI
Sbjct  532  KQLHASRKKGESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  576



>ref|XP_009775389.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
 ref|XP_009775390.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Nicotiana sylvestris]
Length=568

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTKTL++ Y EAS+D+P+DP T LPKI
Sbjct  524  KQLHASRKKGESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|XP_009598843.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
 ref|XP_009598848.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nicotiana 
tomentosiformis]
Length=568

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTKTL++ Y EAS+D+P+DP T LPKI
Sbjct  524  KQLHASRKKGESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|XP_007136588.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
 gb|ESW08582.1| hypothetical protein PHAVU_009G057500g [Phaseolus vulgaris]
Length=568

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST T+L++Y +ASSDIPAD PTALPKI
Sbjct  524  KQLNASRTKGEPVQGFNFSTTTMLNRYLQASSDIPADLPTALPKI  568



>ref|NP_001275223.1| glucose-6-phosphate isomerase [Solanum tuberosum]
 gb|AAU00726.1| glucose-6-phosphate isomerase [Solanum tuberosum]
Length=568

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTKTL+++Y EAS+D+P+DP T LP I
Sbjct  524  KQLHASRKKGESVEGFNFSTKTLITRYLEASADVPSDPSTLLPNI  568



>ref|XP_007017512.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
 gb|EOY14737.1| Sugar isomerase (SIS) family protein isoform 3 [Theobroma cacao]
Length=537

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KG+ + G  FST TLL++Y EASSDIPADPPT LP+I
Sbjct  493  KQLHASRTKGDPVEGFNFSTTTLLTRYLEASSDIPADPPTLLPRI  537



>ref|XP_007017511.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
 gb|EOY14736.1| Sugar isomerase (SIS) family protein isoform 2 [Theobroma cacao]
Length=568

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KG+ + G  FST TLL++Y EASSDIPADPPT LP+I
Sbjct  524  KQLHASRTKGDPVEGFNFSTTTLLTRYLEASSDIPADPPTLLPRI  568



>gb|AII20189.1| glucose-6-phosphate isomerase [Nicotiana tabacum]
Length=568

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            +QL+ASRKKGES+ G  FSTKTL++ Y EAS+D+P+DP T LPKI
Sbjct  524  RQLHASRKKGESVEGFNFSTKTLITTYLEASADVPSDPSTLLPKI  568



>ref|XP_003618419.1| Glucose-6-phosphate isomerase [Medicago truncatula]
 gb|AES74637.1| glucose-6-phosphate isomerase [Medicago truncatula]
Length=568

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE I G  FST T++++Y +AS+D+PADPPT LP+I
Sbjct  524  KQLNASRTKGEPIQGFNFSTTTMITRYLQASADVPADPPTTLPQI  568



>ref|XP_007017510.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
 gb|EOY14735.1| Sugar isomerase family protein isoform 1 [Theobroma cacao]
Length=714

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KG+ + G  FST TLL++Y EASSDIPADPPT LP+I
Sbjct  670  KQLHASRTKGDPVEGFNFSTTTLLTRYLEASSDIPADPPTLLPRI  714



>gb|KHN45846.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST T+L++Y +ASSD+PAD PT LPKI
Sbjct  506  KQLNASRTKGEPVQGFNFSTTTMLTRYLQASSDVPADLPTVLPKI  550



>ref|NP_001242028.1| uncharacterized protein LOC100807719 [Glycine max]
 gb|ACU20878.1| unknown [Glycine max]
Length=568

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST T+L++Y +ASSD+PAD PT LPKI
Sbjct  524  KQLNASRTKGEPVQGFNFSTTTMLTRYLQASSDVPADLPTVLPKI  568



>ref|NP_001265881.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
 gb|ABE03628.1| glucose-6-phosphate isomerase [Solanum lycopersicum]
Length=568

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTK L+++Y EAS+D+P+DP T LP I
Sbjct  524  KQLHASRKKGESVEGFNFSTKMLITRYLEASADVPSDPSTLLPNI  568



>ref|XP_010313627.1| PREDICTED: glucose-6-phosphate isomerase isoform X1 [Solanum 
lycopersicum]
Length=574

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FSTK L+++Y EAS+D+P+DP T LP I
Sbjct  530  KQLHASRKKGESVEGFNFSTKMLITRYLEASADVPSDPSTLLPNI  574



>gb|KJB14513.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=569

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR K E + G  FST TLL++Y +ASSDIPA+PPT LP+I
Sbjct  525  KQLNASRTKSEPVEGFNFSTTTLLTRYLQASSDIPAEPPTLLPRI  569



>gb|KJB14509.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14510.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
 gb|KJB14512.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=568

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR K E + G  FST TLL++Y +ASSDIPA+PPT LP+I
Sbjct  524  KQLNASRTKSEPVEGFNFSTTTLLTRYLQASSDIPAEPPTLLPRI  568



>gb|KJB14511.1| hypothetical protein B456_002G128400 [Gossypium raimondii]
Length=545

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR K E + G  FST TLL++Y +ASSDIPA+PPT LP+I
Sbjct  501  KQLNASRTKSEPVEGFNFSTTTLLTRYLQASSDIPAEPPTLLPRI  545



>ref|XP_006434973.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
 gb|ESR48213.1| hypothetical protein CICLE_v10000722mg [Citrus clementina]
Length=568

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR K E I G  FST TLL++Y EASSDIP+DPPT LP+I
Sbjct  524  KQLHASRMKREPIEGFNFSTTTLLTRYLEASSDIPSDPPTLLPRI  568



>ref|XP_008377469.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=156

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL+KY EA+ DIPAD PT LP+I
Sbjct  112  KQLNASRTKGQPIEGFNYSTTTLLTKYLEATKDIPADLPTLLPQI  156



>sp|P54243.1|G6PI_OENME RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Oenothera sinuata 
var. hirsuta]
 emb|CAA61577.1| glucose-6-phosphate isomerase [Oenothera sinuata var. hirsuta]
Length=568

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGES+ G  FSTKTLL++Y EA+SD+PA P T LPKI
Sbjct  524  KQLHASRVKGESVEGFNFSTKTLLTRYLEATSDVPAAPSTLLPKI  568



>ref|XP_007221807.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|EMJ23006.1| hypothetical protein PRUPE_ppa003512mg [Prunus persica]
 gb|AGH25539.1| phosphoglucose isomerase [Prunus persica]
Length=568

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL KY EASSDIPAD PT LP+I
Sbjct  524  KQLNASRTKGQPIEGFNYSTTTLLKKYLEASSDIPADLPTLLPRI  568



>emb|CAB55566.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=568

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>ref|XP_004291883.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
 ref|XP_011459557.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Fragaria 
vesca subsp. vesca]
Length=568

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR +G+S+ G  FSTKTL++KY EASSDIPA+ PT LP+I
Sbjct  524  KQLHASRTEGKSVEGFNFSTKTLMTKYLEASSDIPAELPTLLPRI  568



>sp|P54240.1|G6PI1_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56693.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61566.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=568

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>sp|P54236.1|G6PI1_CLAFR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia franciscana]
 emb|CAA61576.1| glucose-6-phosphate isomerase [Clarkia franciscana]
Length=568

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>gb|KCW67833.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=566

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  +ST T+L++Y EA+SD+P+DPPT LP+I
Sbjct  522  KQLHASRVKGEPVEGFNYSTATMLTRYLEATSDVPSDPPTLLPRI  566



>ref|XP_010060937.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 ref|XP_010060938.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Eucalyptus 
grandis]
 gb|KCW67834.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
 gb|KCW67835.1| hypothetical protein EUGRSUZ_F01561 [Eucalyptus grandis]
Length=568

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  +ST T+L++Y EA+SD+P+DPPT LP+I
Sbjct  524  KQLHASRVKGEPVEGFNYSTATMLTRYLEATSDVPSDPPTLLPRI  568



>gb|AAY85660.1| cytosolic glucose-6-phosphate isomerase [Helianthus annuus]
Length=566

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGES+ G  FST  LL++Y EAS+D+P++P T LPKI
Sbjct  522  KQLHASRKKGESVEGFNFSTTKLLTRYLEASADVPSEPTTLLPKI  566



>sp|P54237.1|G6PI1_CLAMI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia mildrediae]
 emb|CAA61569.1| glucose-6-phosphate isomerase [Clarkia mildrediae]
Length=568

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR KGE + G  FSTKTLL+KY EA+SD+PADP T LP I
Sbjct  524  KQLHGSRVKGEPVEGFNFSTKTLLTKYLEATSDVPADPSTLLPNI  568



>sp|P54234.1|G6PI1_CLAAR RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia arcuata]
 emb|CAA61575.1| glucose-6-phosphate isomerase [Clarkia arcuata]
Length=568

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL +Y EA+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEGFNFSTKTLLERYLEATSDVPADPSTLLPNI  568



>ref|XP_008357232.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Malus 
domestica]
Length=288

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL+KY EA+ DIPAD PT LP+I
Sbjct  244  KQLNASRTKGQPIEGFNYSTTTLLTKYLEATKDIPADLPTLLPQI  288



>ref|XP_008377470.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B [Malus 
domestica]
Length=389

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL+KY EA+ DIPAD PT LP+I
Sbjct  345  KQLNASRTKGQPIEGFNYSTTTLLTKYLEATKDIPADLPTLLPQI  389



>emb|CDP07527.1| unnamed protein product [Coffea canephora]
Length=210

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR+KGE I G  FST T+LS+Y +AS+D+P+DP T LPK+
Sbjct  166  KQLHVSRRKGEPIEGFNFSTTTVLSRYLQASADVPSDPSTLLPKM  210



>gb|KHN22258.1| Glucose-6-phosphate isomerase, cytosolic [Glycine soja]
Length=550

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE I G  FST T+L++Y +ASSD+PAD  T LPKI
Sbjct  506  KQLNASRTKGEPIQGFNFSTTTMLTRYLQASSDVPADLSTVLPKI  550



>sp|P54241.1|G6PI2_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61571.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE++  G  FSTKTLL++Y EASSD+PADP T LPKI
Sbjct  524  KQLHASRVKGEAVEEGFNFSTKTLLTRYLEASSDVPADPSTLLPKI  569



>ref|XP_006582469.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase, 
cytosolic 2-like [Glycine max]
Length=462

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE I G  FST T+L++Y +ASSD+PAD  T LPKI
Sbjct  418  KQLNASRTKGEPIQGFNFSTTTMLTRYLQASSDVPADLSTVLPKI  462



>ref|XP_008377422.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Malus 
domestica]
Length=568

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL+KY EA+ DIPAD PT LP+I
Sbjct  524  KQLNASRTKGQPIEGFNYSTTTLLTKYLEATKDIPADLPTLLPQI  568



>gb|KDO84534.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=441

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR K E I G  FST TLL++Y EASSDIP+DP T LP+I
Sbjct  397  KQLHASRMKREPIEGFNFSTTTLLTRYLEASSDIPSDPSTLLPRI  441



>emb|CAC85684.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+P DP T LP I
Sbjct  482  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPTDPSTLLPNI  526



>sp|P54239.1|G6PI1_CLAWI RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia williamsonii]
 emb|CAA61574.1| glucose-6-phosphate isomerase [Clarkia williamsonii]
Length=568

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR KGE + G  FSTKTLL++Y EA+SD+PADP T LP I
Sbjct  524  KQLHGSRVKGEPVEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  568



>emb|CAD79590.1| cytosolic phosphoglucose isomerase, partial [Lopezia grandiflora]
Length=230

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR  GE++ G  FSTKTLL++Y + +SD+PADP T LPKI
Sbjct  186  KQLHASRVNGEAVEGFNFSTKTLLTRYLKETSDVPADPSTLLPKI  230



>emb|CAC85683.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=526

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+P DP T LP I
Sbjct  482  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVPTDPSTLLPNI  526



>emb|CAB55567.1| cytosolic phosphoglucose isomerase [Clarkia gracilis]
Length=569

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE++  G  FSTKTLL++Y EA+SD+PADP T LPKI
Sbjct  524  KQLHASRVKGEAVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>ref|XP_008377333.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
 ref|XP_008377335.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Malus domestica]
Length=568

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST +LL+KY EAS DIPAD PT LP+I
Sbjct  524  KQLNASRTKGQPIEGFNYSTTSLLTKYLEASKDIPADLPTLLPQI  568



>gb|AFK39110.1| unknown [Medicago truncatula]
Length=568

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNA R KGE I G  FS  T++++Y +AS+D+PADPPT LP+I
Sbjct  524  KQLNAFRTKGEPIQGFNFSATTMITRYLQASADVPADPPTTLPQI  568



>gb|KDO84533.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=606

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR K E I G  FST TLL++Y EASSDIP+DP T LP+I
Sbjct  562  KQLHASRMKREPIEGFNFSTTTLLTRYLEASSDIPSDPSTLLPRI  606



>gb|KDO84532.1| hypothetical protein CISIN_1g007374mg [Citrus sinensis]
Length=583

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR K E I G  FST TLL++Y EASSDIP+DP T LP+I
Sbjct  539  KQLHASRMKREPIEGFNFSTTTLLTRYLEASSDIPSDPSTLLPRI  583



>ref|XP_006473486.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Citrus 
sinensis]
Length=568

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR K E I G  FST TLL++Y EASSDIP+DP T LP+I
Sbjct  524  KQLHASRMKREPIEGFNFSTTTLLTRYLEASSDIPSDPSTLLPRI  568



>gb|KHN34179.1| Glucose-6-phosphate isomerase, cytosolic 1 [Glycine soja]
Length=552

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST  +L++Y +AS+D+PAD PT LP+I
Sbjct  508  KQLNASRTKGEPVQGFNFSTTAMLTRYLQASADVPADLPTRLPQI  552



>ref|XP_003554193.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Glycine 
max]
Length=568

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST  +L++Y +AS+D+PAD PT LP+I
Sbjct  524  KQLNASRTKGEPVQGFNFSTTAMLTRYLQASADVPADLPTRLPQI  568



>emb|CAC82581.1| cytosolic phosphoclucose isomerase, partial [Clarkia delicata]
Length=127

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  82   KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  127



>emb|CAC86122.1| cytosolic phosphoglucose isomerase [Clarkia modesta]
Length=569

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y EA+SD+PADP T LPKI
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>ref|XP_009365601.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
 ref|XP_009365602.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic-like [Pyrus 
x bretschneideri]
Length=568

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR +G+ I G  +ST TLL+KY EA+ DIPAD PT LP+I
Sbjct  524  KQLNASRTEGQPIEGFNYSTTTLLTKYLEATKDIPADLPTLLPQI  568



>sp|P54242.1|G6PI2_CLAXA RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia xantiana]
 emb|CAA56694.1| glucose-6-phosphate isomerase [Clarkia xantiana]
 emb|CAA61567.1| glucose-6-phosphate isomerase [Clarkia xantiana subsp. parviflora]
Length=569

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y EA+SD+PADP T LPKI
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPKI  569



>ref|XP_010263691.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010263692.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Nelumbo 
nucifera]
Length=568

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST T+L+KY EA S +PA+P T LPK+
Sbjct  524  KQLNASRTKGEPVEGFNFSTTTMLNKYLEAKSRVPANPTTVLPKV  568



>emb|CAC84504.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=150

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  105  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  150



>ref|XP_008444704.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444705.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
 ref|XP_008444706.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Cucumis 
melo]
Length=566

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G   ST TLL +Y EASSD+P+D PT LP+I
Sbjct  522  KQLNASRTKGQPIEGFNHSTTTLLKRYLEASSDVPSDLPTLLPRI  566



>emb|CAC85668.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=178

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  133  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  178



>ref|XP_002312387.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
 gb|EEE89754.2| hypothetical protein POPTR_0008s11770g [Populus trichocarpa]
Length=568

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FST T+L+KY + SS++PA+PPT LP+I
Sbjct  524  KQLHASRVKGEPVEGFNFSTTTMLTKYLKESSEVPANPPTILPRI  568



>ref|XP_011021922.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Populus 
euphratica]
Length=568

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FST T+LSK+ + SS++PA+PPT LP+I
Sbjct  524  KQLHASRVKGEPVDGFNFSTTTMLSKFLKESSEVPANPPTILPRI  568



>gb|KHG04166.1| Glucose-6-phosphate isomerase, cytosolic [Gossypium arboreum]
Length=560

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN SR K E + G  FST TLL++Y +ASSDIPA+P T LP+I
Sbjct  516  KQLNGSRTKSEPVEGFNFSTTTLLTRYLQASSDIPAEPLTLLPRI  560



>ref|XP_010106007.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
 gb|EXC07277.1| Glucose-6-phosphate isomerase, cytosolic 1 [Morus notabilis]
Length=547

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G   ST TLL++Y EASSD+P+D PT LP+I
Sbjct  503  KQLHASRTKGEPVQGFNCSTTTLLTRYLEASSDVPSDLPTLLPRI  547



>ref|XP_004152701.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 ref|XP_004160034.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2-like [Cucumis 
sativus]
 gb|KGN62593.1| hypothetical protein Csa_2G361580 [Cucumis sativus]
Length=566

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE I G   ST TLL +Y EASSD+P+D PT LP+I
Sbjct  522  KQLSASRTKGEPIEGFNHSTTTLLKRYLEASSDVPSDLPTLLPRI  566



>ref|XP_009364475.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
 ref|XP_009364484.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Pyrus x 
bretschneideri]
Length=568

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KG+ I G  +ST TLL+KY EAS+D PA  PT LP+I
Sbjct  524  KQLNASRTKGQPIEGFNYSTATLLTKYLEASTDFPAYLPTLLPQI  568



>sp|P54235.1|G6PI1_CLACO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia concinna]
 emb|CAA61570.1| glucose-6-phosphate isomerase [Clarkia concinna subsp. automixa]
Length=569

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y EA+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLEATSDVPADPSTLLPNI  569



>ref|XP_010677508.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=568

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR  GE+I G  FST T+L+KY + SSD+PA+ PT LP++
Sbjct  524  KQLHASRSNGEAIQGFNFSTTTVLTKYLQGSSDVPAELPTKLPQV  568



>emb|CAC85686.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  482  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  527



>ref|XP_002510371.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
 gb|EEF52558.1| glucose-6-phosphate isomerase, putative [Ricinus communis]
Length=568

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST T+L++Y E +S++PA P T LP+I
Sbjct  524  KQLNASRTKGEPVEGFNFSTTTMLTRYLEETSEVPAKPQTLLPRI  568



>emb|CAC85685.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=516

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  471  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  516



>emb|CAC84508.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
 emb|CAC85681.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85682.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=527

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  482  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  527



>emb|CAC82579.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>emb|CAC84514.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=527

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR  GE +  G  FSTKTLL++Y +A+SD+PADP T LPKI
Sbjct  482  KQLHASRVNGEPVEEGFNFSTKTLLTRYLKATSDVPADPSTLLPKI  527



>ref|XP_002282774.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 ref|XP_010664679.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Vitis vinifera]
 emb|CBI19685.3| unnamed protein product [Vitis vinifera]
Length=568

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN++R KG+ + G  +ST TLL +Y EASSDIP+DP T LP++
Sbjct  524  KQLNSARTKGKPVEGFNYSTTTLLKRYLEASSDIPSDPCTLLPQM  568



>emb|CAC82578.1| cytosolic phosphoclucose isomerase [Clarkia epilobioides]
Length=569

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>sp|P34797.1|G6PI3_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2B; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI, 
partial [Clarkia lewisii]
 emb|CAA50403.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
Length=317

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A++D+PADP T LP I
Sbjct  272  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATTDVPADPSTLLPNI  317



>sp|P29333.1|G6PI2_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 2A; Short=GPI; 
AltName: Full=PGI3; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA45616.1| glucose-6-phosphate isomerase [Clarkia lewisii]
 emb|CAA61565.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE +  G  FSTKTLL++Y +A++D+PADP T LP I
Sbjct  524  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATTDVPADPSTLLPNI  569



>emb|CAC84511.1| cytosolic phosphoglucose isomerase, partial [Clarkia delicata]
Length=526

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K + + G  FSTKTLL +Y EA+SD+PADP T LP I
Sbjct  482  KQLHGSRVKAKPVEGFNFSTKTLLIRYLEATSDVPADPSTLLPNI  526



>gb|KDP38492.1| hypothetical protein JCGZ_04417 [Jatropha curcas]
Length=568

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASR KGE + G  FST +LL +Y E SSD+P +P T LP+I
Sbjct  524  KQLHASRTKGEPVEGFNFSTTSLLKRYLEESSDVPKNPQTLLPRI  568



>ref|XP_011083695.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
 ref|XP_011083696.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Sesamum 
indicum]
Length=568

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ASRKKGE++ G  FST T+L +Y EAS+D+P +  T LPK+
Sbjct  524  KQLHASRKKGEAVEGFNFSTTTVLKRYLEASADVPKEDCTILPKM  568



>sp|P54238.1|G6PI1_CLARO RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Clarkia rostrata]
 emb|CAA61572.1| glucose-6-phosphate isomerase [Clarkia rostrata]
Length=570

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  524  KQLHGSRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>sp|P34796.1|G6PI1_CLALE RecName: Full=Glucose-6-phosphate isomerase, cytosolic 1A; Short=GPI; 
AltName: Full=PGI2; Short=PGI; AltName: Full=Phosphoglucose 
isomerase; AltName: Full=Phosphohexose isomerase; Short=PHI 
[Clarkia lewisii]
 emb|CAA50402.1| cytosolic phosphoglucose isomerase [Clarkia lewisii]
 emb|CAA61564.1| glucose-6-phosphate isomerase [Clarkia lewisii]
Length=569

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR KGE +  G  FSTKTLL++Y +A+SD+PADP T LP I
Sbjct  524  KQLHGSRVKGEPVEEGFNFSTKTLLTRYLQATSDVPADPSTLLPNI  569



>ref|XP_006837344.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
 gb|ERN00198.1| hypothetical protein AMTR_s00111p00094320 [Amborella trichopoda]
Length=568

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN SR KGE + G  +ST T+L+KY EA S IP++P T LPK+
Sbjct  524  KQLNLSRTKGEPVEGFNYSTTTMLTKYLEAKSPIPSEPCTILPKV  568



>ref|XP_007151167.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
 gb|ESW23161.1| hypothetical protein PHAVU_004G023500g [Phaseolus vulgaris]
Length=568

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN SR +GE + G   ST ++L++Y +AS+D+PAD PT LP+I
Sbjct  524  KQLNVSRTQGEPVQGFNSSTTSMLTRYLQASADVPADLPTRLPQI  568



>sp|O82059.2|G6PI_SPIOL RecName: Full=Glucose-6-phosphate isomerase, cytosolic; Short=GPI; 
AltName: Full=Phosphoglucose isomerase; Short=PGI; AltName: 
Full=Phosphohexose isomerase; Short=PHI [Spinacia oleracea]
 emb|CAA03983.1| glucose-6-phosphate isomerase [Spinacia oleracea]
Length=566

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALP  69
            KQL+ASR  GE++ G  FST T+++KY + +SD+PA+ PT LP
Sbjct  524  KQLHASRTNGEAVKGFNFSTTTVMAKYLQETSDVPAELPTKLP  566



>gb|EYU45142.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=569

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASRKK E + G  FST  LL++Y EAS+DI  +  T LPK+
Sbjct  525  KQLNASRKKAEPVEGFNFSTTALLTRYLEASTDISKEDCTVLPKM  569



>gb|EYU45143.1| hypothetical protein MIMGU_mgv1a003701mg [Erythranthe guttata]
Length=568

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASRKK E + G  FST  LL++Y EAS+DI  +  T LPK+
Sbjct  524  KQLNASRKKAEPVEGFNFSTTALLTRYLEASTDISKEDCTVLPKM  568



>emb|CAC85669.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85648.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=168

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIP  93
            KQL+ASR KGE + G  FSTKTLL++Y EA+SD+P
Sbjct  133  KQLHASRVKGEPVEGFNFSTKTLLTRYLEATSDVP  167



>ref|XP_010254873.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic [Nelumbo 
nucifera]
Length=568

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLNASR KGE + G  FST  +L+KY EA S + A P T LPK+
Sbjct  524  KQLNASRIKGEPVEGFNFSTTKMLNKYLEAKSRVLAHPSTILPKM  568



>gb|EPS71211.1| glucose-6-phosphate isomerase [Genlisea aurea]
Length=569

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIP-ADPPTALPK  66
            KQL+ASRKKGE+I G  FST  LL KY +ASS+ P  +  T LPK
Sbjct  524  KQLHASRKKGEAIRGFNFSTTKLLEKYLQASSEDPHTEEITVLPK  568



>emb|CAC85647.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPA  90
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PA
Sbjct  133  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPA  169



>emb|CAC85670.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
 emb|CAC85671.1| cytosolic phosphoglucose isomerase, partial [Clarkia similis]
Length=169

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  197  KQLNASRKKGESIX-GXXFSTKTLLSKYXEASSDIPA  90
            KQL+ASR KGE +  G  FSTKTLL++Y +A+SD+PA
Sbjct  133  KQLHASRVKGEPVEEGFNFSTKTLLTRYLQATSDVPA  169



>ref|XP_010935387.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 2B-like [Elaeis 
guineensis]
Length=224

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN SR KGE + G  FST TLL++Y EA S + ++  T LPK+
Sbjct  181  KQLNLSRTKGEPVVGFNFSTSTLLTRYLEADSGVQSN-STMLPKM  224



>ref|XP_008220896.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic, partial 
[Prunus mume]
Length=556

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSD  99
            KQLNASR KG+ I G  +ST TLL KY EASSD
Sbjct  524  KQLNASRTKGQPIEGFNYSTTTLLKKYLEASSD  556



>dbj|BAA23179.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23184.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23185.2| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23176.1| phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23181.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23183.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23177.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
 dbj|BAA23178.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>dbj|BAA23182.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>ref|XP_010519111.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X1 
[Tarenaya hassleriana]
 ref|XP_010519112.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic isoform X2 
[Tarenaya hassleriana]
Length=561

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSD  99
            KQLNASR +G +I G  FST TLL +Y EASSD
Sbjct  525  KQLNASRTEGAAIDGFNFSTTTLLQRYLEASSD  557



>dbj|BAA23180.1| cytosolic phosphoglucose isomerase [Dioscorea tokoro]
Length=567

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR K E + G  FST TLL++Y EA + +P+D  + LPK+
Sbjct  524  KQLHLSRTKAEPVEGFNFSTTTLLTRYLEAETGVPSD-QSQLPKL  567



>ref|XP_010942803.1| PREDICTED: glucose-6-phosphate isomerase, cytosolic 1 [Elaeis 
guineensis]
Length=567

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQLN SR KGE + G  FST TLL++Y E  S + ++  T LPK+
Sbjct  524  KQLNLSRTKGEPVAGFNFSTSTLLTRYLEGDSGVQSN-STMLPKM  567



>gb|AEH27532.1| putative glucose-6-phosphateisomerase [Amorphophallus konjac]
Length=210

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  197  KQLNASRKKGESIXGXXFSTKTLLSKYXEASSDIPADPPTALPKI  63
            KQL+ SR  GE + G  +ST  LL++Y EA + +P+   T LPK+
Sbjct  166  KQLHLSRTAGEPVKGFNYSTTALLTRYLEAETGLPSGSSTVLPKV  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565033620200