BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005C21

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD02268.1|  aspartate aminotransferase                             194   4e-59   Nicotiana tabacum [American tobacco]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    197   2e-57   Nicotiana sylvestris
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    195   1e-56   Solanum tuberosum [potatoes]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     194   1e-56   Solanum tuberosum [potatoes]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    192   2e-55   Solanum lycopersicum
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    191   2e-55   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD94538.1|  aspartate aminotransferase                             183   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46621.1|  unknown                                                 184   6e-55   Lotus japonicus
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    190   7e-55   Nelumbo nucifera [Indian lotus]
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    190   1e-54   Populus euphratica
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        190   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        189   1e-54   
ref|XP_010042868.1|  PREDICTED: aspartate aminotransferase P2, mi...    179   3e-54   Eucalyptus grandis [rose gum]
emb|CDP18792.1|  unnamed protein product                                190   3e-54   Coffea canephora [robusta coffee]
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    187   8e-54   
gb|AAB46611.1|  aspartate aminotransferase                              187   9e-54   Medicago sativa [alfalfa]
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   186   9e-54   Citrus sinensis [apfelsine]
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    187   1e-53   Populus euphratica
gb|KEH39860.1|  aspartate aminotransferase                              187   1e-53   Medicago truncatula
prf||1908424A  Asp aminotransferase                                     187   1e-53
gb|AAC12674.1|  aspartate aminotransferase                              187   1e-53   Lotus corniculatus
ref|XP_002515455.1|  aspartate aminotransferase, putative               187   1e-53   Ricinus communis
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             187   1e-53   Citrus clementina [clementine]
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         187   1e-53   Jatropha curcas
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   187   2e-53   Citrus sinensis [apfelsine]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             186   2e-53   Capsella rubella
ref|NP_001237987.1|  aspartate aminotransferase                         186   2e-53   
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    186   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    186   2e-53   Glycine max [soybeans]
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    186   2e-53   Prunus mume [ume]
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    186   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             186   2e-53   
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    187   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             186   3e-53   Prunus persica
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    186   3e-53   Brassica rapa
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    186   3e-53   Cicer arietinum [garbanzo]
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    186   4e-53   Malus domestica [apple tree]
emb|CDJ26231.1|  putative aspartate aminotransferase                    185   6e-53   Brassica oleracea
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             185   7e-53   
gb|ABK24563.1|  unknown                                                 185   8e-53   Picea sitchensis
emb|CAA56932.1|  aspartate aminotransferase                             184   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                            184   8e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40845.1|  unknown                                                 184   8e-53   Picea sitchensis
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    184   9e-53   Camelina sativa [gold-of-pleasure]
ref|NP_001190885.1|  aspartate aminotransferase                         184   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161154.1|  hypothetical protein PHAVU_001G0470000g            179   1e-52   Phaseolus vulgaris [French bean]
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    184   1e-52   Elaeis guineensis
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    184   2e-52   Glycine max [soybeans]
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    183   2e-52   
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    184   2e-52   Glycine max [soybeans]
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    183   4e-52   Eucalyptus grandis [rose gum]
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    183   4e-52   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                          183   4e-52   
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             182   6e-52   
prf||2009357A  Asp aminotransferase                                     182   8e-52
emb|CDY13467.1|  BnaA03g51850D                                          182   9e-52   Brassica napus [oilseed rape]
emb|CDX68807.1|  BnaC01g06460D                                          183   9e-52   
gb|ACU24502.1|  unknown                                                 182   9e-52   Glycine max [soybeans]
gb|ABR16448.1|  unknown                                                 181   1e-51   Picea sitchensis
ref|XP_010089944.1|  Aspartate aminotransferase                         182   1e-51   
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  181   2e-51   Canavalia lineata
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    181   2e-51   Phaseolus vulgaris [French bean]
gb|ACR34530.1|  unknown                                                 181   2e-51   Zea mays [maize]
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     181   2e-51   Eucalyptus grandis [rose gum]
ref|NP_001149005.1|  aspartate aminotransferase                         181   2e-51   
gb|AAM67272.1|  aspartate aminotransferase                              181   2e-51   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   181   2e-51   Panicum miliaceum [broom millet]
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    180   2e-51   Cucumis melo [Oriental melon]
ref|NP_001031767.1|  aspartate aminotransferase                         181   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    180   4e-51   Setaria italica
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    180   4e-51   Vitis vinifera
emb|CAN76227.1|  hypothetical protein VITISV_000267                     180   4e-51   Vitis vinifera
gb|KJB65890.1|  hypothetical protein B456_010G117400                    180   4e-51   Gossypium raimondii
gb|KJB65891.1|  hypothetical protein B456_010G117400                    180   4e-51   Gossypium raimondii
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    180   5e-51   Cucumis sativus [cucumbers]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    180   6e-51   Cucumis melo [Oriental melon]
gb|AAO23563.1|  aspartate aminotransferase                              178   8e-51   Oryza sativa [red rice]
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    179   8e-51   
ref|XP_007011759.1|  Aspartate aminotransferase                         179   8e-51   
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                179   1e-50   Erythranthe guttata [common monkey flower]
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                179   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_001785888.1|  predicted protein                                  179   2e-50   
ref|NP_001048397.1|  Os02g0797500                                       179   2e-50   
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          178   2e-50   Amborella trichopoda
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    178   3e-50   Lupinus angustifolius
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    178   3e-50   Phoenix dactylifera
emb|CDX72339.1|  BnaC07g43610D                                          177   4e-50   
gb|KJB55008.1|  hypothetical protein B456_009G060500                    176   4e-50   Gossypium raimondii
emb|CAA04697.1|  aspartate aminotransferase 2                           177   5e-50   Canavalia lineata
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    177   6e-50   Fragaria vesca subsp. vesca
gb|KJB55006.1|  hypothetical protein B456_009G060500                    177   7e-50   Gossypium raimondii
gb|KJB55007.1|  hypothetical protein B456_009G060500                    177   8e-50   Gossypium raimondii
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    176   9e-50   
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    176   1e-49   Gossypium arboreum [tree cotton]
dbj|BAJ97030.1|  predicted protein                                      173   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB55009.1|  hypothetical protein B456_009G060500                    176   2e-49   Gossypium raimondii
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               176   3e-49   Triticum urartu
dbj|BAJ92741.1|  predicted protein                                      174   5e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    174   6e-49   Brachypodium distachyon [annual false brome]
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               174   1e-48   
dbj|BAJ96638.1|  predicted protein                                      173   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             172   2e-48   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             172   3e-48   
gb|EPS71467.1|  aspartate aminotransferase                              160   4e-47   Genlisea aurea
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  164   1e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    156   4e-42   Phoenix dactylifera
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    154   1e-41   
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            147   9e-39   Glycine soja [wild soybean]
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             140   4e-36   Chlorella variabilis
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    139   1e-35   
ref|XP_008784800.1|  PREDICTED: aspartate aminotransferase, chlor...    135   1e-34   
ref|XP_005642879.1|  aspartate aminotransferase                         134   5e-34   Coccomyxa subellipsoidea C-169
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       126   2e-31   Auxenochlorella protothecoides
ref|XP_002501168.1|  aspartate aminotransferase                         125   7e-31   Micromonas commoda
ref|XP_001700039.1|  aspartate aminotransferase                         123   3e-30   Chlamydomonas reinhardtii
ref|XP_001695040.1|  aspartate aminotransferase                         122   1e-29   Chlamydomonas reinhardtii
gb|KIZ05915.1|  aspartate aminotransferase                              118   9e-29   Monoraphidium neglectum
ref|XP_002950644.1|  aspartate aminotransferase                         119   9e-29   Volvox carteri f. nagariensis
ref|XP_002954714.1|  aspartate aminotransferase                         119   1e-28   Volvox carteri f. nagariensis
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799              118   1e-28   Chlorella variabilis
ref|XP_001771002.1|  predicted protein                                  115   2e-27   
ref|XP_003064597.1|  aspartate amino transferase                        115   3e-27   Micromonas pusilla CCMP1545
ref|XP_005643912.1|  aspartate aminotransferase                         111   5e-26   Coccomyxa subellipsoidea C-169
emb|CDX70399.1|  BnaC03g04830D                                          110   1e-25   
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    110   1e-25   Vitis vinifera
ref|XP_009131210.1|  PREDICTED: aspartate aminotransferase 3, chl...    110   1e-25   Brassica rapa
emb|CBI20886.3|  unnamed protein product                                110   1e-25   Vitis vinifera
gb|AAM91546.1|  aspartate aminotransferase Asp2                         107   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137184.1|  hypothetical protein PHAVU_009G106800g             109   2e-25   Phaseolus vulgaris [French bean]
ref|XP_002514283.1|  aspartate aminotransferase, putative               109   2e-25   
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    110   2e-25   Gossypium arboreum [tree cotton]
gb|KJB07521.1|  hypothetical protein B456_001G028100                    110   2e-25   Gossypium raimondii
gb|AEX09183.1|  putative aspartate aminotransferase 2                   110   2e-25   Gossypium hirsutum [American cotton]
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    109   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    109   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006287876.1|  hypothetical protein CARUB_v10001103mg             109   3e-25   Capsella rubella
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    109   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    109   3e-25   Oryza brachyantha
ref|XP_006289742.1|  hypothetical protein CARUB_v10003310mg             109   3e-25   Capsella rubella
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            108   4e-25   
ref|XP_004136291.1|  PREDICTED: aspartate aminotransferase, chlor...    109   4e-25   Cucumis sativus [cucumbers]
ref|XP_010419724.1|  PREDICTED: aspartate aminotransferase 3, chl...    109   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010491885.1|  PREDICTED: aspartate aminotransferase 3, chl...    108   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010453196.1|  PREDICTED: aspartate aminotransferase 3, chl...    108   5e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             108   5e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          108   5e-25   Amborella trichopoda
ref|XP_002873517.1|  hypothetical protein ARALYDRAFT_487989             108   5e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_196713.1|  aspartate aminotransferase 3                          108   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             108   6e-25   Citrus clementina [clementine]
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    108   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044317.1|  Os01g0760600                                       108   6e-25   
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    108   6e-25   Populus euphratica
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    108   7e-25   Populus euphratica
ref|XP_007012061.1|  Aspartate aminotransferase 3                       108   7e-25   
gb|KFK25414.1|  aspartate aminotransferase                              108   7e-25   Arabis alpina [alpine rockcress]
emb|CDM84293.1|  unnamed protein product                                108   8e-25   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002324997.1|  aspartate aminotransferase family protein          108   8e-25   Populus trichocarpa [western balsam poplar]
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    108   8e-25   Daucus carota [carrots]
gb|KJB64944.1|  hypothetical protein B456_010G072900                    108   9e-25   Gossypium raimondii
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 107   9e-25   Gossypium arboreum [tree cotton]
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    108   9e-25   Nicotiana tomentosiformis
ref|XP_008466236.1|  PREDICTED: aspartate aminotransferase, cytop...    108   1e-24   Cucumis melo [Oriental melon]
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    108   1e-24   Citrus sinensis [apfelsine]
gb|AAL82596.1|  aspartate aminotransferase 1                            102   1e-24   Musa acuminata [banana]
gb|AFK44136.1|  unknown                                                 103   1e-24   Medicago truncatula
emb|CAN70394.1|  hypothetical protein VITISV_020521                     107   1e-24   Vitis vinifera
gb|AAL09704.1|AF419301_1  aspartate aminotransferase                    107   1e-24   Securigera parviflora
gb|AAA79370.1|  aspartate aminotransferase                              107   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197456.1|  aspartate aminotransferase                            107   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ABY58643.1|  aspartate aminotransferase                              107   1e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    107   1e-24   Setaria italica
ref|XP_010519717.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   Phoenix dactylifera
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   Sesamum indicum [beniseed]
ref|XP_006399658.1|  hypothetical protein EUTSA_v10013515mg             107   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   Vitis vinifera
ref|XP_010519716.1|  PREDICTED: aspartate aminotransferase, cytop...    106   2e-24   Tarenaya hassleriana [spider flower]
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         107   2e-24   Jatropha curcas
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   Nelumbo nucifera [Indian lotus]
tpg|DAA57534.1|  TPA: hypothetical protein ZEAMMB73_000065              103   2e-24   
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    107   2e-24   
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       107   2e-24   Cicer arietinum [garbanzo]
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    107   3e-24   Elaeis guineensis
gb|AEX09182.1|  putative aspartate aminotransferase 1                   106   3e-24   Gossypium hirsutum [American cotton]
ref|XP_004291203.1|  PREDICTED: aspartate aminotransferase, cytop...    106   4e-24   Fragaria vesca subsp. vesca
emb|CDY44925.1|  BnaA02g04300D                                          105   4e-24   Brassica napus [oilseed rape]
ref|XP_010532471.1|  PREDICTED: aspartate aminotransferase 3, chl...    106   5e-24   Tarenaya hassleriana [spider flower]
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     106   5e-24   Eucalyptus grandis [rose gum]
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    106   5e-24   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA57533.1|  TPA: hypothetical protein ZEAMMB73_000065              103   5e-24   
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       105   5e-24   Glycine max [soybeans]
ref|XP_002516566.1|  aspartate aminotransferase, putative               105   5e-24   Ricinus communis
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818             105   5e-24   
ref|NP_001237541.1|  aspartate aminotransferase glyoxysomal isozy...    105   6e-24   Glycine max [soybeans]
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             105   6e-24   Citrus clementina [clementine]
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954             105   6e-24   
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         105   7e-24   Jatropha curcas
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 105   8e-24   
ref|XP_010100270.1|  Aspartate aminotransferase                         105   8e-24   Morus notabilis
emb|CDP03316.1|  unnamed protein product                                105   9e-24   Coffea canephora [robusta coffee]
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    105   9e-24   Solanum lycopersicum
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    105   9e-24   Solanum tuberosum [potatoes]
emb|CDP16161.1|  unnamed protein product                                105   9e-24   Coffea canephora [robusta coffee]
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    105   1e-23   Solanum tuberosum [potatoes]
emb|CDX92520.1|  BnaA10g15590D                                          104   1e-23   
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    104   1e-23   Brassica rapa
emb|CDY65959.1|  BnaC09g54080D                                          104   1e-23   Brassica napus [oilseed rape]
gb|KHN10226.1|  Aspartate aminotransferase 1                            104   1e-23   Glycine soja [wild soybean]
gb|ACU21245.1|  unknown                                                 104   1e-23   Glycine max [soybeans]
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    104   1e-23   Nicotiana sylvestris
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    104   2e-23   Nicotiana tomentosiformis
emb|CAA45023.1|  aspartate aminotransferase                             104   2e-23   Panicum miliaceum [broom millet]
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    104   2e-23   Nicotiana tomentosiformis
ref|XP_002308618.1|  aspartate transaminase family protein              104   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    104   2e-23   Sesamum indicum [beniseed]
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    104   2e-23   Populus euphratica
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    105   2e-23   
emb|CAA63894.1|  aspartate aminotransferase                             103   2e-23   Lotus japonicus
emb|CAA43779.1|  aspartate aminotransferase                             103   3e-23   Medicago sativa [alfalfa]
gb|KEH36022.1|  aspartate aminotransferase                              103   3e-23   Medicago truncatula
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    104   3e-23   
gb|AAA33408.1|  aspartate aminotransferase P1                           103   3e-23   Lupinus angustifolius
ref|XP_010688229.1|  PREDICTED: aspartate aminotransferase, cytop...    103   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    104   3e-23   
ref|NP_001141224.1|  uncharacterized protein LOC100273311               104   3e-23   Zea mays [maize]
gb|AAA50160.1|  aspartate aminotransferase P1                           103   3e-23   Lupinus angustifolius
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    103   3e-23   Citrus sinensis [apfelsine]
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    103   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    103   3e-23   Nicotiana sylvestris
gb|KEH36020.1|  aspartate aminotransferase                              103   3e-23   Medicago truncatula
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    103   4e-23   Malus domestica [apple tree]
ref|XP_010048107.1|  PREDICTED: aspartate aminotransferase, cytop...    103   4e-23   Eucalyptus grandis [rose gum]
gb|AFK40370.1|  unknown                                                 103   4e-23   Medicago truncatula
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    103   4e-23   Brachypodium distachyon [annual false brome]
gb|KCW80240.1|  hypothetical protein EUGRSUZ_C01585                     103   4e-23   Eucalyptus grandis [rose gum]
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    103   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    103   5e-23   Prunus mume [ume]
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             103   5e-23   Prunus persica
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    102   6e-23   Brassica rapa
emb|CDY42276.1|  BnaC02g08820D                                          102   6e-23   Brassica napus [oilseed rape]
gb|AIT70250.1|  aspartate aminotransferase                              102   6e-23   Betaphycus philippinensis
gb|KFK26196.1|  hypothetical protein AALP_AA8G215200                    102   6e-23   Arabis alpina [alpine rockcress]
ref|XP_004243159.1|  PREDICTED: aspartate aminotransferase, cytop...    102   6e-23   
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             102   7e-23   Eutrema salsugineum [saltwater cress]
emb|CDY71396.1|  BnaCnng72730D                                          100   8e-23   Brassica napus [oilseed rape]
ref|XP_009367911.1|  PREDICTED: aspartate aminotransferase, cytop...    102   1e-22   Pyrus x bretschneideri [bai li]
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                102   1e-22   Erythranthe guttata [common monkey flower]
gb|KFK40563.1|  hypothetical protein AALP_AA2G012200                  97.4    1e-22   Arabis alpina [alpine rockcress]
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    102   1e-22   Pyrus x bretschneideri [bai li]
gb|ABR16105.1|  unknown                                                 101   2e-22   Picea sitchensis
gb|AIT70256.1|  aspartate aminotransferase                              101   2e-22   Eucheuma denticulatum
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    101   2e-22   Medicago sativa [alfalfa]
gb|ACN40894.1|  unknown                                                 101   3e-22   Picea sitchensis
gb|KJB64945.1|  hypothetical protein B456_010G072900                    100   3e-22   Gossypium raimondii
ref|XP_005705870.1|  aspartate aminotransferase                         100   3e-22   Galdieria sulphuraria
ref|XP_009112705.1|  PREDICTED: aspartate aminotransferase, cytop...    100   3e-22   Brassica rapa
ref|XP_010473503.1|  PREDICTED: aspartate aminotransferase, cytop...    100   5e-22   Camelina sativa [gold-of-pleasure]
gb|KJB07520.1|  hypothetical protein B456_001G028000                  99.8    6e-22   Gossypium raimondii
ref|XP_002308617.2|  hypothetical protein POPTR_0006s25820g             100   6e-22   
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    100   7e-22   Tarenaya hassleriana [spider flower]
ref|XP_007012062.1|  Aspartate aminotransferase 3, putative             101   8e-22   
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821              100   8e-22   Stereum hirsutum FP-91666 SS1
gb|KJB07518.1|  hypothetical protein B456_001G028000                  99.8    8e-22   Gossypium raimondii
gb|AIT70254.1|  aspartate aminotransferase                            99.8    8e-22   Grateloupia livida
ref|XP_002680594.1|  aspartate aminotransferase                         100   1e-21   Naegleria gruberi strain NEG-M
ref|XP_011019649.1|  PREDICTED: aspartate aminotransferase, cytop...  99.0    1e-21   Populus euphratica
gb|AIT70257.1|  aspartate aminotransferase                            99.0    1e-21   Gracilaria blodgettii
ref|XP_007338662.1|  aspartate aminotransferase                       98.6    3e-21   
ref|XP_010048111.1|  PREDICTED: aspartate aminotransferase, cytop...  98.2    3e-21   
gb|KHG23915.1|  Aspartate aminotransferase, cytoplasmic               98.2    3e-21   Gossypium arboreum [tree cotton]
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828           98.2    3e-21   Heterobasidion irregulare TC 32-1
ref|XP_010048110.1|  PREDICTED: aspartate aminotransferase, cytop...  98.2    3e-21   Eucalyptus grandis [rose gum]
emb|CDY34689.1|  BnaC04g19940D                                        98.2    3e-21   Brassica napus [oilseed rape]
gb|EFA86317.1|  aspartate aminotransferase                            98.2    3e-21   Heterostelium album PN500
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242            97.8    4e-21   Gloeophyllum trabeum ATCC 11539
gb|AIT70267.1|  aspartate aminotransferase                            97.4    5e-21   Grateloupia filicina
ref|XP_010430356.1|  PREDICTED: aspartate aminotransferase, cytop...  97.4    5e-21   Camelina sativa [gold-of-pleasure]
dbj|BAE99790.1|  aspartate aminotransferase                           95.5    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004356181.1|  aspartate aminotransferase                       97.4    7e-21   Cavenderia fasciculata
gb|EPS28777.1|  hypothetical protein PDE_03723                        97.8    7e-21   
ref|XP_003402856.1|  PREDICTED: aspartate aminotransferase, mitoc...  97.4    7e-21   
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                 97.1    8e-21   
ref|XP_003486130.1|  PREDICTED: aspartate aminotransferase, mitoc...  97.1    8e-21   
gb|AIT70255.1|  aspartate aminotransferase                            96.7    9e-21   
ref|XP_009123404.1|  PREDICTED: aspartate aminotransferase, cytop...  96.7    1e-20   
gb|AIT70258.1|  aspartate aminotransferase                            96.7    1e-20   
emb|CCG83496.1|  putative Aspartate transaminase                      96.3    1e-20   
gb|EHA22111.1|  hypothetical protein ASPNIDRAFT_56390                 97.1    2e-20   
gb|EMD38441.1|  hypothetical protein CERSUDRAFT_82693                 96.3    2e-20   
gb|AIT70259.1|  aspartate aminotransferase                            96.3    2e-20   
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                 96.3    2e-20   
ref|XP_010418279.1|  PREDICTED: aspartate aminotransferase, cytop...  95.9    2e-20   
gb|AAA79372.1|  aspartate aminotransferase                            95.9    2e-20   
ref|NP_564803.1|  aspartate aminotransferase 4                        95.9    2e-20   
ref|NP_849838.1|  aspartate aminotransferase 4                        95.9    2e-20   
ref|XP_005535358.1|  aspartate aminotransferase                       96.3    2e-20   
emb|CDY32206.1|  BnaA03g54610D                                        95.5    3e-20   
emb|CDY20276.1|  BnaC04g36800D                                        95.1    3e-20   
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873           95.5    3e-20   
ref|XP_002765977.1|  aspartate aminotransferase, cytoplasmic isoz...  93.6    4e-20   
gb|KIJ34684.1|  hypothetical protein M422DRAFT_213094                 95.1    4e-20   
gb|ESA01319.1|  hypothetical protein GLOINDRAFT_338037                95.1    4e-20   
gb|EGE78706.1|  aspartate aminotransferase                            95.9    4e-20   
ref|XP_002391771.1|  hypothetical protein MPER_08751                  92.8    5e-20   
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                 95.1    5e-20   
gb|KIV84393.1|  hypothetical protein PV11_00176                       95.5    5e-20   
ref|XP_002847042.1|  aspartate aminotransferase                       95.1    5e-20   
emb|CDY39814.1|  BnaA09g10660D                                        94.7    5e-20   
ref|XP_002886453.1|  hypothetical protein ARALYDRAFT_475071           94.7    5e-20   
gb|EJU05387.1|  aspartate aminotransferase                            94.7    5e-20   
gb|AIT70262.1|  aspartate aminotransferase                            94.7    5e-20   
gb|KFH12158.1|  aspartate aminotransferase                            94.0    5e-20   
emb|CEL53865.1|  aspartate aminotransferase                           94.7    6e-20   
ref|XP_755298.1|  aspartate transaminase                              95.5    6e-20   
ref|XP_002764661.1|  aspartate aminotransferase, cytoplasmic, put...  94.4    6e-20   
ref|XP_009052331.1|  hypothetical protein LOTGIDRAFT_231665           94.7    6e-20   
gb|KEY79534.1|  aspartate transaminase                                95.5    6e-20   
dbj|GAM40234.1|  aspartate aminotransferase                           94.7    6e-20   
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                 94.7    6e-20   
ref|XP_002482531.1|  aspartate transaminase, putative                 95.1    6e-20   
emb|CDY31847.1|  BnaC09g13020D                                        94.4    6e-20   
ref|XP_001826273.1|  aspartate aminotransferase, cytoplasmic          94.7    7e-20   
ref|XP_640082.1|  aspartate aminotransferase                          94.7    7e-20   
gb|KFG54125.1|  aspartate aminotransferase                            94.0    7e-20   
emb|CEP17012.1|  hypothetical protein                                 94.4    7e-20   
gb|KFG46516.1|  aspartate aminotransferase                            95.9    7e-20   
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                 94.4    8e-20   
gb|EDP54494.1|  aspartate transaminase, putative                      95.1    8e-20   
gb|KFX51903.1|  Aspartate aminotransferase, cytoplasmic               94.7    8e-20   
ref|XP_002148269.1|  aspartate transaminase, putative                 94.7    8e-20   
ref|XP_009113043.1|  PREDICTED: aspartate aminotransferase, cytop...  94.0    8e-20   
emb|CCX31965.1|  Similar to Aspartate aminotransferase, cytoplasm...  94.7    8e-20   
ref|XP_001397865.2|  aspartate aminotransferase, cytoplasmic          94.7    8e-20   
gb|EPR63537.1|  aspartate aminotransferase                            95.9    9e-20   
ref|XP_007321884.1|  hypothetical protein SERLADRAFT_475342           94.0    9e-20   
ref|XP_009269315.1|  Aspartate aminotransferase, cytoplasmic          94.4    9e-20   
gb|KDN41452.1|  hypothetical protein RSAG8_07402                      90.9    9e-20   
ref|XP_008220045.1|  PREDICTED: aspartate aminotransferase, cytop...  94.0    9e-20   
ref|XP_003886076.1|  Contig An16c0190, complete genome. (Precurso...  94.0    9e-20   
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1           94.0    1e-19   
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779            94.0    1e-19   
ref|XP_007223291.1|  hypothetical protein PRUPE_ppa005576mg           94.4    1e-19   
gb|KDN44729.1|  putative aspartate aminotransferase, cytoplasmic      94.0    1e-19   
ref|XP_002764660.1|  aspartate aminotransferase, cytoplasmic, put...  93.6    1e-19   
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115           94.0    1e-19   
ref|XP_006458215.1|  hypothetical protein AGABI2DRAFT_190572          94.0    1e-19   
ref|XP_009542586.1|  hypothetical protein HETIRDRAFT_414741           93.6    1e-19   
gb|AIT70252.1|  aspartate aminotransferase                            94.4    1e-19   
ref|XP_002791767.1|  aspartate aminotransferase                       94.4    1e-19   
gb|KFG64384.1|  aspartate aminotransferase                            93.6    1e-19   
ref|XP_003169961.1|  aspartate aminotransferase                       94.0    1e-19   
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475           93.6    1e-19   
gb|KIY68604.1|  aspartate amino-transferase                           93.6    1e-19   
ref|XP_007326695.1|  hypothetical protein AGABI1DRAFT_111350          93.6    1e-19   
gb|EQL28128.1|  aspartate aminotransferase                            93.6    2e-19   
ref|XP_002622447.1|  aspartate aminotransferase                       93.6    2e-19   
ref|XP_006302336.1|  hypothetical protein CARUB_v10020394mg           93.2    2e-19   
gb|KFG48451.1|  aspartate aminotransferase                            95.1    2e-19   
gb|EEQ92028.1|  aspartate aminotransferase                            93.6    2e-19   
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517               93.6    2e-19   
gb|KFH15985.1|  aspartate aminotransferase                            92.8    2e-19   
gb|AIT70268.1|  aspartate aminotransferase                            93.6    2e-19   
ref|XP_008347631.1|  PREDICTED: aspartate aminotransferase, cytop...  93.2    2e-19   
gb|AIT70269.1|  aspartate aminotransferase                            93.6    2e-19   
ref|XP_008883875.1|  aspartate aminotransferase                       93.2    2e-19   
ref|XP_004339901.1|  aspartate aminotransferase, putative             93.6    2e-19   
dbj|GAA85105.1|  aspartate transaminase                               93.2    2e-19   
ref|XP_003328962.1|  aspartate aminotransferase                       93.2    2e-19   
gb|KIJ68976.1|  hypothetical protein HYDPIDRAFT_172482                93.2    2e-19   
ref|XP_002367206.1|  aspartate aminotransferase, putative             94.4    2e-19   
ref|XP_001833338.2|  aspartate aminotransferase                       93.2    2e-19   
gb|AAR00232.1|  aspartate transaminase                                89.0    2e-19   
ref|XP_002780423.1|  aspartate aminotransferase, putative             92.8    2e-19   
ref|XP_002780422.1|  aspartate aminotransferase, putative             92.8    2e-19   
ref|XP_001275272.1|  aspartate transaminase, putative                 93.2    2e-19   
ref|XP_002565847.1|  Pc22g19440                                       93.2    2e-19   
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                 92.8    2e-19   
gb|EPE10724.1|  aspartate aminotransferase                            92.8    2e-19   
ref|XP_007722546.1|  aspartate aminotransferase                       93.6    3e-19   
gb|EPT25025.1|  aspartate aminotransferase                            94.4    3e-19   
ref|XP_009159475.1|  aspartate aminotransferase                       92.8    3e-19   
gb|EGE09449.1|  aspartate transaminase                                91.7    3e-19   
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...  93.2    3e-19   
gb|KIP08181.1|  hypothetical protein PHLGIDRAFT_29717                 92.8    3e-19   
ref|XP_007301170.1|  aspartate aminotransferase                       92.8    3e-19   
gb|EZF36094.1|  hypothetical protein H101_00376                       92.0    3e-19   
ref|XP_008729478.1|  hypothetical protein G647_06938                  92.8    3e-19   
gb|KDB13308.1|  aspartate aminotransferase                            92.8    4e-19   
emb|CDY46924.1|  BnaA09g12700D                                        92.4    4e-19   
emb|CDS05732.1|  Putative Aspartate aminotransferase                  92.4    4e-19   
ref|XP_006391820.1|  hypothetical protein EUTSA_v10023500mg           92.0    4e-19   
emb|CDJ46758.1|  aspartate aminotransferase, putative                 90.5    4e-19   
ref|XP_007757790.1|  aspartate aminotransferase                       92.4    4e-19   
gb|ADP03197.1|  aspartate transaminase                                91.3    5e-19   
gb|KEP52891.1|  aspartate aminotransferase                            92.4    5e-19   
ref|XP_011110484.1|  hypothetical protein H072_4587                   92.4    5e-19   
gb|ADP03191.1|  aspartate transaminase                                91.3    5e-19   
gb|ADP03185.1|  aspartate transaminase                                91.3    5e-19   
gb|EJT99836.1|  aspartate aminotransferase                            92.0    5e-19   
gb|ADP03202.1|  aspartate transaminase                                91.3    5e-19   
ref|XP_007361273.1|  aspartate aminotransferase                       92.0    5e-19   
gb|EGD95227.1|  aspartate aminotransferase                            92.0    6e-19   
ref|XP_006959708.1|  PLP-dependent transferase                        92.0    6e-19   
ref|XP_007863462.1|  aspartate amino-transferase                      91.7    6e-19   
ref|XP_007852807.1|  aspartate aminotransferase                       92.0    7e-19   
gb|EYE95621.1|  putative aspartate transaminase                       91.7    7e-19   
gb|KGO77057.1|  Pyridoxal phosphate-dependent transferase, major ...  91.7    7e-19   
ref|XP_003016845.1|  hypothetical protein ARB_05138                   92.0    7e-19   
ref|XP_003018134.1|  hypothetical protein TRV_07830                   92.0    7e-19   
gb|KGB35954.1|  Aspartate aminotransferase, mitochondrial             91.7    7e-19   
gb|EZF36093.1|  hypothetical protein H101_00376                       92.0    7e-19   
ref|XP_001213580.1|  aspartate aminotransferase                       92.0    8e-19   
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15             91.7    8e-19   
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                  91.7    8e-19   
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1           91.7    8e-19   
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521            91.3    8e-19   
gb|EEH20659.1|  hypothetical protein PABG_02890                       92.0    8e-19   
ref|XP_010757441.1|  hypothetical protein PADG_01404                  92.0    8e-19   
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                  91.7    9e-19   
gb|EKV09426.1|  Aspartate transaminase, putative                      91.7    9e-19   
gb|EZF72427.1|  hypothetical protein H105_05473                       91.7    9e-19   
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                91.7    9e-19   
gb|ELU44777.1|  aspartate amino-transferase                           92.4    9e-19   
ref|XP_003236138.1|  aspartate aminotransferase                       91.7    9e-19   
emb|CDH49583.1|  aspartate aminotransferase                           91.3    9e-19   
gb|EUC63953.1|  aspartate aminotransferase                            92.0    9e-19   
gb|KIK23391.1|  hypothetical protein PISMIDRAFT_649018                91.7    9e-19   
ref|XP_009045194.1|  hypothetical protein LOTGIDRAFT_207558           91.3    9e-19   
gb|KDR10996.1|  Aspartate aminotransferase, mitochondrial             91.7    9e-19   
dbj|GAA55746.1|  aspartate aminotransferase cytoplasmic               88.6    9e-19   
emb|CBQ68983.1|  probable aspartate aminotransferase, cytoplasmic     91.3    1e-18   
ref|XP_646849.1|  aspartate aminotransferase                          91.3    1e-18   
gb|KFH62511.1|  aspartate aminotransferase                            91.7    1e-18   
emb|CDM27766.1|  Aspartate aminotransferase, cytoplasmic              91.7    1e-18   
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                 91.3    1e-18   
ref|XP_008464259.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.3    1e-18   
gb|KIY50962.1|  PLP-dependent transferase                             91.3    1e-18   
emb|CCF48663.1|  probable aspartate aminotransferase, cytoplasmic     91.3    1e-18   
ref|XP_008464260.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.3    1e-18   
ref|XP_007395810.1|  hypothetical protein PHACADRAFT_256136           91.3    1e-18   
ref|XP_007735384.1|  aspartate aminotransferase                       91.3    1e-18   
ref|XP_009163630.1|  hypothetical protein T265_01360                  90.9    1e-18   
ref|XP_001903448.1|  hypothetical protein                             91.3    1e-18   
ref|XP_663652.1|  hypothetical protein AN6048.2                       91.3    1e-18   
gb|KDQ60719.1|  hypothetical protein JAAARDRAFT_31694                 90.9    1e-18   
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                 90.9    2e-18   
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                 90.9    2e-18   
ref|XP_003390732.1|  PREDICTED: aspartate aminotransferase, cytop...  90.1    2e-18   
ref|XP_001260457.1|  aspartate transaminase, putative                 91.3    2e-18   
ref|XP_002542670.1|  aspartate aminotransferase                       91.3    2e-18   
gb|KIW23628.1|  hypothetical protein PV07_11814                       90.9    2e-18   
gb|KIO06515.1|  hypothetical protein M404DRAFT_946120                 90.5    2e-18   
gb|KGO38545.1|  Aspartate/other aminotransferase                      90.5    2e-18   
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                90.9    2e-18   
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952               90.9    2e-18   
gb|KIM28774.1|  hypothetical protein M408DRAFT_16169                  90.9    2e-18   
gb|KDR81509.1|  hypothetical protein GALMADRAFT_221371                90.5    2e-18   
ref|XP_506013.1|  YALI0F29337p                                        90.5    2e-18   
gb|EAS29116.3|  aspartate aminotransferase                            91.3    2e-18   
gb|EWC46846.1|  hypothetical protein DRE_03858                        90.5    2e-18   
gb|EPY49344.1|  aspartate aminotransferase                            90.5    2e-18   
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644           90.5    2e-18   
gb|ADP03187.1|  aspartate transaminase                                89.7    2e-18   
ref|XP_001828762.2|  aspartate Aminotransferase                       90.5    2e-18   
gb|EFW16035.1|  aspartate aminotransferase                            90.9    2e-18   
ref|XP_003067849.1|  aminotransferase, classes I and II family pr...  90.9    2e-18   
ref|XP_011401594.1|  Aspartate aminotransferase 1                     90.1    2e-18   
ref|XP_003036007.1|  hypothetical protein SCHCODRAFT_65913            90.1    2e-18   
gb|KFH67254.1|  aspartate aminotransferase                            90.5    2e-18   
emb|CBK20182.2|  unnamed protein product                              90.5    2e-18   
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                 90.5    2e-18   
gb|KDN51728.1|  hypothetical protein RSAG8_00276                      90.5    2e-18   
ref|XP_001541653.1|  hypothetical protein HCAG_03751                  90.5    3e-18   
ref|XP_007359882.1|  PLP-dependent transferase                        90.1    3e-18   
gb|EMF13847.1|  PLP-dependent transferase                             90.5    3e-18   
ref|NP_998544.1|  aspartate aminotransferase 2a                       90.1    3e-18   
gb|KIM55879.1|  hypothetical protein SCLCIDRAFT_133726                90.1    3e-18   
ref|XP_008378103.1|  PREDICTED: aspartate aminotransferase, cytop...  91.3    3e-18   
ref|XP_007764657.1|  aspartate aminotransferase                       90.1    3e-18   
ref|XP_007805006.1|  hypothetical protein EPUS_08830                  90.5    3e-18   
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                 89.7    3e-18   
gb|KIK59788.1|  hypothetical protein GYMLUDRAFT_658122                90.1    3e-18   
ref|XP_002516565.1|  aspartate aminotransferase, putative             89.7    3e-18   
gb|KIJ16826.1|  aspartate transaminase                                89.7    3e-18   
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371               90.1    3e-18   
ref|XP_009492182.1|  hypothetical protein, variant                    89.7    3e-18   
emb|CDH56017.1|  aspartate aminotransferase                           90.1    3e-18   
gb|KDQ33200.1|  hypothetical protein PLEOSDRAFT_1052049               89.7    3e-18   
emb|CEG05709.1|  unnamed protein product                              89.7    3e-18   
gb|KDQ55152.1|  hypothetical protein JAAARDRAFT_134176                89.7    3e-18   
ref|XP_004337429.1|  mitochondrial aspartate aminotransferase         89.7    4e-18   
emb|CDS04038.1|  hypothetical protein LRAMOSA06993                    89.7    4e-18   
emb|CDI55059.1|  probable aspartate aminotransferase, cytoplasmic     89.7    4e-18   
ref|XP_009492181.1|  hypothetical protein H696_00076                  89.7    4e-18   
ref|XP_006401959.1|  hypothetical protein EUTSA_v10015824mg           89.0    4e-18   
gb|KIW48791.1|  hypothetical protein, variant                         89.7    4e-18   
gb|KIY72818.1|  hypothetical protein CYLTODRAFT_417594                89.7    4e-18   
ref|XP_001240699.1|  conserved hypothetical protein                   89.7    4e-18   
ref|XP_006454385.1|  glutamic oxaloacetic transaminase AAT1           89.7    4e-18   
gb|KII88605.1|  hypothetical protein PLICRDRAFT_41791                 89.4    4e-18   



>dbj|BAD02268.1| aspartate aminotransferase [Nicotiana tabacum]
Length=227

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWKQEMEMMAGR+KSVRQ LYDSLS KDKSGKDW +ILKQIGMFSFTGLNKAQSENM+
Sbjct  130  FDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWPYILKQIGMFSFTGLNKAQSENMT  189

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  190  NKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  227



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/98 (92%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWKQEMEMMAGR+KSVRQ LYDSLS KDKSGKDW++ILKQIGMFSFTGLNKAQSENM+
Sbjct  365  FDEWKQEMEMMAGRIKSVRQKLYDSLSTKDKSGKDWSYILKQIGMFSFTGLNKAQSENMT  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  425  NKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK+EMEMMAGR+KSVRQ LYDSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM+
Sbjct  372  FSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMA  431

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  432  DKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  469



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK+EMEMMAGR+KSVRQ LYDSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM+
Sbjct  365  FSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMA  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  425  DKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK+EMEMMAGR+KSVRQ LYDSLS KDKSGK+W+FILKQIGMFSFTGL++AQSENM+
Sbjct  365  FSEWKEEMEMMAGRIKSVRQKLYDSLSAKDKSGKNWSFILKQIGMFSFTGLDRAQSENMA  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  425  NKWHVYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  462



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EMEMMAGR+KSVRQ LYD+L  KDKSGKDW++ILKQIGMFSFTGLNKAQS+NM+
Sbjct  362  FNEWKEEMEMMAGRIKSVRQKLYDNLISKDKSGKDWSYILKQIGMFSFTGLNKAQSDNMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS
Sbjct  422  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  459



>dbj|BAD94538.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=187

 Score =   183 bits (464),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  90   FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  149

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  150  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  187



>gb|AFK46621.1| unknown [Lotus japonicus]
Length=241

 Score =   184 bits (467),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FIL+QIGMFSFTGLNK QS+NM+
Sbjct  144  FNEWKAEMEMMAGRIKNVRQKLYDSISSKDKSGKDWSFILEQIGMFSFTGLNKNQSDNMT  203

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  204  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  241



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   190 bits (483),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW++EME+MAGR+K+VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQSENM+
Sbjct  373  FNEWREEMELMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSENMT  432

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  433  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  470



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  369  FNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  428

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  429  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  369  FNEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  428

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  429  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EMEM+AGR+K+VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGLNK QSENM+
Sbjct  369  FNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLNKTQSENMT  428

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  429  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>ref|XP_010042868.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Eucalyptus grandis]
Length=120

 Score =   179 bits (453),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+WK EMEMMAGR+K+VRQ L DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  23   FNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMT  82

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  83   NKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  120



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   190 bits (483),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EME+MAGR+KSVRQ LYDSL  KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+
Sbjct  452  FNEWKEEMEVMAGRIKSVRQKLYDSLRAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMT  511

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS+AKCEYLADAI DSY+NVS
Sbjct  512  NKWHVYMTKDGRISLAGLSSAKCEYLADAIFDSYHNVS  549



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+WK+EME+MAGR+KSVR+ LYDSLS KD SGKDW+F+LKQIGMFSFTGLN AQSENM+
Sbjct  354  FNDWKEEMELMAGRIKSVRKKLYDSLSAKDNSGKDWSFVLKQIGMFSFTGLNDAQSENMT  413

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS+AKCEYLADAIIDSYYN+S
Sbjct  414  NKWHVYMTKDGRISLAGLSSAKCEYLADAIIDSYYNIS  451



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+
Sbjct  358  FDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMT  417

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  418  NKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  455



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+
Sbjct  313  FDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  373  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  410



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EMEM+AGR+K+VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGL K QSENM+
Sbjct  369  FNEWKEEMEMLAGRIKNVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLTKTQSENMT  428

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  429  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+
Sbjct  368  FDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMT  427

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  428  NKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>prf||1908424A Asp aminotransferase
Length=465

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+
Sbjct  368  FDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMT  427

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  428  NKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  360  FNEWKAEMEMMAGRIKNVRQKLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMT  419

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  420  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  457



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K VRQ LYDSLS KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+
Sbjct  367  FNEWKDEMEMMAGRIKGVRQKLYDSLSAKDKSGKDWSFILKQIGMFSYTGLNKTQSDNMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  464



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+
Sbjct  362  FDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  422  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  459



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K VRQ L+DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  369  FNEWKAEMEMMAGRIKGVRQKLFDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMT  428

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  429  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  466



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+FIL+QIGMFSFTGLNKAQS+NM+
Sbjct  370  FDEWKAEMEMMAGRIKNVRQKLFDSLSAKDKSGKDWSFILRQIGMFSFTGLNKAQSDNMT  429

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  430  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  467



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  NKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  NKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYD+L+ KDKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+
Sbjct  367  FSEWKAEMEMMAGRIKNVRQKLYDNLTAKDKSGKDWSFILKQIGMFSFTGLNKAQTENMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  398  FGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  457

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  458  NKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  495



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYD+L+ KDKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+
Sbjct  367  FGEWKAEMEMMAGRIKNVRQKLYDNLTAKDKSGKDWSFILKQIGMFSFTGLNKAQTENMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  NKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  370  FDEWKAEMEMMAGRIKNVRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMT  429

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  430  NKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  467



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   186 bits (471),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K VRQ LYD+L+  DKSGKDW+FILKQIGMFSFTGLNKAQ+ENM+
Sbjct  367  FNEWKAEMEMMAGRIKGVRQKLYDNLTATDKSGKDWSFILKQIGMFSFTGLNKAQTENMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYL+DAIIDSY+NVS
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLSDAIIDSYHNVS  464



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  416  DKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSHHNVS  453



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FSEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EME+M+GR+K VRQ LYD+LS KDK+GKDW+F+L+QIGMFSFTGLNKAQSENMS
Sbjct  367  FDEWKSEMELMSGRIKGVRQRLYDNLSAKDKTGKDWSFVLRQIGMFSFTGLNKAQSENMS  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS +KCEYLADAI+DSYYNVS
Sbjct  427  NKWHIYMTKDGRISLAGLSLSKCEYLADAIVDSYYNVS  464



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EME+M+GR+K VRQ LYD+LS KDK+GKDW+F+L+QIGMFSFTGLNKAQSENMS
Sbjct  356  FDEWKSEMELMSGRIKGVRQRLYDNLSAKDKTGKDWSFVLRQIGMFSFTGLNKAQSENMS  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWHIYMTKDGRISLAGLS +KCEYLADAI+DSYYNVS
Sbjct  416  NKWHIYMTKDGRISLAGLSLSKCEYLADAIVDSYYNVS  453



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  DKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  453



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  351  FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  410

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  411  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  448



>ref|XP_007161154.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
 gb|ESW33148.1| hypothetical protein PHAVU_001G0470000g, partial [Phaseolus vulgaris]
Length=261

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW+ EMEMMAGR+K+VRQ LY+S++ KD SGKDW+FILKQIGMFSFTGLNK Q++NM+
Sbjct  164  FNEWRAEMEMMAGRIKNVRQQLYNSITSKDNSGKDWSFILKQIGMFSFTGLNKEQTDNMT  223

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  224  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  261



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWKQEME+MAGR+K+VRQ L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQSE+M+
Sbjct  357  FNEWKQEMELMAGRIKNVRQRLFDYLSRKDKSGKDWSFILKQIGMFSFTGLNKAQSEHMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS +KCEYLADAIIDS++NVS
Sbjct  417  NKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSFHNVS  454



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   184 bits (467),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSGKDW+FILKQIGMFSFTGLN  QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNTNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWKQEME+MAGR+K+VRQ L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQSE+M+
Sbjct  341  FNEWKQEMELMAGRIKNVRQRLFDYLSRKDKSGKDWSFILKQIGMFSFTGLNKAQSEHMT  400

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS +KCEYLADAIIDS++NVS
Sbjct  401  NKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSFHNVS  438



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRIS AGLS AKCEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISSAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  365  FNEWKAEMEMMAGRIKNVRQKLYDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMT  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGL+ AKCE LADAI+DSY+NVS
Sbjct  425  NKWHVYMTKDGRISLAGLNLAKCEDLADAIVDSYHNVS  462



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  416  DKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  451



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  416  DKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  451



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   182 bits (462),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FGEWKAEMEMMAGRIKTVRQKLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  416  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHN  451



>prf||2009357A Asp aminotransferase
Length=463

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 1/99 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSEN-M  286
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+N M
Sbjct  365  FDEWKAEMEMMAGRIKTVRQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMM  424

Query  285  SNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +NKWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  425  TNKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKA-QSENM  286
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKA QS+NM
Sbjct  356  FGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQQSDNM  415

Query  285  SNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  TNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHNVS  454



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   183 bits (464),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  407  FNEWKAEMEMMAGRIKTVRQQLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  466

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  467  DKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  502



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   182 bits (461),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSGKDW+FILKQIGMFSFT LNK QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGKDWSFILKQIGMFSFTSLNKNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NV
Sbjct  426  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNV  462



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EME+M+GR+K VRQ LY +LS KDKSGKDW+F+L+QIGMFSFTGLNKAQSENMS
Sbjct  313  FDEWKSEMELMSGRIKGVRQRLYANLSAKDKSGKDWSFVLRQIGMFSFTGLNKAQSENMS  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS +KCEYLADAIIDSYYNVS
Sbjct  373  SKWHIYMTKDGRISLAGLSLSKCEYLADAIIDSYYNVS  410



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EME+MAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLN+AQS+ M+
Sbjct  385  FNEWKAEMELMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLNEAQSDKMT  444

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  445  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  482



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK  MEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  368  FEEWKAFMEMMAGRIKNVRQLLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMT  427

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  428  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  465



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW+ EMEMMAGR+K+VRQ LY+S++ KD SGKDW+FILKQIGMFSFTGLNK Q++NM+
Sbjct  364  FNEWRAEMEMMAGRIKNVRQQLYNSITSKDNSGKDWSFILKQIGMFSFTGLNKEQTDNMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  424  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  461



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME+MAGR+K+VRQ LYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM+
Sbjct  362  FGEWKQEMELMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  422  DKWHIYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  459



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+WK EMEMMAGR+K+VRQ L DSLS KDKSGKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  364  FNDWKAEMEMMAGRIKNVRQKLNDSLSAKDKSGKDWSFILKQIGMFSFTGLSKTQSENMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGL+ AKCEYLADAI+DSY+NVS
Sbjct  424  NKWHVYMTKDGRISLAGLNLAKCEYLADAIVDSYHNVS  461



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME+MAGR+K+VRQ LYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM+
Sbjct  362  FGEWKQEMELMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  422  DKWHIYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  459



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+
Sbjct  356  FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+Y TKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  416  DKWHVYXTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  453



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM+
Sbjct  360  FGEWKQEMEQMAGRIKNVRQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMT  419

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKC+YLADAIIDS++NVS
Sbjct  420  DKWHVYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVS  457



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM+
Sbjct  313  FNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  373  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  409



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  356  FSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  416  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHN  451



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS+KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM+
Sbjct  361  FGEWKQEMEQMAGRIKNVRQKLYDSLSVKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMT  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWH+YMTKDGRISLAGLS AKC+YLADAIIDS++NV+
Sbjct  421  DKWHVYMTKDGRISLAGLSLAKCDYLADAIIDSFHNVN  458



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EME+MAGR+K+VRQ L+DSLS KDK GKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  365  FNEWKEEMELMAGRIKNVRQKLFDSLSAKDKCGKDWSFILKQIGMFSFTGLSKVQSENMT  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  425  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHCVS  462



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK+EME+MAGR+K+VRQ L+DSLS KDK GKDW+FILKQIGMFSFTGL+K QSENM+
Sbjct  365  FNEWKEEMELMAGRIKNVRQKLFDSLSAKDKCGKDWSFILKQIGMFSFTGLSKVQSENMT  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  425  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHCVS  462



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  363  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  423  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  460



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  363  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  423  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  460



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM+
Sbjct  367  FNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  427  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  463



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGL+K QS+NM+
Sbjct  368  FNEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLSKVQSDNMT  427

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGLS AKCEYLADAIIDS++NV
Sbjct  428  DKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNV  464



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM+
Sbjct  317  FGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMT  376

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  377  DKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  414



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM+
Sbjct  325  FGEWKQEMEEMAGRIKNVRQKLYDSLSAKDNSGKDWSFILRQIGMFSYTGLNKTQSDNMT  384

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  385  DKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  422



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VRQ L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  367  FKEWNVEMEMMAGRIKNVRQKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NV
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNV  463



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK+EM  MAGR+KSVR+ LYDSL  KD SGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  366  FSEWKEEMASMAGRIKSVRKKLYDSLCAKDNSGKDWSFILKQIGMFSFTGLNKAQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS+A CEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISLAGLSSANCEYLADAIIDSYHNVS  463



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK+EM  MAGR+KSVR+ LYDSL  KD SGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  365  FSEWKEEMASMAGRIKSVRKKLYDSLCAKDNSGKDWSFILKQIGMFSFTGLNKAQSDNMT  424

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS+A CEYLADAIIDSY+NVS
Sbjct  425  NKWHVYMTKDGRISLAGLSSANCEYLADAIIDSYHNVS  462



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW+ EM+MMAGR+K+VRQ LYD LS KDKSGKDW+F+LKQIGMFSFTGLNKAQS+NM+
Sbjct  364  FDEWRAEMQMMAGRIKTVRQRLYDELSTKDKSGKDWSFVLKQIGMFSFTGLNKAQSDNMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGL+ AKC YLADAIIDSYYN+
Sbjct  424  DKWHVYMTKDGRISLAGLNLAKCAYLADAIIDSYYNI  460



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM+
Sbjct  361  FGEWKQEMEEMAGRIKNVRQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMT  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGLS AKCEYLADAIIDS++NVS
Sbjct  421  DKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS  458



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EME MAGR+KSVR+ L+++LS KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM+
Sbjct  372  FSEWKSEMEFMAGRIKSVRKRLFENLSQKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMT  431

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS +KCEYLADAIIDSY+NV+
Sbjct  432  NKWHVYMTKDGRISLAGLSLSKCEYLADAIIDSYHNVN  469



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYDS+S KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+
Sbjct  357  FDEWKVEMEMMAGRIKNVRQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDS++ VS
Sbjct  417  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHYVS  454



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWKQEME+MAGR+K+VRQ L+D LS KDKSGKDW+FILKQIGMFSFTGLNKAQS++M+
Sbjct  357  FNEWKQEMELMAGRIKNVRQRLFDYLSQKDKSGKDWSFILKQIGMFSFTGLNKAQSDHMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKW +YMTKDGRISLAGLS +KCEYLADAI+DS++NVS
Sbjct  417  NKWRVYMTKDGRISLAGLSLSKCEYLADAIMDSFHNVS  454



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKA-QSENM  286
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKA QS+NM
Sbjct  356  FGEWKAEMEMMAGRIKTVRQRLYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQQSDNM  415

Query  285  SNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            +NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N
Sbjct  416  TNKWHVYMTKDGRISLAGLSMAKCEYLADAIIDSYHN  452



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  299  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  358

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  359  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  396



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   177 bits (450),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 81/98 (83%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EWK EMEMMAGR+K+VRQ LYD +S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+
Sbjct  368  FDEWKAEMEMMAGRIKNVRQLLYDPISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMT  427

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+ MTKDGRIS AGLS AKCEYLADAIIDSY+NVS
Sbjct  428  NKWHVLMTKDGRISPAGLSLAKCEYLADAIIDSYHNVS  465



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K+VRQ LYDSL  KDKSGKDW+FILKQIGMFSFTGLN  Q+ENM+
Sbjct  356  FGEWKAEMEMMAGRIKNVRQKLYDSLCAKDKSGKDWSFILKQIGMFSFTGLNTTQTENMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
             KWH++MTKDGRISLAGL+ AKCEYL+DAIIDSY+NVS
Sbjct  416  KKWHVFMTKDGRISLAGLNLAKCEYLSDAIIDSYHNVS  453



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  367  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  427  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  464



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  371  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  430

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  431  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  468



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWKQEME+MAGR+K+VRQ LY++LS KDKSGKDW+F+LKQIGMFS+TGL+KAQS++M+
Sbjct  328  FNEWKQEMELMAGRIKNVRQRLYENLSQKDKSGKDWSFVLKQIGMFSYTGLHKAQSDHMT  387

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWHIYMTKDGRISLAGLS +KCEYLADAIIDS++NV
Sbjct  388  DKWHIYMTKDGRISLAGLSLSKCEYLADAIIDSFHNV  424



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS +DKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  367  FKEWNAEMEMMAGRIKNVRDKLFDSLSSEDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
             KWHIYMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  427  TKWHIYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  464



>dbj|BAJ97030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=345

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  248  FGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMT  307

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  308  DKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  345



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EMEMMAGR+K+VR  L+DSLS KDKSGKDW+F+LKQIGMFSFTGLNKAQ +NM+
Sbjct  399  FKEWNAEMEMMAGRIKNVRHKLFDSLSSKDKSGKDWSFVLKQIGMFSFTGLNKAQCDNMT  458

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+N S
Sbjct  459  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNGS  496



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   176 bits (445),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  371  FGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMT  430

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  431  DKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  468



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  360  FGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMT  419

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  420  DKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  457



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWKQEME MAGR+K+VRQ LYDSLS KD+SGKDW+FIL QIGMFS+TGLN+ QS+NM+
Sbjct  358  FGEWKQEMEQMAGRIKNVRQKLYDSLSAKDQSGKDWSFILSQIGMFSYTGLNRNQSDNMT  417

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  418  DKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  455



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  386  FGEWKEEMEQMAGRIKNVRQKLYDSLTEKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMT  445

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLADAIIDS++NV+
Sbjct  446  DKWHIYMTKDGRISLAGLNLAKCEYLADAIIDSFHNVN  483



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  360  FGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRTQSDNMT  419

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            +KWHIYMTKDGRISLAGL+ AKCEYLA+AIIDS++NV+
Sbjct  420  DKWHIYMTKDGRISLAGLNLAKCEYLAEAIIDSFHNVN  457



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW+ EM+MMAGR+K VRQ LY++L  KDKSGKDW+FILKQIGMFSFTGL K+QS+NM+
Sbjct  313  FDEWRAEMQMMAGRIKGVRQKLYEALLSKDKSGKDWSFILKQIGMFSFTGLTKSQSDNMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGL+ AKC+YLADAIIDSYYNV
Sbjct  373  DKWHVYMTKDGRISLAGLNLAKCDYLADAIIDSYYNV  409



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW+ EM+MMAGR+K VRQ LY++L  KDKSGKDW+FILKQIGMFSFTGL K+QS+NM+
Sbjct  313  FDEWRAEMQMMAGRIKGVRQKLYEALLSKDKSGKDWSFILKQIGMFSFTGLTKSQSDNMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            +KWH+YMTKDGRISLAGL+ AKC+YLADAIIDSYYNV
Sbjct  373  DKWHVYMTKDGRISLAGLNLAKCDYLADAIIDSYYNV  409



>gb|EPS71467.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=133

 Score =   160 bits (406),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EME+MAGR+KSVR+ LY+ LS  D +GKDW+FIL+QIGMFSFTGLNK QSE M+
Sbjct  38   FKEWKDEMEVMAGRIKSVRKLLYEELSRSDGTGKDWSFILRQIGMFSFTGLNKEQSEKMT  97

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
             KWH+YMTKDGRISLAGLS+AKC YLA AI+DSY+N
Sbjct  98   GKWHVYMTKDGRISLAGLSSAKCSYLAGAIVDSYHN  133



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK+EME MAGR+K+VRQ LYDSL+ KD+SGKDW+FIL QIGMFSFTGLN+ QS+NM+
Sbjct  278  FGEWKEEMEQMAGRIKNVRQKLYDSLTAKDQSGKDWSFILSQIGMFSFTGLNRPQSDNMT  337

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAII  190
            +KWHIYMTKDGRISLAGL+ AKCEYLADAII
Sbjct  338  DKWHIYMTKDGRISLAGLNLAKCEYLADAII  368



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWKQE+E+++ R+KS+RQ L++SLS KD+SG+DW+FI+K+ G+FSF GLNKAQ +NM 
Sbjct  356  FNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQIDNMR  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YM KDGR+SL GLS ++CEYLADAIIDS++NVS
Sbjct  416  NKWHVYMIKDGRMSLGGLSLSQCEYLADAIIDSFHNVS  453



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW++E+ +MAGR+KSVR+ LYD LS KD SGKDW+F +K IGM+S++GLN+AQ ENM 
Sbjct  309  FSEWEEELRLMAGRIKSVRKKLYDCLSAKDMSGKDWSFFVKHIGMYSYSGLNEAQRENMR  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            NKWH+YMTKDGR++L G+S AKCEYLADA IDSY+ V
Sbjct  369  NKWHVYMTKDGRMALTGVSQAKCEYLADAFIDSYHYV  405



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   147 bits (371),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 69/98 (70%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEWK EMEMMAGR+K+VRQ LYDS++ KDKSG+  +       +    GLNK QS+NM+
Sbjct  366  FNEWKAEMEMMAGRIKNVRQQLYDSITSKDKSGQSASQYPDNCVLPFIPGLNKNQSDNMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNVS  169
            NKWH+YMTKDGRISLAGLS AKCEYLADAIIDSY+NVS
Sbjct  426  NKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSYHNVS  463



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EMEMMAGR+K VRQ LYD+L ++    KDW+F+LKQIGMF+FTG+   Q +NM+
Sbjct  346  FGEWKGEMEMMAGRIKGVRQDLYDAL-VEINPDKDWSFVLKQIGMFTFTGMTPQQCDNMT  404

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NKWH+YMTKDGR+SLAGLS+AK  YLA AI DS  N
Sbjct  405  NKWHVYMTKDGRLSLAGLSSAKAAYLARAIDDSVRN  440



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   139 bits (350),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 39/137 (28%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKA------  301
            FNEWKQE+E+++ R+KS+RQ L++SLS KD+SG+DW+FI+K+ G+FSF GLNKA      
Sbjct  356  FNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQISNPH  415

Query  300  ---------------------------------QSENMSNKWHIYMTKDGRISLAGLSAA  220
                                             Q +NM NKWH+YM KDGR+SL GLS +
Sbjct  416  GSAYQIAHALAVSVFLILHAFWYVLHCVFVRLSQIDNMRNKWHVYMIKDGRMSLGGLSLS  475

Query  219  KCEYLADAIIDSYYNVS  169
            +CEYLADAIIDS++NVS
Sbjct  476  QCEYLADAIIDSFHNVS  492



>ref|XP_008784800.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=386

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 88/137 (64%), Gaps = 39/137 (28%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKA------  301
            FNEWKQE+E+++ R+KS+RQ L++SLS KD+SG+DW+FI+K+ G+FSF GLNKA      
Sbjct  250  FNEWKQEVELISRRLKSLRQRLFESLSCKDRSGRDWSFIVKENGIFSFIGLNKAQISNPH  309

Query  300  ---------------------------------QSENMSNKWHIYMTKDGRISLAGLSAA  220
                                             Q +NM NKWH+YM KDGR+SL GLS +
Sbjct  310  GSAYQIAHALAVSVFLILHAFWYVLHCVFVRLSQIDNMRNKWHVYMIKDGRMSLGGLSLS  369

Query  219  KCEYLADAIIDSYYNVS  169
            +CEYLADAIIDS++NVS
Sbjct  370  QCEYLADAIIDSFHNVS  386



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW +EME M+GR+K VRQ L+D L+ K    KDW+FIL+Q+GMFSFTGLN AQ +NM+
Sbjct  358  FQEWNEEMEYMSGRIKDVRQVLHDELA-KLNGDKDWSFILRQLGMFSFTGLNPAQVDNMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NK HIYMTKDGRISLAGL ++K  YLA AI DS+ N
Sbjct  417  NKHHIYMTKDGRISLAGLPSSKAAYLAAAIDDSFRN  452



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 73/96 (76%), Gaps = 5/96 (5%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  EME MAGR+K+VRQ LYD L+    S KDW+FI    GMFSFTGL+  Q ENM+
Sbjct  295  FGEWNVEMEEMAGRIKTVRQDLYDHLTRLLPS-KDWSFI----GMFSFTGLSPQQVENMT  349

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NKWH++MTKDGRISLAGL+ AK  YLA+AI+DS  N
Sbjct  350  NKWHVFMTKDGRISLAGLNRAKAGYLAEAIVDSVQN  385



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F  W +EM  MAGR+K+VR  LYD+L  K    KDW+F+ +QIGMFSFTGLN  Q ++M+
Sbjct  315  FARWNEEMGEMAGRIKTVRAMLYDNLC-KLNPDKDWSFVTRQIGMFSFTGLNPNQVKHMT  373

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSY  181
             K  IYMT DGRISLAGLS AKCEYLA+AI+DS+
Sbjct  374  EKHAIYMTGDGRISLAGLSQAKCEYLANAIVDSF  407



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EM  MAGR++ VR  L  SL  K  S KDW+FI KQIGMFSFTGL  AQ +NM+
Sbjct  333  FEEWKGEMRGMAGRIERVRGELQRSLESKYPS-KDWSFITKQIGMFSFTGLTPAQVDNMT  391

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NK  I+MT+DGRISLAGL++AK +YLA+AI+DS  N
Sbjct  392  NKHAIFMTRDGRISLAGLNSAKVDYLAEAIVDSVRN  427



>ref|XP_001695040.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP02192.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=433

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -2

Query  453  WKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKW  274
            WK+E+  MA R+K++RQ LY  L  +   G DW+F+LKQIGMFS+TGL+KAQ E ++ KW
Sbjct  338  WKEELAGMAHRIKAMRQALYGQLVARQLPG-DWSFVLKQIGMFSYTGLSKAQCEVLTRKW  396

Query  273  HIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            HI++T DGRIS+AGLSAA C YLA+AI D   N
Sbjct  397  HIHLTMDGRISMAGLSAASCPYLAEAIADVVTN  429



>gb|KIZ05915.1| aspartate aminotransferase [Monoraphidium neglectum]
Length=345

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EM  MAGR+  VR  L  +L  K  + KDW+F+ KQIGMFS+TG++  Q +NM+
Sbjct  250  FEEWKGEMAGMAGRISKVRGELRAALE-KRMADKDWSFVTKQIGMFSYTGMSPQQVDNMT  308

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NK  +YMT+DGRISLAGLS+AK +YLADAI+DS  N
Sbjct  309  NKHAVYMTRDGRISLAGLSSAKVDYLADAIVDSVRN  344



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EWK EM  MAGR++ VR  L  +L  K    KDW+FI KQIGMF+FTGL  AQ +NM+
Sbjct  343  FEEWKGEMRGMAGRIERVRGELQRALEAK-YPDKDWSFITKQIGMFTFTGLTPAQVDNMT  401

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            NK  ++MT+DGRISLAGL++AK EYLA+AI++S  N
Sbjct  402  NKHSVFMTRDGRISLAGLNSAKVEYLANAIVESVRN  437



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -2

Query  453  WKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKW  274
            WK+E+  MA R+KS+RQ LYD L  ++  G DW+F+LKQIGMFSFTG+ + Q E + +KW
Sbjct  334  WKEELRGMAERIKSMRQVLYDQLVARNVPG-DWSFVLKQIGMFSFTGMTRHQCEQLVSKW  392

Query  273  HIYMTKDGRISLAGLSAAKCEYLADAIIDSYYN  175
            H+++T DGRIS+AGLSAA   YLA+AI D   N
Sbjct  393  HVHLTLDGRISMAGLSAATAPYLAEAIADVIQN  425



>ref|XP_005843806.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
 gb|EFN51704.1| hypothetical protein CHLNCDRAFT_59799 [Chlorella variabilis]
Length=406

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + +WK E++ MA R+ ++RQ LY +L      G DW  IL+QIGMFS+TGL KAQ ENM+
Sbjct  311  YAQWKVELKGMADRILTMRQQLYQALQEVGAPG-DWGHILRQIGMFSYTGLTKAQVENMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
            NKWH+YMT DGRIS+AGLS++KC YLA A+ DS  N 
Sbjct  370  NKWHVYMTFDGRISMAGLSSSKCGYLAQAMKDSVENC  406



>ref|XP_001771002.1| predicted protein [Physcomitrella patens]
 gb|EDQ64157.1| predicted protein [Physcomitrella patens]
Length=409

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  E++ MA R+ S+RQ LYD+L  +   G DWT +LKQIGMF+FTGLNK+Q E M+
Sbjct  310  FQEWTVELKGMADRIISMRQQLYDALQARGTPG-DWTHVLKQIGMFTFTGLNKSQVEFMT  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  369  RQYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  459  NEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSN  280
            + W  EM  MAGR+K+VR+ L++ L+ +    KDW+F+ +QIGMFSFTGL+ AQ E M+ 
Sbjct  319  SRWNDEMGTMAGRIKTVRRELFEELT-RLNPDKDWSFVTRQIGMFSFTGLSPAQVERMTG  377

Query  279  KWHIYMTKDGRISLAGLSAAKCEYLADAIIDSYYNV  172
               I+MTKDGRISLAGLS+AK +YLA+AI DS+ N 
Sbjct  378  THKIFMTKDGRISLAGLSSAKVKYLANAIDDSFRNA  413



>ref|XP_005643912.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE19368.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=440

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 1/93 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW++E++ MAGR+  +RQ L+ +L      G  W  IL QIGMFSFTGL K Q   M+
Sbjct  345  YAEWREELKGMAGRIMQMRQELFRALQQVGAPG-SWNHILDQIGMFSFTGLTKEQVRVMT  403

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  184
            +KWH+YMT DGRIS+AGLS++KC YLA+AI D+
Sbjct  404  DKWHVYMTFDGRISMAGLSSSKCHYLAEAINDA  436



>emb|CDX70399.1| BnaC03g04830D [Brassica napus]
Length=450

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+
Sbjct  354  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSYMT  412

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  413  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW  ILKQIGMF+FTGLN AQ   M+
Sbjct  354  YNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWNHILKQIGMFTFTGLNTAQVAFMT  412

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  413  KEYHVYMTSDGRISMAGLSSKTVPHLADAI  442



>ref|XP_009131210.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Brassica 
rapa]
 emb|CDX78428.1| BnaA03g03400D [Brassica napus]
Length=452

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+
Sbjct  356  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSYMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW  ILKQIGMF+FTGLN AQ   M+
Sbjct  326  YNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWNHILKQIGMFTFTGLNTAQVAFMT  384

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++H+YMT DGRIS+AGLS+    +LADAI
Sbjct  385  KEYHVYMTSDGRISMAGLSSKTVPHLADAI  414



>gb|AAM91546.1| aspartate aminotransferase Asp2 [Arabidopsis thaliana]
Length=201

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  105  YNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  163

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  164  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  193



>ref|XP_007137184.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
 gb|ESW09178.1| hypothetical protein PHAVU_009G106800g [Phaseolus vulgaris]
Length=410

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  314  FNEWTIELKGMADRIISMRQQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVSFMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
            N++HIYMT DGRIS+AGLS+     LADAI
Sbjct  373  NEYHIYMTSDGRISMAGLSSKTVPLLADAI  402



>ref|XP_002514283.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF48237.1| aspartate aminotransferase, putative [Ricinus communis]
Length=404

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  308  YNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  366

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  367  KEYHIYMTADGRISMAGLSSKTVPHLADAI  396



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+
Sbjct  356  FNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  REYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+
Sbjct  356  FNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  REYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q E M+
Sbjct  356  FNEWTIELKAMADRIISMRKQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSKQVEFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  REYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_010420761.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Camelina sativa]
Length=405

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTVELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_010493028.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTVELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_006287876.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
 gb|EOA20774.1| hypothetical protein CARUB_v10001103mg [Capsella rubella]
Length=405

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTIELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_010454237.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Camelina sativa]
Length=405

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L+D++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTIELKEMADRIKSMRQQLFDAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  362  FNEWTVELKAMADRIISMRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  421  QEYHIYMTSDGRISMAGLSGRTIPHLADAI  450



>ref|XP_006289742.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
 gb|EOA22640.1| hypothetical protein CARUB_v10003310mg [Capsella rubella]
Length=452

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  356  FNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_007013138.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
 gb|EOY30757.1| Aspartate aminotransferase, cytoplasmic [Theobroma cacao]
Length=405

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEWK E++ MA R+ S+R+ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  309  YNEWKIELKAMAERIISMRKQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_004136291.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004168053.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN60208.1| hypothetical protein Csa_3G889160 [Cucumis sativus]
Length=464

 Score =   109 bits (272),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  368  FNEWTVELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSFMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  427  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  456



>ref|XP_010419724.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=454

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  358  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  417  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>ref|XP_010491885.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like [Camelina 
sativa]
Length=451

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  355  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMT  413

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  414  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>ref|XP_010453196.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Camelina 
sativa]
Length=455

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  359  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSYMT  417

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  418  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>ref|XP_002871893.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48152.1| hypothetical protein ARALYDRAFT_909992 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L++++  +   G DWT I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWTHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  356  FNEWTVELKAMADRIISMRKQLYDALCSRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  444



>ref|XP_002873517.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49776.1| hypothetical protein ARALYDRAFT_487989 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  353  FNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  412  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|NP_196713.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
 sp|P46644.1|AAT3_ARATH RecName: Full=Aspartate aminotransferase 3, chloroplastic; AltName: 
Full=Protein YELLOW-LEAF-SPECIFIC GENE 4; AltName: Full=Transaminase 
A; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA79371.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB87712.1| aspartate aminotransferase (Asp3) [Arabidopsis thaliana]
 gb|AAK92700.1| putative aspartate aminotransferase Asp3 [Arabidopsis thaliana]
 gb|AAL85041.1| putative aspartate aminotransferase ASP3 [Arabidopsis thaliana]
 gb|AED91691.1| aspartate aminotransferase 3 [Arabidopsis thaliana]
Length=449

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  353  FNEWTLELKAMADRIISMRKQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  412  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  353  FNEWTFELKAMADRIISMRQKLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPQQVAFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
              +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  412  KDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  311  FNEWTVELKGMADRIISMRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  370  QEYHIYMTSDGRISMAGLSGRTIPHLADAI  399



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  364  FNEWTVELKGMADRIISMRQQLFDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  423  QEYHIYMTSDGRISMAGLSGRTIPHLADAI  452



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  311  YNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  370  KEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  311  YNEWTVELKAMADRIISMRQKLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  370  KEYHIYMTSDGRISMAGLSSRTVPLLADAI  399



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  355  YNEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  413

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  414  REYHIYMTSDGRISMAGLSSKTVPHLADAI  443



>gb|KFK25414.1| aspartate aminotransferase [Arabis alpina]
Length=449

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R+ L+++L  +   G DWT I+KQIGMF+FTGLN AQ   M+
Sbjct  353  FHEWTLELKAMADRIISMRKQLFEALRARGTPG-DWTHIIKQIGMFTFTGLNPAQVSFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  412  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R+ L+D+L +++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  358  FDEWTVELKAMADRIISMREQLFDALKIRETPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  417  QEYHIYMTSDGRISMAGLSSRTVPHLADAI  446



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  311  YNEWTVELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  370  KEYHIYMTSDGRISMAGLSSRTVPHLTDAI  399



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  309  YNEWTLELKAMADRIISMRQELFNALQAKGTPG-DWSHIVKQIGMFTFTGLNSEQVTFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
            N++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  368  NEYHIYLTSDGRISMAGLSSRTVPHLADAI  397



>gb|KJB64944.1| hypothetical protein B456_010G072900 [Gossypium raimondii]
Length=405

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEWK E++ MA R+ S+R+ L+D+LS K   G +W+ I+KQIGMF+FTGLN  Q   M+
Sbjct  309  YNEWKIELKAMADRIISMRKQLFDALSAKGTPG-NWSHIIKQIGMFTFTGLNSDQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>gb|KHG24168.1| Aspartate aminotransferase, cytoplasmic [Gossypium arboreum]
Length=405

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEWK E++ MA R+ S+R+ L+D+LS K   G DW+ I+KQIGMF+FTGL+  Q   M+
Sbjct  309  YNEWKIELKAMADRIISMRKQLFDALSAKGTPG-DWSHIIKQIGMFTFTGLDSDQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQ  298
            F+EWKQEMEMMAGR+KSVRQ LYDSLS KDKSGKDW++ILKQIGMFSFTGLNKAQ
Sbjct  365  FDEWKQEMEMMAGRIKSVRQKLYDSLSAKDKSGKDWSYILKQIGMFSFTGLNKAQ  419



>ref|XP_008466236.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Cucumis melo]
Length=460

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  364  FNEWTVELKAMADRIISMRQQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSFMT  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  423  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_006476088.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=449

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I KQIGMF+FTGLN  Q   M+
Sbjct  353  FNEWTFELKAMADRIISMRQKLFDALRARGTPG-DWSHIFKQIGMFTFTGLNPQQVAFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
              +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  412  KDYHIYMTSDGRISMAGLSSKTVPHLADAI  441



>gb|AAL82596.1| aspartate aminotransferase 1 [Musa acuminata]
 gb|AAL82597.1| aspartate aminotransferase 2 [Musa acuminata]
Length=114

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  18   YHEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNTEQVTFMT  76

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  77   KEYHIYMTSDGRISMAGLSSKTVPHLVDAI  106



>gb|AFK44136.1| unknown [Medicago truncatula]
Length=153

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  57   YNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILT  115

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  116  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  145



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  315  YNEWTXELKAMADRIISMRQLLFDTLRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  373

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  374  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>gb|AAL09704.1|AF419301_1 aspartate aminotransferase [Securigera parviflora]
Length=341

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  245  YNEWTIELKAMADRIISMRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNPEQVSFMT  303

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  304  KEYHIYLTSDGRISMAGLSSKTVSHLADAI  333



>gb|AAA79370.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>ref|NP_197456.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46645.2|AAT2_ARATH RecName: Full=Aspartate aminotransferase, cytoplasmic isozyme 
1; AltName: Full=Transaminase A [Arabidopsis thaliana]
 gb|ABG25061.1| At5g19550 [Arabidopsis thaliana]
 gb|AED92724.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=405

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N W  E++ MA R+KS+RQ L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+
Sbjct  309  YNNWTIELKEMADRIKSMRQQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLADAM  397



>gb|ABY58643.1| aspartate aminotransferase [Triticum aestivum]
Length=380

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R+ L+D+L +++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  290  FDEWTVELKAMADRIISMREQLFDALKIRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  348

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  349  QEYHIYMTSDGRISMAGLSSRTVPHLADAI  378



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  364  FNEWTLELKAMADRIISMRQQLFDALKSRGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  423  QEYHIYMTSDGRISMAGLSTRTVPHLADAI  452



>ref|XP_010519717.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X2 [Tarenaya hassleriana]
Length=405

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  309  YNEWTIELKGMADRIISMRHQLYDALQARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_008789337.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Phoenix dactylifera]
Length=463

 Score =   107 bits (268),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN+ Q   M+
Sbjct  367  FHEWTIELKAMADRIISMRQLLFDALHARGTPG-DWSHIIKQIGMFTFTGLNREQVAFMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  426  QEYHIYMTSDGRISMAGLSSKTVPHLADAI  455



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW  E++ MA R+ S+RQ LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  310  YTEWSVELKAMADRIISMRQQLYDALCARGTPG-DWSHIIKQIGMFTFTGLNTNQVAFMT  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  369  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  398



>ref|XP_006399658.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
 dbj|BAJ33906.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41111.1| hypothetical protein EUTSA_v10013515mg [Eutrema salsugineum]
Length=453

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  357  FNEWTLELKAMADRIISMRKQLFEALRARGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LAD+I
Sbjct  416  KEYHIYMTSDGRISMAGLSSKTVPHLADSI  445



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  315  YNEWTLELKAMADRIISMRQLLFDTLRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  373

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  374  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  403



>ref|XP_010519716.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
isoform X1 [Tarenaya hassleriana]
Length=340

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  LYD+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  244  YNEWTIELKGMADRIISMRHQLYDALQARGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  302

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  303  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  332



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  L+D+L+ +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  311  YNEWTIELKAMADRIISMRHQLFDALTARGTPG-DWSHIMKQIGMFTFTGLNSEQVAFMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  370  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  399



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q  +M+
Sbjct  365  YTEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIVKQIGMFTFTGLNTEQVASMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  424  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  453



>tpg|DAA57534.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=171

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ ++RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  75   FNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  133

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  134  QEYHIYMTSDGRISMAGLSMRTVPHLADAI  163



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  362  YNEWTIELKAMADRIISMRQQLFDALRDRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  421  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  450



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  362  YNEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSFMT  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  421  KEYHIYMTSDGRISMAGLSSRTVSHLADAI  450



>ref|XP_010920378.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Elaeis guineensis]
Length=464

 Score =   107 bits (266),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  368  FHEWTVELKAMADRIISMRQMLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  427  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  456



>gb|AEX09182.1| putative aspartate aminotransferase 1 [Gossypium hirsutum]
Length=405

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEWK E++ MA R+ S+R+ L+D+LS K   G DW+ I+KQIGMF+FTGL+  Q   M 
Sbjct  309  YNEWKIELKAMADRIISMRKQLFDALSAKGTPG-DWSHIIKQIGMFTFTGLDSDQVAFMI  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  397



>ref|XP_004291203.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L+DSL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  363  FNEWTIELKAMADRIISMRHQLFDSLRAKGTPG-DWSHIIKQIGMFTFTGLNPEQVAFMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  422  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  451



>emb|CDY44925.1| BnaA02g04300D [Brassica napus]
Length=405

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MAGR+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMAGRIISMRQHLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>ref|XP_010532471.1| PREDICTED: aspartate aminotransferase 3, chloroplastic [Tarenaya 
hassleriana]
Length=451

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R+ L+D+L  +   G DW+ I+KQIGMF+FTGLN AQ   M+
Sbjct  355  FNEWTLELKAMADRIISMRKQLFDALRARGTPG-DWSHIVKQIGMFTFTGLNTAQVSFMT  413

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  414  KEYHIYMTSDGRISMAGLSSKTVPHLTEAI  443



>gb|KCW81535.1| hypothetical protein EUGRSUZ_C02894 [Eucalyptus grandis]
Length=452

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  356  YNEWTIELKAMADRIISMRHQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSQQVAFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  415  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  444



>ref|XP_010693429.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  355  YDEWTVELKAMAERIISMRQKLFDALQTRGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  413

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  414  KEYHIYMTSDGRISMAGLSSKTIPHLADAM  443



>tpg|DAA57533.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=201

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ ++RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  105  FNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  163

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  164  QEYHIYMTSDGRISMAGLSMRTVPHLADAI  193



>gb|AAC50015.1| aspartate aminotransferase cytosolic isozyme AAT2 [Glycine max]
Length=419

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+W  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  323  FNDWTIELKAMADRIISMRQELFDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMT  381

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  382  KEFHIYMTSDGRISMAGLSSKTVPLLADAI  411



>ref|XP_002516566.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF45907.1| aspartate aminotransferase, putative [Ricinus communis]
Length=440

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  344  YSEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  402

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  403  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  432



>ref|XP_002989786.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
 gb|EFJ09053.1| hypothetical protein SELMODRAFT_184818 [Selaginella moellendorffii]
Length=413

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R  LYD+L  +   G DWT ILKQIGMFSFTGLNK Q + M+
Sbjct  316  FSEWTVELKGMADRIISMRHKLYDALRARGTPG-DWTHILKQIGMFSFTGLNKEQVQFMT  374

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++ IYMT DGRIS+AGLS      LADAI
Sbjct  375  REYRIYMTLDGRISMAGLSLKTVPLLADAI  404



>ref|NP_001237541.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|AAC50014.1| aspartate aminotransferase glyoxysomal isozyme AAT1 precursor 
[Glycine max]
 gb|KHN18198.1| Aspartate aminotransferase 1 [Glycine soja]
Length=456

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+W  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  360  FNDWTIELKAMADRIISMRQELFDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMT  418

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  419  KEFHIYMTSDGRISMAGLSSKTVPLLADAI  448



>ref|XP_006451184.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 ref|XP_006475645.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Citrus 
sinensis]
 gb|ESR64424.1| hypothetical protein CICLE_v10008489mg [Citrus clementina]
 gb|KDO48875.1| hypothetical protein CISIN_1g015435mg [Citrus sinensis]
Length=407

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW  E++ MA R+ S+RQ L+D+LS +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  311  YKEWTLELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  370  KEYHIYMTSDGRISMAGLSSKTVPHLTDAI  399



>ref|XP_002990136.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
 gb|EFJ08853.1| hypothetical protein SELMODRAFT_235954 [Selaginella moellendorffii]
Length=414

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R  LYD+L  +   G DWT ILKQIGMFSFTGLNK Q + M+
Sbjct  317  FSEWTVELKGMADRIISMRHKLYDALRARGTPG-DWTHILKQIGMFSFTGLNKEQVQFMT  375

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++ IYMT DGRIS+AGLS      LADAI
Sbjct  376  REYRIYMTLDGRISMAGLSLKTVPLLADAI  405



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  358  YNEWTIELKAMADRIICMRQQLFDALHARGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMT  416

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  417  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  446



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R+ L+++L +++  G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  311  FDEWTLELKAMADRIISMREQLFNALKIRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  369

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  370  QEYHIYMTSDGRISMAGLSSRTVPHLADAI  399



>ref|XP_010100270.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB82277.1| Aspartate aminotransferase [Morus notabilis]
Length=463

 Score =   105 bits (263),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  367  YNEWTIELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNAEQVAFMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  426  KEYHIYMTSDGRISMAGLSSKTVPHLVDAI  455



>emb|CDP03316.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  314  YHEWTVELKAMADRIISMRQKLFDALQARGTPG-DWSHIIKQIGMFTFTGLNAQQVAFMT  372

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  373  KEYHIYMTSDGRISMAGLSSQTVPLLADAI  402



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+  +RQ L+D+L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  356  YHEWTLELKAMADRIIRMRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  415  KEYHIYMTSDGRISMAGLSSRTVPHLTDAI  444



>ref|XP_006352160.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Solanum 
tuberosum]
Length=406

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ LYD++  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  310  YDEWTVELKAMADRIISMRQQLYDAMQARGTPG-DWSHIIKQIGMFTFTGLNVEQVSFMT  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  369  REYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>emb|CDP16161.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  324  FHEWTLELKAMADRIISMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVTFMR  382

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  383  KEYHIYMTSDGRISMAGLSSRTVPHLTDAI  412



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+  +RQ L+D+L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  357  YHEWTLELKAMADRIIRMRQQLFDALRAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  415

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  416  KEYHIYMTSDGRISMAGLSSRTIPHLTDAI  445



>emb|CDX92520.1| BnaA10g15590D [Brassica napus]
Length=405

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  368  KEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>ref|XP_009120876.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1-like 
[Brassica rapa]
Length=405

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  368  KEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>emb|CDY65959.1| BnaC09g54080D [Brassica napus]
Length=405

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +L DAI
Sbjct  368  KEYHIYMTSDGRISMAGLSTKTVPHLVDAI  397



>gb|KHN10226.1| Aspartate aminotransferase 1 [Glycine soja]
Length=416

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  320  FNDWTIELKAMADRIINMRQELFDALRSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMT  378

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  379  KEYHIYMTSDGRISMAGLSSKTVPLLADAI  408



>gb|ACU21245.1| unknown [Glycine max]
Length=344

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FN+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  248  FNDWTIELKAMADRIINMRQELFDALRSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMT  306

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  307  KEYHIYMTSDGRISMAGLSSKTVPLLADAI  336



>ref|XP_009762342.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=409

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L  +  +G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  313  YDEWTIELKAMADRIISMRQQLFDALQARGTTG-DWSHIIKQIGMFTFTGLNTEQVSFMT  371

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  372  REHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>ref|XP_009617506.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=409

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L  +  +G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  313  YDEWTIELKAMADRIISMRQQLFDALQARGTAG-DWSHIIKQIGMFTFTGLNTEQVSFMT  371

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             + HIYMT DGRIS+AGLS+    +LADAI
Sbjct  372  REHHIYMTSDGRISMAGLSSRTIPHLADAI  401



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  313  FHEWTVELKAMADRIISMRQQLFDALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  371

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGL+     +LADAI
Sbjct  372  QEYHIYMTSDGRISMAGLNMKNVPHLADAI  401



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  352  YHEWTLELKAMADRIIRMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  410

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  411  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  440



>ref|XP_002308618.1| aspartate transaminase family protein [Populus trichocarpa]
 gb|EEE92141.1| aspartate transaminase family protein [Populus trichocarpa]
Length=449

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  353  YNEWTIELKAMADRIISMRQKLFEALHARGTPG-DWSHIVKQIGMFTFTGLNSKQVAFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  412  KEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_011090162.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=460

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  364  YQEWTIELKAMAERIISMRQQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMT  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  423  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  452



>ref|XP_011019648.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=449

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  353  YNEWTIELKAMADRIISMRQKLFEALRARGTPG-DWSHIVKQIGMFTFTGLNSKQVAFMT  411

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  412  KEYHIYMTSDGRISMAGLSSKTVPHLADAM  441



>ref|XP_010049084.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Eucalyptus 
grandis]
Length=594

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  498  YNEWTIELKAMADRIISMRHQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSQQVAFMT  556

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  557  KEYHIYMTSDGRISMAGLSSKTVPHLADAI  586



>emb|CAA63894.1| aspartate aminotransferase [Lotus japonicus]
Length=418

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+RQ L+D+L  +   G DW+ I+K IGMF+FTGLN  Q   M+
Sbjct  322  YNEWTIELKGMADRIISMRQQLFDALRSRGTPG-DWSHIIKSIGMFTFTGLNPEQVSFMT  380

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  381  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  321  YNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILT  379

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  380  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  409



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  322  YNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILT  380

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  381  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_008361035.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  365  FNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  424  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>gb|AAA33408.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  324  YNEWHIELKAMADRIIKMRQQLFDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLT  382

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  383  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>ref|XP_010688229.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Beta 
vulgaris subsp. vulgaris]
Length=405

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ L+D+L+ +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  309  YDEWTIELKEMADRIISMRQQLFDALNARGTPG-DWSHIIKQIGMFTFTGLNADQVTFMR  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  368  AEYHIYMTSDGRISMAGLSSRTVPHLADAI  397



>ref|XP_008352022.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=461

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  365  FNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  423

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  424  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  453



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ ++RQ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  363  FNEWTLELKAMADRIINMRQQLFNALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS     +LADAI
Sbjct  422  QEYHIYMTSDGRISMAGLSMRTVPHLADAI  451



>gb|AAA50160.1| aspartate aminotransferase P1 [Lupinus angustifolius]
Length=420

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  324  YNEWTIELKAMADRIIKMRQQLFDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLT  382

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  383  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  412



>ref|XP_006476087.1| PREDICTED: aspartate aminotransferase 3, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=455

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 65/95 (68%), Gaps = 5/95 (5%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKD-----KSGKDWTFILKQIGMFSFTGLNKAQ  298
            FNEW  E++ MA R+ S+RQ L+D+L  ++      +  DW+ I KQIGMF+FTGLN  Q
Sbjct  353  FNEWTFELKAMADRIISMRQKLFDALRAREIWYIAGTPGDWSHIFKQIGMFTFTGLNPQQ  412

Query  297  SENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
               M+  +HIYMT DGRIS+AGLS+    +LADAI
Sbjct  413  VAFMTKDYHIYMTSDGRISMAGLSSKTVPHLADAI  447



>ref|XP_009410920.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN+ Q  +M+
Sbjct  363  YHEWTIELKAMADRIIRMRQQLFDALRTRGTPG-DWSHIVKQIGMFTFTGLNREQVTSMT  421

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LA AI
Sbjct  422  KEYHIYMTSDGRISMAGLSSKTVPHLAGAI  451



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + EW  E++ MA R+  +RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  354  YREWTLELKAMADRIIRMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  412

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  413  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  442



>gb|KEH36020.1| aspartate aminotransferase [Medicago truncatula]
Length=458

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  362  YNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILT  420

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  421  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  450



>ref|XP_008378104.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Malus domestica]
Length=421

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  325  FNEWTIELKEMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  383

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  384  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  413



>ref|XP_010048107.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Eucalyptus 
grandis]
 gb|KCW80239.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=406

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  310  YNEWTIELKAMADRIISMRHQLFEALKTRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  369  QEYHIYMTSDGRISMAGLSSRTVPHLADAI  398



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++
Sbjct  322  YNDWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNSEQVSILT  380

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  381  KEYHIYLTSDGRISMAGLSSKTVPHLADAI  410



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score =   103 bits (258),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/90 (52%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  E++ MA R+ S+RQ L+++L+++   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  368  FEEWTIELKGMANRIISMRQQLFNALNIRGTPG-DWSHIIKQIGMFTFTGLNSDQVAFMR  426

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+   ++LA+AI
Sbjct  427  QEYHIYMTSDGRISMAGLSSRTVDHLANAI  456



>gb|KCW80240.1| hypothetical protein EUGRSUZ_C01585 [Eucalyptus grandis]
Length=415

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +NEW  E++ MA R+ S+R  L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M 
Sbjct  319  YNEWTIELKAMADRIISMRHQLFEALKTRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMR  377

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  378  QEYHIYMTSDGRISMAGLSSRTVPHLADAI  407



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ ++RQ L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  325  YHEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNTEQVTFMT  383

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  384  KEYHIYMTSDGRISMAGLSSKTVPHLVDAI  413



>ref|XP_008220042.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Prunus mume]
Length=463

 Score =   103 bits (257),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  367  FNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  425

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  426  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  455



>ref|XP_007222958.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
 gb|AGF95095.1| aspartate aminotransferase [Prunus persica]
 gb|EMJ24157.1| hypothetical protein PRUPE_ppa005315mg [Prunus persica]
Length=467

 Score =   103 bits (257),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            FNEW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  371  FNEWTIELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  429

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  430  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  459



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>emb|CDY42276.1| BnaC02g08820D [Brassica napus]
Length=405

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+RQ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRQQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLVEAI  397



>gb|AIT70250.1| aspartate aminotransferase [Betaphycus philippinensis]
Length=420

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW++E+  MA R++ +RQ L  +L +K+ +  +W  I+ QIGMFSFTGL  AQ E M 
Sbjct  317  FAEWEEELRKMADRIRDMRQKLRGAL-VKNGTPGNWDHIVNQIGMFSFTGLTAAQVELMK  375

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  184
            NK+HIYMT +GRIS+AGL+    EY+ADA+ D+
Sbjct  376  NKYHIYMTSNGRISMAGLTEDTVEYVADAMKDA  408



>gb|KFK26196.1| hypothetical protein AALP_AA8G215200 [Arabis alpina]
Length=405

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+R+ L+++L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  309  YNDWTIELKAMADRIISMRKQLFEALQTRGTPG-DWSHIIKQIGMFTFTGLNTEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS  184
             + HIYMT DGRIS+AGLS+    +LADAI D+
Sbjct  368  KEHHIYMTSDGRISMAGLSSKTVPHLADAIHDA  400



>ref|XP_004243159.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=406

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            ++EW  E++ MA R+ S+RQ LY ++  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  310  YDEWTVELKAMADRIISMRQQLYAAMQARGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMT  368

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
            +++HIYMT DGRIS+AGLS+    +LADA+
Sbjct  369  SEYHIYMTSDGRISMAGLSSRTVPHLADAM  398



>ref|XP_006400515.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
 gb|ESQ41968.1| hypothetical protein EUTSA_v10013703mg [Eutrema salsugineum]
Length=405

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ MA R+ S+R+ L+++L  K   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  309  YNDWTIELKGMADRIISMRKQLFEALQAKGTPG-DWSHIIKQIGMFTFTGLNKEQVAFMT  367

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct  368  KEFHIYMTSDGRISMAGLSSKTVPHLVDAI  397



>emb|CDY71396.1| BnaCnng72730D [Brassica napus]
Length=240

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            + +W  E++ MA R+ S+RQ LY+++  +   G DW+ I+KQIGMFSFTGLN+ Q   M+
Sbjct  144  YKDWTIELKGMADRIISMRQQLYEAIQARGTPG-DWSHIIKQIGMFSFTGLNEKQVRMMA  202

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+     LADAI
Sbjct  203  KEYHIYMTYDGRISMAGLSSKTVPQLADAI  232



>ref|XP_009367911.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X2 
[Pyrus x bretschneideri]
Length=452

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  356  FSEWTVELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  414

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  415  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  444



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F EW  E++ MA R+ ++R  L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  359  FQEWTVELKAMADRIINMRTQLFDALRSRGTPG-DWSHIIKQIGMFTFTGLNSKQVAFMT  417

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +LADAI
Sbjct  418  KEYHIYMTSDGRISMAGLSSRTVPHLADAI  447



>gb|KFK40563.1| hypothetical protein AALP_AA2G012200 [Arabis alpina]
Length=119

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +N+W  E++ M  R+ ++RQ LY++L  +   G DW+ I+KQIGMFSFTGLN+ Q   M+
Sbjct  23   YNDWNIELKGMVDRILNMRQQLYEALQARGTPG-DWSHIIKQIGMFSFTGLNEKQVRLMA  81

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAIID  187
             ++HIYMT +GRIS+ GLS      LADAI D
Sbjct  82   KEYHIYMTYNGRISIGGLSLKTVTRLADAIHD  113



>ref|XP_009367910.1| PREDICTED: aspartate aminotransferase, cytoplasmic isoform X1 
[Pyrus x bretschneideri]
Length=460

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            F+EW  E++ MA R+ S+R  L++SL  K   G DW+ I+KQIGMF+FTGLN  Q   M+
Sbjct  364  FSEWTVELKAMADRIISMRHQLFESLRAKGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMT  422

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIYMT DGRIS+AGLS+    +L +AI
Sbjct  423  KEYHIYMTSDGRISMAGLSSRTVPHLTEAI  452



>gb|ABR16105.1| unknown [Picea sitchensis]
Length=424

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = -2

Query  462  FNEWKQEMEMMAGRVKSVRQXLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMS  283
            +  W  E++ MA R+ S+R  LYD+L  +   G DW+ I+KQIGMF+FTGLNK Q   M+
Sbjct  328  YYNWTVELKNMADRIISMRHQLYDALKARGTPG-DWSHIIKQIGMFTFTGLNKDQVSFMT  386

Query  282  NKWHIYMTKDGRISLAGLSAAKCEYLADAI  193
             ++HIY+T DGRIS+AGLS+    +LADAI
Sbjct  387  AEYHIYLTSDGRISMAGLSSKTVPHLADAI  416



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561614547535