BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005C13

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086869.1|  PREDICTED: uncharacterized protein LOC105168472    179   3e-50   Sesamum indicum [beniseed]
gb|EYU37358.1|  hypothetical protein MIMGU_mgv1a004629mg                174   7e-49   Erythranthe guttata [common monkey flower]
ref|XP_010100043.1|  hypothetical protein L484_013155                   162   7e-48   
ref|XP_003536819.1|  PREDICTED: myosin heavy chain, skeletal musc...    171   1e-47   Glycine max [soybeans]
gb|KHN27159.1|  hypothetical protein glysoja_032927                     167   2e-47   Glycine soja [wild soybean]
ref|XP_007142592.1|  hypothetical protein PHAVU_007G000500g             168   5e-47   Phaseolus vulgaris [French bean]
ref|XP_004310133.1|  PREDICTED: coiled-coil domain-containing pro...    169   1e-46   Fragaria vesca subsp. vesca
ref|XP_007142591.1|  hypothetical protein PHAVU_007G000500g             169   1e-46   Phaseolus vulgaris [French bean]
ref|XP_002297871.1|  hypothetical protein POPTR_0001s13160g             169   1e-46   
ref|XP_003556588.1|  PREDICTED: protein anoxia up-regulated-like ...    168   2e-46   Glycine max [soybeans]
ref|XP_007222390.1|  hypothetical protein PRUPE_ppa004878mg             167   4e-46   
ref|XP_008222369.1|  PREDICTED: uncharacterized protein LOC103322249    168   4e-46   Prunus mume [ume]
emb|CDP18972.1|  unnamed protein product                                159   5e-46   Coffea canephora [robusta coffee]
ref|XP_011020859.1|  PREDICTED: uncharacterized protein LOC105123085    166   1e-45   Populus euphratica
ref|XP_007043822.1|  Uncharacterized protein isoform 1                  166   2e-45   
emb|CAN81746.1|  hypothetical protein VITISV_038195                     165   2e-45   Vitis vinifera
ref|XP_010066446.1|  PREDICTED: dynactin subunit 1 isoform X3           165   3e-45   Eucalyptus grandis [rose gum]
ref|XP_002267942.2|  PREDICTED: uncharacterized protein LOC100260846    165   4e-45   
ref|XP_011036158.1|  PREDICTED: uncharacterized protein LOC105133757    165   5e-45   Populus euphratica
ref|XP_010066445.1|  PREDICTED: uncharacterized protein LOC104453...    164   5e-45   Eucalyptus grandis [rose gum]
ref|XP_010066444.1|  PREDICTED: uncharacterized protein LOC104453...    164   5e-45   Eucalyptus grandis [rose gum]
ref|XP_004497432.1|  PREDICTED: uncharacterized protein LOC101507...    164   5e-45   Cicer arietinum [garbanzo]
ref|XP_004497431.1|  PREDICTED: uncharacterized protein LOC101507...    164   5e-45   Cicer arietinum [garbanzo]
gb|KCW64334.1|  hypothetical protein EUGRSUZ_G01963                     164   6e-45   Eucalyptus grandis [rose gum]
gb|KDP23274.1|  hypothetical protein JCGZ_23107                         164   7e-45   Jatropha curcas
ref|XP_002304646.2|  hypothetical protein POPTR_0003s16260g             164   8e-45   
ref|XP_008390187.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    163   2e-44   
ref|XP_009378816.1|  PREDICTED: uncharacterized protein LOC103967265    163   2e-44   
ref|XP_009359892.1|  PREDICTED: uncharacterized protein LOC103950...    160   6e-44   
gb|KDO83180.1|  hypothetical protein CISIN_1g008906mg                   158   9e-44   Citrus sinensis [apfelsine]
ref|XP_009359891.1|  PREDICTED: uncharacterized protein LOC103950...    161   9e-44   Pyrus x bretschneideri [bai li]
ref|XP_008459909.1|  PREDICTED: uncharacterized protein LOC103498889    160   2e-43   Cucumis melo [Oriental melon]
ref|XP_008369644.1|  PREDICTED: uncharacterized protein LOC103433181    159   4e-43   
ref|XP_006483009.1|  PREDICTED: myosin-9-like isoform X3                158   7e-43   
gb|KDO83179.1|  hypothetical protein CISIN_1g008906mg                   158   7e-43   Citrus sinensis [apfelsine]
ref|XP_006483008.1|  PREDICTED: myosin-9-like isoform X2                158   8e-43   Citrus sinensis [apfelsine]
gb|AFK47824.1|  unknown                                                 152   9e-43   Lotus japonicus
gb|KDO83174.1|  hypothetical protein CISIN_1g008906mg                   158   9e-43   Citrus sinensis [apfelsine]
ref|XP_006483007.1|  PREDICTED: myosin-9-like isoform X1                158   1e-42   Citrus sinensis [apfelsine]
ref|XP_006438862.1|  hypothetical protein CICLE_v10031153mg             158   1e-42   Citrus clementina [clementine]
gb|KGN46417.1|  hypothetical protein Csa_6G091900                       156   5e-42   Cucumis sativus [cucumbers]
ref|XP_004140652.1|  PREDICTED: uncharacterized protein LOC101205430    156   5e-42   
ref|XP_004239298.1|  PREDICTED: uncharacterized protein LOC101253187    156   6e-42   Solanum lycopersicum
ref|XP_006343189.1|  PREDICTED: uncharacterized protein LOC102581164    156   6e-42   Solanum tuberosum [potatoes]
ref|XP_009597749.1|  PREDICTED: uncharacterized protein LOC104093...    155   8e-42   Nicotiana tomentosiformis
ref|XP_010249187.1|  PREDICTED: uncharacterized protein LOC104591834    155   9e-42   Nelumbo nucifera [Indian lotus]
ref|XP_004170125.1|  PREDICTED: uncharacterized LOC101205430            144   1e-41   
ref|XP_011073178.1|  PREDICTED: macoilin-1                              153   8e-41   Sesamum indicum [beniseed]
ref|XP_010682658.1|  PREDICTED: uncharacterized protein LOC104897472    152   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009781777.1|  PREDICTED: uncharacterized protein LOC104230...    152   2e-40   Nicotiana sylvestris
ref|XP_006844529.1|  hypothetical protein AMTR_s00016p00160930          150   6e-40   Amborella trichopoda
gb|KHG28186.1|  atg11                                                   151   6e-40   Gossypium arboreum [tree cotton]
ref|XP_008440074.1|  PREDICTED: macoilin-1                              150   7e-40   
ref|XP_006485111.1|  PREDICTED: dynactin subunit 1-like isoform X2      149   7e-40   
gb|KDO51298.1|  hypothetical protein CISIN_1g008306mg                   149   7e-40   Citrus sinensis [apfelsine]
ref|XP_004145144.1|  PREDICTED: uncharacterized protein LOC101221393    150   8e-40   Cucumis sativus [cucumbers]
gb|KHG28185.1|  atg11                                                   150   9e-40   Gossypium arboreum [tree cotton]
gb|KJB15173.1|  hypothetical protein B456_002G163500                    148   9e-40   Gossypium raimondii
ref|XP_009767496.1|  PREDICTED: uncharacterized protein LOC104218...    148   1e-39   Nicotiana sylvestris
gb|KDO51296.1|  hypothetical protein CISIN_1g008306mg                   149   2e-39   Citrus sinensis [apfelsine]
ref|XP_006485110.1|  PREDICTED: dynactin subunit 1-like isoform X1      149   2e-39   Citrus sinensis [apfelsine]
gb|KDO51297.1|  hypothetical protein CISIN_1g008306mg                   149   2e-39   Citrus sinensis [apfelsine]
ref|XP_006436938.1|  hypothetical protein CICLE_v10031078mg             149   2e-39   Citrus clementina [clementine]
gb|KJB15171.1|  hypothetical protein B456_002G163500                    149   2e-39   Gossypium raimondii
ref|XP_009767495.1|  PREDICTED: uncharacterized protein LOC104218...    149   2e-39   Nicotiana sylvestris
emb|CBI15742.3|  unnamed protein product                                148   3e-39   Vitis vinifera
ref|XP_002284492.1|  PREDICTED: uncharacterized protein LOC100256039    148   3e-39   Vitis vinifera
emb|CAN81274.1|  hypothetical protein VITISV_021176                     148   4e-39   Vitis vinifera
ref|XP_006341491.1|  PREDICTED: uncharacterized protein LOC102585...    146   1e-38   
ref|XP_006341490.1|  PREDICTED: uncharacterized protein LOC102585...    146   2e-38   Solanum tuberosum [potatoes]
gb|EYU21825.1|  hypothetical protein MIMGU_mgv1a021335mg                142   3e-38   Erythranthe guttata [common monkey flower]
ref|XP_007038109.1|  Uncharacterized protein isoform 3                  144   4e-38   
ref|XP_010099602.1|  hypothetical protein L484_004034                   145   5e-38   
ref|XP_010026209.1|  PREDICTED: dynactin subunit 1-like                 145   5e-38   Eucalyptus grandis [rose gum]
ref|XP_007038108.1|  Uncharacterized protein isoform 2                  145   6e-38   
emb|CDO98314.1|  unnamed protein product                                145   7e-38   Coffea canephora [robusta coffee]
ref|XP_007038107.1|  Uncharacterized protein isoform 1                  144   8e-38   
gb|KJB40055.1|  hypothetical protein B456_007G044600                    142   9e-38   Gossypium raimondii
ref|XP_006646640.1|  PREDICTED: ELKS/Rab6-interacting/CAST family...    144   9e-38   Oryza brachyantha
ref|XP_009597748.1|  PREDICTED: uncharacterized protein LOC104093...    144   1e-37   Nicotiana tomentosiformis
ref|XP_004971152.1|  PREDICTED: uncharacterized protein LOC101760852    144   2e-37   Setaria italica
ref|XP_002511106.1|  conserved hypothetical protein                     144   2e-37   Ricinus communis
gb|KJB40053.1|  hypothetical protein B456_007G044600                    142   2e-37   Gossypium raimondii
tpg|DAA56002.1|  TPA: hypothetical protein ZEAMMB73_352561              141   2e-37   
ref|XP_002459023.1|  hypothetical protein SORBIDRAFT_03g044670          143   2e-37   Sorghum bicolor [broomcorn]
gb|EEC72087.1|  hypothetical protein OsI_05032                          142   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010492074.1|  PREDICTED: uncharacterized protein LOC104769543    143   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010453387.1|  PREDICTED: uncharacterized protein LOC104735325    143   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006286776.1|  hypothetical protein CARUB_v10003326mg             142   3e-37   Capsella rubella
gb|EEE55938.1|  hypothetical protein OsJ_04631                          142   4e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004235837.1|  PREDICTED: uncharacterized protein LOC101264...    142   4e-37   Solanum lycopersicum
ref|XP_010419899.1|  PREDICTED: uncharacterized protein LOC104705575    142   4e-37   Camelina sativa [gold-of-pleasure]
gb|KJB40052.1|  hypothetical protein B456_007G044600                    142   4e-37   Gossypium raimondii
ref|NP_001045273.1|  Os01g0928100                                       142   5e-37   
gb|KJB40054.1|  hypothetical protein B456_007G044600                    142   5e-37   Gossypium raimondii
gb|KDP22551.1|  hypothetical protein JCGZ_26382                         142   6e-37   Jatropha curcas
ref|XP_006399817.1|  hypothetical protein EUTSA_v10013191mg             142   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_008674618.1|  PREDICTED: myosin heavy chain, striated muscle     142   9e-37   
ref|XP_003564988.1|  PREDICTED: MAP7 domain-containing protein 1-...    141   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_008777461.1|  PREDICTED: uncharacterized protein LOC103697393    140   2e-36   Phoenix dactylifera
ref|XP_009337520.1|  PREDICTED: uncharacterized protein LOC103929...    140   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009337519.1|  PREDICTED: uncharacterized protein LOC103929...    140   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_004501741.1|  PREDICTED: uncharacterized abhydrolase domai...    140   3e-36   Cicer arietinum [garbanzo]
ref|XP_010909766.1|  PREDICTED: uncharacterized protein LOC105035770    140   3e-36   Elaeis guineensis
ref|XP_004501742.1|  PREDICTED: uncharacterized abhydrolase domai...    140   3e-36   Cicer arietinum [garbanzo]
ref|XP_002321743.2|  hypothetical protein POPTR_0015s11590g             140   3e-36   
ref|XP_008351703.1|  PREDICTED: uncharacterized protein LOC103415127    139   5e-36   
gb|KEH35693.1|  ripening-regulated protein                              138   6e-36   Medicago truncatula
ref|XP_008239546.1|  PREDICTED: uncharacterized protein LOC103338...    139   8e-36   Prunus mume [ume]
gb|KFK25562.1|  hypothetical protein AALP_AA8G131000                    139   8e-36   Arabis alpina [alpine rockcress]
gb|KHN31266.1|  hypothetical protein glysoja_012916                     139   9e-36   Glycine soja [wild soybean]
ref|XP_006578723.1|  PREDICTED: uncharacterized abhydrolase domai...    139   1e-35   Glycine max [soybeans]
gb|KEH35692.1|  ripening-regulated protein                              138   2e-35   Medicago truncatula
ref|XP_006376918.1|  hypothetical protein POPTR_0012s10720g             138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009334313.1|  PREDICTED: uncharacterized protein LOC103927...    138   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009334312.1|  PREDICTED: uncharacterized protein LOC103927...    138   2e-35   Pyrus x bretschneideri [bai li]
gb|KJB51281.1|  hypothetical protein B456_008G210100                    137   2e-35   Gossypium raimondii
ref|XP_007209092.1|  hypothetical protein PRUPE_ppa003575mg             137   4e-35   Prunus persica
emb|CDX69654.1|  BnaA10g20030D                                          137   4e-35   
ref|XP_009121778.1|  PREDICTED: uncharacterized protein LOC103846586    137   5e-35   Brassica rapa
gb|KHN09724.1|  hypothetical protein glysoja_011998                     135   5e-35   Glycine soja [wild soybean]
emb|CDY09779.1|  BnaC09g43820D                                          137   5e-35   Brassica napus [oilseed rape]
ref|XP_010550755.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_007137890.1|  hypothetical protein PHAVU_009G164500g             136   8e-35   Phaseolus vulgaris [French bean]
ref|XP_011002098.1|  PREDICTED: uncharacterized protein LOC105109182    136   8e-35   Populus euphratica
gb|EPS59084.1|  hypothetical protein M569_15727                         136   9e-35   Genlisea aurea
ref|XP_008356569.1|  PREDICTED: uncharacterized protein LOC103420...    135   1e-34   
ref|XP_008374187.1|  PREDICTED: uncharacterized protein LOC103437...    135   1e-34   
ref|XP_002871557.1|  hypothetical protein ARALYDRAFT_488142             135   1e-34   Arabidopsis lyrata subsp. lyrata
gb|KJB15172.1|  hypothetical protein B456_002G163500                    135   1e-34   Gossypium raimondii
ref|XP_006581845.1|  PREDICTED: plectin-like                            135   1e-34   Glycine max [soybeans]
ref|XP_008356568.1|  PREDICTED: uncharacterized protein LOC103420...    135   2e-34   
ref|XP_008374186.1|  PREDICTED: uncharacterized protein LOC103437...    135   2e-34   
ref|XP_008356567.1|  PREDICTED: uncharacterized protein LOC103420...    135   2e-34   
ref|XP_008356566.1|  PREDICTED: uncharacterized protein LOC103420...    135   2e-34   
ref|XP_008374184.1|  PREDICTED: uncharacterized protein LOC103437...    135   2e-34   
ref|XP_008374185.1|  PREDICTED: uncharacterized protein LOC103437...    135   2e-34   
ref|XP_010247124.1|  PREDICTED: uncharacterized protein LOC104590245    132   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010556094.1|  PREDICTED: GRIP1-associated protein 1              134   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_008791048.1|  PREDICTED: uncharacterized protein LOC103708063    134   3e-34   Phoenix dactylifera
ref|XP_009368792.1|  PREDICTED: uncharacterized protein LOC103958...    133   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_009368795.1|  PREDICTED: uncharacterized protein LOC103958...    133   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_009368793.1|  PREDICTED: uncharacterized protein LOC103958...    133   1e-33   Pyrus x bretschneideri [bai li]
gb|AFN54517.1|  ripening-regulated protein                              132   2e-33   Fragaria x ananassa
ref|XP_008798921.1|  PREDICTED: uncharacterized protein LOC103713683    130   2e-33   
ref|NP_196830.2|  uncharacterized protein                               132   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297498.1|  PREDICTED: coiled-coil domain-containing pro...    132   2e-33   Fragaria vesca subsp. vesca
dbj|BAJ93558.1|  predicted protein                                      132   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008790703.1|  PREDICTED: uncharacterized protein LOC103707...    132   2e-33   Phoenix dactylifera
emb|CDM85875.1|  unnamed protein product                                132   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006405440.1|  hypothetical protein EUTSA_v10028083mg             129   3e-33   
ref|XP_010929654.1|  PREDICTED: protein Hook homolog 2-like isofo...    132   3e-33   Elaeis guineensis
ref|XP_010929655.1|  PREDICTED: protein Hook homolog 2-like isofo...    132   3e-33   Elaeis guineensis
ref|XP_010904828.1|  PREDICTED: uncharacterized protein LOC105032156    131   3e-33   Elaeis guineensis
ref|XP_011042949.1|  PREDICTED: uncharacterized protein LOC105138...    132   3e-33   Populus euphratica
ref|XP_011042951.1|  PREDICTED: uncharacterized protein LOC105138...    132   3e-33   Populus euphratica
emb|CBI34283.3|  unnamed protein product                                125   1e-32   Vitis vinifera
ref|XP_010531859.1|  PREDICTED: uncharacterized protein LOC104808...    129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010659988.1|  PREDICTED: uncharacterized protein LOC100260652    130   3e-32   
ref|XP_009415852.1|  PREDICTED: uncharacterized protein LOC103996...    129   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415853.1|  PREDICTED: uncharacterized protein LOC103996...    129   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415851.1|  PREDICTED: uncharacterized protein LOC103996...    129   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678340.1|  PREDICTED: myosin heavy chain, non-muscle          129   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002975311.1|  hypothetical protein SELMODRAFT_442801             128   5e-32   
ref|XP_002964484.1|  hypothetical protein SELMODRAFT_438807             128   5e-32   Selaginella moellendorffii
ref|XP_006855399.1|  hypothetical protein AMTR_s00057p00146260          127   1e-31   
gb|EPS67968.1|  hypothetical protein M569_06807                         119   1e-31   Genlisea aurea
ref|XP_010545937.1|  PREDICTED: uncharacterized protein LOC104818...    125   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_010545934.1|  PREDICTED: uncharacterized protein LOC104818...    125   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010545933.1|  PREDICTED: uncharacterized protein LOC104818...    125   5e-31   Tarenaya hassleriana [spider flower]
emb|CDX88044.1|  BnaA06g26350D                                          125   1e-30   
ref|XP_009150900.1|  PREDICTED: uncharacterized protein LOC103874239    124   1e-30   Brassica rapa
gb|KJB15175.1|  hypothetical protein B456_002G163500                    125   2e-30   Gossypium raimondii
ref|XP_009395181.1|  PREDICTED: uncharacterized protein LOC103980467    124   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB86633.1|  putative protein                                       124   2e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80382.1|  BnaC07g30620D                                          124   2e-30   
gb|EYU38200.1|  hypothetical protein MIMGU_mgv1a002994mg                124   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_008790705.1|  PREDICTED: uncharacterized protein LOC103707...    122   6e-30   Phoenix dactylifera
ref|XP_010097351.1|  hypothetical protein L484_010229                   124   6e-30   
ref|XP_011082849.1|  PREDICTED: uncharacterized protein LOC105165513    123   6e-30   Sesamum indicum [beniseed]
ref|XP_006413349.1|  hypothetical protein EUTSA_v10024690mg             123   6e-30   Eutrema salsugineum [saltwater cress]
ref|XP_006413348.1|  hypothetical protein EUTSA_v10024690mg             123   6e-30   
ref|XP_010438932.1|  PREDICTED: caldesmon-like                          123   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010448485.1|  PREDICTED: uncharacterized protein LOC104730...    123   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010448486.1|  PREDICTED: uncharacterized protein LOC104730...    123   9e-30   Camelina sativa [gold-of-pleasure]
gb|KCW61705.1|  hypothetical protein EUGRSUZ_H04425                     118   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010433693.1|  PREDICTED: uncharacterized protein LOC104717762    123   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011465885.1|  PREDICTED: coiled-coil domain-containing pro...    122   2e-29   Fragaria vesca subsp. vesca
dbj|BAJ95178.1|  predicted protein                                      122   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011465884.1|  PREDICTED: coiled-coil domain-containing pro...    122   2e-29   Fragaria vesca subsp. vesca
ref|XP_011465883.1|  PREDICTED: coiled-coil domain-containing pro...    122   2e-29   Fragaria vesca subsp. vesca
emb|CDY03383.1|  BnaC01g16990D                                          122   2e-29   
gb|KCW48522.1|  hypothetical protein EUGRSUZ_K02199                     120   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010237694.1|  PREDICTED: uncharacterized protein LOC100834...    122   2e-29   Brachypodium distachyon [annual false brome]
ref|XP_010237693.1|  PREDICTED: uncharacterized protein LOC100834...    122   2e-29   
emb|CDY34338.1|  BnaA01g14410D                                          122   3e-29   Brassica napus [oilseed rape]
ref|XP_009138807.1|  PREDICTED: triadin isoform X1                      122   3e-29   Brassica rapa
ref|XP_009138814.1|  PREDICTED: triadin isoform X2                      122   3e-29   Brassica rapa
ref|XP_007207715.1|  hypothetical protein PRUPE_ppa025957mg             121   4e-29   
ref|XP_008218218.1|  PREDICTED: uncharacterized protein LOC103318595    121   5e-29   
gb|EMT30590.1|  hypothetical protein F775_12884                         122   6e-29   
ref|XP_006382705.1|  hypothetical protein POPTR_0005s04600g             120   7e-29   
ref|XP_004980549.1|  PREDICTED: pre-mRNA-splicing factor CWC22 ho...    121   8e-29   
ref|XP_006283270.1|  hypothetical protein CARUB_v10004304mg             120   9e-29   
ref|XP_006663480.1|  PREDICTED: CAP-Gly domain-containing linker ...    120   9e-29   Oryza brachyantha
gb|KDP23593.1|  hypothetical protein JCGZ_23426                         121   1e-28   Jatropha curcas
emb|CDY64711.1|  BnaA06g38700D                                          116   1e-28   Brassica napus [oilseed rape]
ref|XP_006287432.1|  hypothetical protein CARUB_v10000636mg             119   1e-28   Capsella rubella
ref|XP_007030136.1|  Uncharacterized protein TCM_025951                 120   2e-28   
ref|XP_002869690.1|  expressed protein                                  120   2e-28   Arabidopsis lyrata subsp. lyrata
gb|KFK27654.1|  hypothetical protein AALP_AA8G411300                    119   2e-28   Arabis alpina [alpine rockcress]
ref|XP_002449559.1|  hypothetical protein SORBIDRAFT_05g019070          120   2e-28   Sorghum bicolor [broomcorn]
ref|XP_010025108.1|  PREDICTED: uncharacterized protein LOC104415...    119   2e-28   
ref|XP_010025107.1|  PREDICTED: uncharacterized protein LOC104415...    119   2e-28   
ref|XP_010025106.1|  PREDICTED: uncharacterized protein LOC104415...    119   2e-28   
ref|XP_010025105.1|  PREDICTED: uncharacterized protein LOC104415...    119   2e-28   Eucalyptus grandis [rose gum]
ref|NP_001119051.1|  uncharacterized protein                            120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194237.2|  uncharacterized protein                               120   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493493.1|  PREDICTED: uncharacterized protein LOC104770731    118   3e-28   
ref|XP_009615103.1|  PREDICTED: uncharacterized protein LOC104107890    114   4e-28   Nicotiana tomentosiformis
ref|XP_011032546.1|  PREDICTED: uncharacterized protein LOC105131319    119   5e-28   Populus euphratica
gb|ABA93965.1|  expressed protein                                       119   5e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KFK29000.1|  hypothetical protein AALP_AA7G076100                    118   5e-28   Arabis alpina [alpine rockcress]
gb|KFK29001.1|  hypothetical protein AALP_AA7G076100                    118   5e-28   Arabis alpina [alpine rockcress]
ref|XP_010421179.1|  PREDICTED: uncharacterized protein LOC104706668    117   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006404211.1|  hypothetical protein EUTSA_v10010238mg             117   6e-28   Eutrema salsugineum [saltwater cress]
ref|XP_009149792.1|  PREDICTED: uncharacterized protein LOC103873113    117   7e-28   Brassica rapa
ref|NP_001067981.2|  Os11g0520500                                       119   7e-28   
emb|CDY05877.1|  BnaC08g20540D                                          117   7e-28   
ref|XP_009772645.1|  PREDICTED: uncharacterized protein LOC104222...    118   8e-28   Nicotiana sylvestris
ref|XP_009342037.1|  PREDICTED: fas-binding factor 1-like               118   8e-28   
ref|XP_009595702.1|  PREDICTED: uncharacterized protein LOC104091958    110   9e-28   Nicotiana tomentosiformis
ref|XP_008388995.1|  PREDICTED: uncharacterized protein LOC103451360    117   1e-27   
ref|XP_010327287.1|  PREDICTED: uncharacterized protein LOC101260484    117   1e-27   Solanum lycopersicum
ref|XP_008370656.1|  PREDICTED: uncharacterized protein LOC103434129    110   1e-27   
ref|XP_006394633.1|  hypothetical protein EUTSA_v10003911mg             116   1e-27   
ref|XP_010454658.1|  PREDICTED: uncharacterized protein LOC104736385    116   2e-27   Camelina sativa [gold-of-pleasure]
emb|CDP18381.1|  unnamed protein product                                117   2e-27   Coffea canephora [robusta coffee]
ref|XP_008678157.1|  PREDICTED: protein SOGA3-like                      117   2e-27   Zea mays [maize]
ref|XP_009381579.1|  PREDICTED: uncharacterized protein LOC103969678    115   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009781778.1|  PREDICTED: uncharacterized protein LOC104230...    115   4e-27   Nicotiana sylvestris
gb|KFK34186.1|  hypothetical protein AALP_AA5G111700                    115   5e-27   Arabis alpina [alpine rockcress]
ref|XP_010039005.1|  PREDICTED: uncharacterized protein LOC104427641    114   5e-27   
ref|XP_006471854.1|  PREDICTED: golgin candidate 5-like                 116   5e-27   
emb|CAB36749.1|  putative protein                                       112   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AES82578.2|  ripening-regulated protein                              115   6e-27   Medicago truncatula
gb|KGN60847.1|  hypothetical protein Csa_2G013280                       115   6e-27   Cucumis sativus [cucumbers]
ref|XP_003626360.1|  hypothetical protein MTR_7g114220                  115   7e-27   
ref|XP_006368855.1|  hypothetical protein POPTR_0001s13160g             114   7e-27   
ref|XP_002872068.1|  hypothetical protein ARALYDRAFT_489231             114   7e-27   
ref|XP_004139373.1|  PREDICTED: uncharacterized protein LOC101217350    115   8e-27   
gb|KDO83175.1|  hypothetical protein CISIN_1g008906mg                   114   9e-27   Citrus sinensis [apfelsine]
ref|XP_006338920.1|  PREDICTED: mucin-17-like                           114   1e-26   
ref|XP_006292226.1|  hypothetical protein CARUB_v10018432mg             113   2e-26   Capsella rubella
ref|XP_010503527.1|  PREDICTED: uncharacterized protein LOC104780...    113   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010503528.1|  PREDICTED: uncharacterized protein LOC104780...    113   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010426384.1|  PREDICTED: uncharacterized protein LOC104711382    113   2e-26   Camelina sativa [gold-of-pleasure]
dbj|BAA97231.1|  unnamed protein product                                112   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455538.1|  PREDICTED: uncharacterized protein LOC103495...    113   3e-26   Cucumis melo [Oriental melon]
ref|XP_002875929.1|  hypothetical protein ARALYDRAFT_485239             112   3e-26   
ref|XP_006408121.1|  hypothetical protein EUTSA_v10020103mg             113   4e-26   
ref|NP_190455.2|  uncharacterized protein                               112   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464000.1|  PREDICTED: uncharacterized protein LOC104744625    113   6e-26   Camelina sativa [gold-of-pleasure]
ref|NP_197759.3|  uncharacterized protein                               111   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485897.1|  PREDICTED: uncharacterized protein LOC104764...    112   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010485896.1|  PREDICTED: uncharacterized protein LOC104764...    112   1e-25   
ref|XP_010421675.1|  PREDICTED: uncharacterized protein LOC104707...    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010421737.1|  PREDICTED: uncharacterized protein LOC104707...    112   2e-25   Camelina sativa [gold-of-pleasure]
gb|EPS68720.1|  hypothetical protein M569_06050                         110   3e-25   Genlisea aurea
emb|CDY41922.1|  BnaC05g46820D                                          111   3e-25   Brassica napus [oilseed rape]
emb|CDY27806.1|  BnaA05g32150D                                          111   3e-25   Brassica napus [oilseed rape]
ref|XP_009147293.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    111   3e-25   
gb|EEE52188.1|  hypothetical protein OsJ_34062                          110   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68259.1|  hypothetical protein OsI_36288                          110   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010515221.1|  PREDICTED: uncharacterized protein LOC104791110    109   5e-25   Camelina sativa [gold-of-pleasure]
gb|AAB81875.2|  hypothetical protein                                    110   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192603.2|  uncharacterized protein                               110   6e-25   
ref|XP_006300090.1|  hypothetical protein CARUB_v10016318mg             110   7e-25   
ref|XP_007147111.1|  hypothetical protein PHAVU_006G096900g             104   1e-24   Phaseolus vulgaris [French bean]
ref|XP_002884485.1|  hypothetical protein ARALYDRAFT_340666             108   3e-24   
ref|XP_001774305.1|  predicted protein                                  107   4e-24   
ref|XP_001777692.1|  predicted protein                                  104   6e-24   
ref|XP_008662961.1|  PREDICTED: uncharacterized protein LOC103641...    105   1e-23   
ref|XP_008662960.1|  PREDICTED: uncharacterized protein LOC103641...    105   1e-23   
ref|XP_009623175.1|  PREDICTED: uncharacterized protein LOC104114...    103   1e-23   
gb|KJB44659.1|  hypothetical protein B456_007G263800                    105   2e-23   
gb|KJB44660.1|  hypothetical protein B456_007G263800                    105   2e-23   
ref|XP_010675034.1|  PREDICTED: uncharacterized protein LOC104891083    105   3e-23   
ref|XP_009623174.1|  PREDICTED: uncharacterized protein LOC104114...    104   4e-23   
ref|XP_006577742.1|  PREDICTED: uncharacterized protein LOC102666442    101   7e-23   
ref|XP_001774286.1|  predicted protein                                  103   7e-23   
gb|KHN43239.1|  hypothetical protein glysoja_001822                     103   1e-22   
gb|KHN04038.1|  hypothetical protein glysoja_022724                     102   1e-22   
ref|XP_006605263.1|  PREDICTED: uncharacterized protein LOC100819816    103   1e-22   
ref|XP_010524892.1|  PREDICTED: uncharacterized protein LOC104802...    103   2e-22   
ref|XP_010524893.1|  PREDICTED: uncharacterized protein LOC104802...    103   2e-22   
gb|KDO42712.1|  hypothetical protein CISIN_1g0362271mg                  101   6e-22   
ref|XP_010546640.1|  PREDICTED: uncharacterized protein LOC104818...  99.8    3e-21   
ref|XP_010546642.1|  PREDICTED: uncharacterized protein LOC104818...  99.8    3e-21   
gb|EEE62332.1|  hypothetical protein OsJ_17121                        95.9    9e-21   
ref|XP_006433124.1|  hypothetical protein CICLE_v100035141mg          90.5    2e-20   
ref|XP_010231707.1|  PREDICTED: uncharacterized protein LOC100835935  96.7    2e-20   
emb|CAB87914.1|  putative protein                                     95.5    6e-20   
gb|AFW57616.1|  hypothetical protein ZEAMMB73_774231                  86.7    5e-19   
ref|XP_010545938.1|  PREDICTED: plectin-like isoform X4               90.5    1e-18   
gb|EEC78518.1|  hypothetical protein OsI_18458                        87.0    2e-17   
ref|XP_004165994.1|  PREDICTED: uncharacterized protein LOC101231489  81.3    7e-15   
ref|XP_003063871.1|  predicted protein                                75.5    6e-13   
emb|CDX68503.1|  BnaC01g25810D                                        69.7    9e-13   
ref|XP_004963416.1|  PREDICTED: uncharacterized protein LOC101763367  72.8    6e-12   
dbj|BAK04121.1|  predicted protein                                    70.5    1e-11   
ref|XP_010546643.1|  PREDICTED: uncharacterized protein LOC104818...  67.4    5e-10   
ref|XP_002512652.1|  conserved hypothetical protein                   61.6    3e-08   
ref|NP_001054649.1|  Os05g0148500                                     60.8    5e-08   
ref|XP_007043823.1|  Uncharacterized protein isoform 2                59.7    1e-07   
ref|XP_002505829.1|  predicted protein                                55.5    3e-06   
gb|KIY99844.1|  hypothetical protein MNEG_8115                        54.3    6e-06   
ref|XP_001703560.1|  predicted protein                                52.8    1e-05   
emb|CEG01980.1|  unnamed product                                      48.1    5e-04   
ref|XP_003082852.1|  unnamed protein product                          48.1    6e-04   
ref|XP_001422651.1|  predicted protein                                47.8    8e-04   



>ref|XP_011086869.1| PREDICTED: uncharacterized protein LOC105168472 [Sesamum indicum]
Length=557

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEEEIANK+L+FWI RS +SPTSH
Sbjct  455  DPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAYGIEEEIANKRLKFWISRSGQSPTSH  514

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            DAVDVEQGLMELRKL IEHRLWEASRKE DQD SL+ 
Sbjct  515  DAVDVEQGLMELRKLEIEHRLWEASRKEIDQDDSLLN  551



>gb|EYU37358.1| hypothetical protein MIMGU_mgv1a004629mg [Erythranthe guttata]
Length=517

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWL YFWRRAKA GIEEEIAN++L+FWIGRS +SPTSH
Sbjct  420  DPKYMEAFELSPEESEDVLFKEAWLMYFWRRAKAYGIEEEIANERLKFWIGRSGQSPTSH  479

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            DAVDVEQGLME+RKLGI+ RLWEASRKE +QD+SL+ 
Sbjct  480  DAVDVEQGLMEIRKLGIKQRLWEASRKEIEQDTSLLN  516



>ref|XP_010100043.1| hypothetical protein L484_013155 [Morus notabilis]
 gb|EXB81214.1| hypothetical protein L484_013155 [Morus notabilis]
Length=138

 Score =   162 bits (410),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRA+  G+EE+IA ++LQFWI RSA SPTSH
Sbjct  35   DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAQVNGLEEDIAKERLQFWINRSAHSPTSH  94

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPPH  105
            DAVDVEQGLMELRK GIEHRLWEASRKE D +SS       P H
Sbjct  95   DAVDVEQGLMELRKYGIEHRLWEASRKEIDHESSPSNARKSPAH  138



>ref|XP_003536819.1| PREDICTED: myosin heavy chain, skeletal muscle-like [Glycine 
max]
 gb|KHN37247.1| hypothetical protein glysoja_013462 [Glycine soja]
Length=529

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEEEIA ++L+FWI RS  SPTSH
Sbjct  430  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEEIAEERLRFWISRSGHSPTSH  489

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVDVEQGL ELRKLGIEHRLWEASRKE DQDS++  K
Sbjct  490  DAVDVEQGLSELRKLGIEHRLWEASRKEVDQDSTIARK  527



>gb|KHN27159.1| hypothetical protein glysoja_032927 [Glycine soja]
Length=372

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++L+FWIGRS  SPTSH
Sbjct  272  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLRFWIGRSGHSPTSH  331

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVD EQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  332  DAVDAEQGLSELRKLGIEHRLWEASRKEVDQDFTIARK  369



>ref|XP_007142592.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
 gb|ESW14586.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
Length=428

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLT+FWRRAK  GIEE+IA ++LQFWIGRS  SPTSH
Sbjct  327  DPKFMEAFELSPEESEDVLFKEAWLTFFWRRAKVHGIEEDIAKERLQFWIGRSGHSPTSH  386

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVDVEQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  387  DAVDVEQGLSELRKLGIEHRLWEASRKEVDQDLTIARK  424



>ref|XP_004310133.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=554

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE IA +++QFWI RS  +P+SH
Sbjct  455  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEENIAKERVQFWINRSGHAPSSH  514

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDVE+GLMELRKLGIEHRLWE SRK  DQDSS +
Sbjct  515  DAVDVEEGLMELRKLGIEHRLWEESRKTIDQDSSTV  550



>ref|XP_007142591.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
 gb|ESW14585.1| hypothetical protein PHAVU_007G000500g [Phaseolus vulgaris]
Length=540

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLT+FWRRAK  GIEE+IA ++LQFWIGRS  SPTSH
Sbjct  439  DPKFMEAFELSPEESEDVLFKEAWLTFFWRRAKVHGIEEDIAKERLQFWIGRSGHSPTSH  498

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVDVEQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  499  DAVDVEQGLSELRKLGIEHRLWEASRKEVDQDLTIARK  536



>ref|XP_002297871.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
 gb|EEE82676.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
Length=539

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RSA SP+SH
Sbjct  447  DPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSAHSPSSH  506

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVEQGLMELRKLGIEHRLWEASRKE DQDS
Sbjct  507  DAVDVEQGLMELRKLGIEHRLWEASRKEIDQDS  539



>ref|XP_003556588.1| PREDICTED: protein anoxia up-regulated-like isoform X1 [Glycine 
max]
Length=527

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++L+FWIGRS  SPTSH
Sbjct  427  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLRFWIGRSGHSPTSH  486

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVD EQGL ELRKLGIEHRLWEASRKE DQD ++  K
Sbjct  487  DAVDAEQGLSELRKLGIEHRLWEASRKEVDQDFTIARK  524



>ref|XP_007222390.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
 gb|EMJ23589.1| hypothetical protein PRUPE_ppa004878mg [Prunus persica]
Length=487

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK  GIEEEIA +++QFWI RS  SPTSH
Sbjct  384  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVHGIEEEIAKERVQFWINRSRHSPTSH  443

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GLMELRKLGIEHRLWE SRK  DQD S
Sbjct  444  DAVDVEEGLMELRKLGIEHRLWEESRKAIDQDPS  477



>ref|XP_008222369.1| PREDICTED: uncharacterized protein LOC103322249 [Prunus mume]
Length=563

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK  GIEEEIA +++QFWI RS  SPTSH
Sbjct  460  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVHGIEEEIAKERVQFWINRSRHSPTSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GLMELRKLGIEHRLWE SRK  DQD S+
Sbjct  520  DAVDVEEGLMELRKLGIEHRLWEESRKAIDQDPSM  554



>emb|CDP18972.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 84/97 (87%), Gaps = 2/97 (2%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEEEIANK++QFWI RS  SPTSH
Sbjct  88   DPKFTEASELSPEESEDVLFKEAWLTYFWRRAKSHGIEEEIANKRVQFWISRSVHSPTSH  147

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD--QDSSL  132
            D VDVEQGLMELRKL IE RLWEASRKE D  Q SSL
Sbjct  148  DVVDVEQGLMELRKLDIEQRLWEASRKEIDHNQPSSL  184



>ref|XP_011020859.1| PREDICTED: uncharacterized protein LOC105123085 [Populus euphratica]
Length=559

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWLTYFWRRA+A GIEE+ A ++LQFWI RS  SP+SH
Sbjct  467  DPKYMEAFELSPEESEDVLFKEAWLTYFWRRAEAHGIEEDTAKERLQFWISRSVHSPSSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVEQGLMELRKLGIEHRLWEASRKE DQ S
Sbjct  527  DAVDVEQGLMELRKLGIEHRLWEASRKEIDQGS  559



>ref|XP_007043822.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99653.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=567

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE++ A ++L+FWI RS  SP+SH
Sbjct  467  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEDDTAKERLKFWISRSGHSPSSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVDVE+GLMELRKLGIEHRLWEASRKE DQD+S   K
Sbjct  527  DAVDVEEGLMELRKLGIEHRLWEASRKEIDQDNSTSKK  564



>emb|CAN81746.1| hypothetical protein VITISV_038195 [Vitis vinifera]
Length=516

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RS  +PTSH
Sbjct  413  DPKYMEAFELSTEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSGHAPTSH  472

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVEQGLMELRKLGIEH LWEASRKE D+DSS
Sbjct  473  DAVDVEQGLMELRKLGIEHWLWEASRKEIDEDSS  506



>ref|XP_010066446.1| PREDICTED: dynactin subunit 1 isoform X3 [Eucalyptus grandis]
Length=516

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTSH
Sbjct  426  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTSH  485

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  486  DAVDVEQGLMELRKLGIEHRLWEASRKET  514



>ref|XP_002267942.2| PREDICTED: uncharacterized protein LOC100260846 [Vitis vinifera]
 emb|CBI35662.3| unnamed protein product [Vitis vinifera]
Length=553

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RS  +PTSH
Sbjct  451  DPKYMEAFELSTEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSGHAPTSH  510

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVEQGLMELRKLGIEH LWEASRKE D+DSS
Sbjct  511  DAVDVEQGLMELRKLGIEHWLWEASRKEIDEDSS  544



>ref|XP_011036158.1| PREDICTED: uncharacterized protein LOC105133757 [Populus euphratica]
Length=558

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RS  SP+SH
Sbjct  466  DPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSVHSPSSH  525

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVEQGL ELRKLGIEHRLWEASRKE DQDS
Sbjct  526  DAVDVEQGLTELRKLGIEHRLWEASRKEIDQDS  558



>ref|XP_010066445.1| PREDICTED: uncharacterized protein LOC104453551 isoform X2 [Eucalyptus 
grandis]
Length=554

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTSH
Sbjct  464  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTSH  523

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  524  DAVDVEQGLMELRKLGIEHRLWEASRKET  552



>ref|XP_010066444.1| PREDICTED: uncharacterized protein LOC104453551 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64333.1| hypothetical protein EUGRSUZ_G01963 [Eucalyptus grandis]
Length=555

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTSH
Sbjct  465  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTSH  524

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  525  DAVDVEQGLMELRKLGIEHRLWEASRKET  553



>ref|XP_004497432.1| PREDICTED: uncharacterized protein LOC101507286 isoform X2 [Cicer 
arietinum]
Length=533

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++ QFWIGRS  SPTSH
Sbjct  438  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERFQFWIGRSGHSPTSH  497

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            DAVDVEQGL ELRKLG+E RLWE SRKE DQD
Sbjct  498  DAVDVEQGLSELRKLGVERRLWEESRKEVDQD  529



>ref|XP_004497431.1| PREDICTED: uncharacterized protein LOC101507286 isoform X1 [Cicer 
arietinum]
Length=534

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++ QFWIGRS  SPTSH
Sbjct  439  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERFQFWIGRSGHSPTSH  498

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            DAVDVEQGL ELRKLG+E RLWE SRKE DQD
Sbjct  499  DAVDVEQGLSELRKLGVERRLWEESRKEVDQD  530



>gb|KCW64334.1| hypothetical protein EUGRSUZ_G01963 [Eucalyptus grandis]
Length=537

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIE E A ++LQFWI RSA SPTSH
Sbjct  447  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEVETAKERLQFWINRSAHSPTSH  506

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGLMELRKLGIEHRLWEASRKET
Sbjct  507  DAVDVEQGLMELRKLGIEHRLWEASRKET  535



>gb|KDP23274.1| hypothetical protein JCGZ_23107 [Jatropha curcas]
Length=572

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA+ELSPEESEDVLFKEAWLTYFW  AKA GIEE+IA ++LQFWI R   SP+SH
Sbjct  463  DPKYMEAVELSPEESEDVLFKEAWLTYFWSTAKANGIEEDIAKERLQFWINRRGHSPSSH  522

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDV+QGL+ELRKLGIEHRLWEASR++ DQDSS
Sbjct  523  DAVDVDQGLVELRKLGIEHRLWEASRRDIDQDSS  556



>ref|XP_002304646.2| hypothetical protein POPTR_0003s16260g [Populus trichocarpa]
 gb|EEE79625.2| hypothetical protein POPTR_0003s16260g [Populus trichocarpa]
Length=553

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++LQFWI RSA SP+SH
Sbjct  461  DQKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERLQFWISRSAHSPSSH  520

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVEQGL ELRKLGIEHRLWEASRKE DQ S
Sbjct  521  DAVDVEQGLTELRKLGIEHRLWEASRKEIDQGS  553



>ref|XP_008390187.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103452479 
[Malus domestica]
Length=563

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +P+SH
Sbjct  460  DPKFTEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSGHAPSSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GLMELRKLGIE RLWE SRK  DQDSS+
Sbjct  520  DAVDVEEGLMELRKLGIESRLWEESRKAIDQDSSV  554



>ref|XP_009378816.1| PREDICTED: uncharacterized protein LOC103967265 [Pyrus x bretschneideri]
Length=562

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +P+SH
Sbjct  459  DPKFTEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSGHAPSSH  518

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GLMELRKLGIE RLWE SRK  DQDSS+
Sbjct  519  DAVDVEEGLMELRKLGIESRLWEESRKAIDQDSSV  553



>ref|XP_009359892.1| PREDICTED: uncharacterized protein LOC103950414 isoform X2 [Pyrus 
x bretschneideri]
Length=479

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +PTSH
Sbjct  375  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSRHAPTSH  434

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  435  DAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  468



>gb|KDO83180.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=351

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  264  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  323

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  324  DAVDVEQGLMELRKLGIEHRLWEASRR  350



>ref|XP_009359891.1| PREDICTED: uncharacterized protein LOC103950414 isoform X1 [Pyrus 
x bretschneideri]
Length=563

 Score =   161 bits (407),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI RS  +PTSH
Sbjct  459  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRSRHAPTSH  518

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  519  DAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  552



>ref|XP_008459909.1| PREDICTED: uncharacterized protein LOC103498889 [Cucumis melo]
Length=541

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+SH
Sbjct  452  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPSSH  511

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGL+ELRKLGIE R+WEASRKE+
Sbjct  512  DAVDVEQGLVELRKLGIERRMWEASRKES  540



>ref|XP_008369644.1| PREDICTED: uncharacterized protein LOC103433181 [Malus domestica]
Length=563

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEAIELSPEESEDVLFKEAWLTYFWRRAK LGIEE+IA +++QFWI R   +PTSH
Sbjct  459  DPKFMEAIELSPEESEDVLFKEAWLTYFWRRAKVLGIEEDIAKERVQFWINRGRHAPTSH  518

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GLMELRKLGIE RLWE SRK  DQ+ S
Sbjct  519  DAVDVEEGLMELRKLGIESRLWEESRKAIDQEYS  552



>ref|XP_006483009.1| PREDICTED: myosin-9-like isoform X3 [Citrus sinensis]
Length=472

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  385  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  444

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  445  DAVDVEQGLMELRKLGIEHRLWEASRR  471



>gb|KDO83179.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=472

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  385  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  444

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  445  DAVDVEQGLMELRKLGIEHRLWEASRR  471



>ref|XP_006483008.1| PREDICTED: myosin-9-like isoform X2 [Citrus sinensis]
Length=543

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  456  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  516  DAVDVEQGLMELRKLGIEHRLWEASRR  542



>gb|AFK47824.1| unknown [Lotus japonicus]
Length=228

 Score =   152 bits (383),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -2

Query  398  AIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVE  219
            A ELSPEESEDVLFKEAWLTYFWRRAKA  IEE+IA  +L FWIGRS  SPTSHDAVDVE
Sbjct  134  ASELSPEESEDVLFKEAWLTYFWRRAKAHSIEEDIAKDRLHFWIGRSGHSPTSHDAVDVE  193

Query  218  QGLMELRKLGIEHRLWEASRKETDQDSSL  132
            QGL ELRKLGIEHRLWEASRKE DQD ++
Sbjct  194  QGLSELRKLGIEHRLWEASRKEVDQDHTI  222



>gb|KDO83174.1| hypothetical protein CISIN_1g008906mg [Citrus sinensis]
Length=547

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  460  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  520  DAVDVEQGLMELRKLGIEHRLWEASRR  546



>ref|XP_006483007.1| PREDICTED: myosin-9-like isoform X1 [Citrus sinensis]
Length=547

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  460  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  520  DAVDVEQGLMELRKLGIEHRLWEASRR  546



>ref|XP_006438862.1| hypothetical protein CICLE_v10031153mg [Citrus clementina]
 gb|ESR52102.1| hypothetical protein CICLE_v10031153mg [Citrus clementina]
Length=547

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE IA ++L+FWI RS  SP+SH
Sbjct  460  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEHIAKERLEFWISRSGHSPSSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIEHRLWEASR+
Sbjct  520  DAVDVEQGLMELRKLGIEHRLWEASRR  546



>gb|KGN46417.1| hypothetical protein Csa_6G091900 [Cucumis sativus]
Length=541

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+SH
Sbjct  452  DPKFMEAFELSAEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPSSH  511

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGL+ELRKLGIE R+WEASRKE+
Sbjct  512  DAVDVEQGLIELRKLGIERRMWEASRKES  540



>ref|XP_004140652.1| PREDICTED: uncharacterized protein LOC101205430 [Cucumis sativus]
Length=535

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+SH
Sbjct  446  DPKFMEAFELSAEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPSSH  505

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKET  150
            DAVDVEQGL+ELRKLGIE R+WEASRKE+
Sbjct  506  DAVDVEQGLIELRKLGIERRMWEASRKES  534



>ref|XP_004239298.1| PREDICTED: uncharacterized protein LOC101253187 [Solanum lycopersicum]
Length=551

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+EE ANK+LQFW  RS  SPTSH
Sbjct  465  DPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEEKANKRLQFWSSRSGHSPTSH  524

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKL IE +LWE+SR+
Sbjct  525  DAVDVEQGLMELRKLAIEQKLWESSRR  551



>ref|XP_006343189.1| PREDICTED: uncharacterized protein LOC102581164 [Solanum tuberosum]
Length=551

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+EE ANK+LQFW  RS  SPTSH
Sbjct  465  DPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEEKANKRLQFWSSRSGHSPTSH  524

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKL IE +LWE+SR+
Sbjct  525  DAVDVEQGLMELRKLAIEQKLWESSRR  551



>ref|XP_009597749.1| PREDICTED: uncharacterized protein LOC104093670 isoform X2 [Nicotiana 
tomentosiformis]
Length=553

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK+LQFW  RS  +PTSH
Sbjct  467  DPKYMEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKRLQFWSSRSGHAPTSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  527  DAVDVEQGLMELRKLGIEQKLWESSRR  553



>ref|XP_010249187.1| PREDICTED: uncharacterized protein LOC104591834 [Nelumbo nucifera]
Length=561

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+MEA ELS EESEDVLFKEAWLTYFWRRAKA G+EE+IA ++L+FWI RS +SPTSHD
Sbjct  454  PKFMEAFELSQEESEDVLFKEAWLTYFWRRAKAHGVEEDIAEERLRFWISRSGQSPTSHD  513

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            AVDVE+GLMELRKLGIE +LWEASRKE DQ S+
Sbjct  514  AVDVERGLMELRKLGIEQQLWEASRKEIDQASA  546



>ref|XP_004170125.1| PREDICTED: uncharacterized LOC101205430 [Cucumis sativus]
Length=86

 Score =   144 bits (364),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            MEA ELS EESEDVLFKEAWLTYFWRRAKA GIEE+IA ++LQFWI RSA SP+SHDAVD
Sbjct  1    MEAFELSAEESEDVLFKEAWLTYFWRRAKAHGIEEDIAKERLQFWISRSAHSPSSHDAVD  60

Query  224  VEQGLMELRKLGIEHRLWEASRKET  150
            VEQGL+ELRKLGIE R+WEASRKE+
Sbjct  61   VEQGLIELRKLGIERRMWEASRKES  85



>ref|XP_011073178.1| PREDICTED: macoilin-1 [Sesamum indicum]
 ref|XP_011073180.1| PREDICTED: macoilin-1 [Sesamum indicum]
Length=562

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 2/103 (2%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKYMEA ELS EESEDVLFKEAWLTYFWRRAK  G+EE+IA+++LQ WI RS +SPTSH
Sbjct  457  DPKYMEAFELSQEESEDVLFKEAWLTYFWRRAKVHGVEEDIADERLQLWISRSGQSPTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  108
            DAVDVE+GL ELRKLGIE +LWEASRKE  Q +   GK  H P
Sbjct  517  DAVDVERGLTELRKLGIEQQLWEASRKEIGQPAFANGK--HTP  557



>ref|XP_010682658.1| PREDICTED: uncharacterized protein LOC104897472 [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KYMEA EL+PEESEDVLFKEAWLTYFWRRA  +GIE++ A ++LQFWIGRS  SPTSH
Sbjct  503  DAKYMEAFELTPEESEDVLFKEAWLTYFWRRALNVGIEKDTAKERLQFWIGRSRHSPTSH  562

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDV+QGL ELRKLGIE RLWEASR+E D
Sbjct  563  DAVDVDQGLTELRKLGIERRLWEASRREND  592



>ref|XP_009781777.1| PREDICTED: uncharacterized protein LOC104230617 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY+EA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK  QFW  RS  +PTSH
Sbjct  471  DPKYIEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKNFQFWSSRSGHAPTSH  530

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  531  DAVDVEQGLMELRKLGIEQKLWESSRR  557



>ref|XP_006844529.1| hypothetical protein AMTR_s00016p00160930 [Amborella trichopoda]
 gb|ERN06204.1| hypothetical protein AMTR_s00016p00160930 [Amborella trichopoda]
Length=566

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS EE EDVLFK+AWLTYFWRRAK  G+EE+IA+ +LQFWI RS++SPTSH
Sbjct  457  DPKFVEAFELSQEEVEDVLFKQAWLTYFWRRAKTHGVEEDIADDRLQFWISRSSQSPTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GLMELRKLG+E +LWEASRKE DQ  +
Sbjct  517  DAVDVERGLMELRKLGLEAQLWEASRKEIDQSGA  550



>gb|KHG28186.1| atg11 [Gossypium arboreum]
Length=631

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEE+ A  +L+FWI RS  SP+SH
Sbjct  544  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKSHGIEEDTAKDRLKFWISRSVHSPSSH  603

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  604  DAVDVEEGLMELRKLGIERRLWEASRR  630



>ref|XP_008440074.1| PREDICTED: macoilin-1 [Cucumis melo]
 ref|XP_008440082.1| PREDICTED: macoilin-1 [Cucumis melo]
Length=558

 Score =   150 bits (379),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS  E+EDVLFKEAWLTYFWRRAKA G++E++A+++LQFWI RS + PTSH
Sbjct  449  DPKFSEAFELSEAEAEDVLFKEAWLTYFWRRAKAYGVDEDVADERLQFWISRSGQPPTSH  508

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GL+ELRKLGIE +LWEASRKE DQ S+ 
Sbjct  509  DAVDVERGLVELRKLGIEQQLWEASRKEIDQSSAF  543



>ref|XP_006485111.1| PREDICTED: dynactin subunit 1-like isoform X2 [Citrus sinensis]
Length=422

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  313  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  372

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  373  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  406



>gb|KDO51298.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=422

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  313  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  372

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  373  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  406



>ref|XP_004145144.1| PREDICTED: uncharacterized protein LOC101221393 [Cucumis sativus]
 ref|XP_004154004.1| PREDICTED: uncharacterized protein LOC101206186 [Cucumis sativus]
 ref|XP_004166344.1| PREDICTED: uncharacterized LOC101206186 [Cucumis sativus]
 gb|KGN64438.1| hypothetical protein Csa_1G051750 [Cucumis sativus]
Length=551

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS  E+EDVLFKEAWLTYFWRRAKA G++E++A+++LQFWI RS + PTSH
Sbjct  451  DPKFSEAFELSEAEAEDVLFKEAWLTYFWRRAKAYGVDEDVADERLQFWISRSGQPPTSH  510

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASRKE DQ S+
Sbjct  511  DAVDVERGLVELRKLGIEQQLWEASRKEIDQSSA  544



>gb|KHG28185.1| atg11 [Gossypium arboreum]
Length=656

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTYFWRRAK+ GIEE+ A  +L+FWI RS  SP+SH
Sbjct  569  DPKFMEAFELSPEESEDVLFKEAWLTYFWRRAKSHGIEEDTAKDRLKFWISRSVHSPSSH  628

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  629  DAVDVEEGLMELRKLGIERRLWEASRR  655



>gb|KJB15173.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=400

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+SH
Sbjct  313  DPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPSSH  372

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  373  DAVDVEEGLMELRKLGIERRLWEASRR  399



>ref|XP_009767496.1| PREDICTED: uncharacterized protein LOC104218653 isoform X2 [Nicotiana 
sylvestris]
Length=440

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+H
Sbjct  334  DPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKMHCVEEDIAEERLQFWINRSGQTPTTH  393

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            D+VDVE+GL+ELRKLGIE +LWEASRKE DQ S   GK
Sbjct  394  DSVDVERGLIELRKLGIEQQLWEASRKEIDQPSVTNGK  431



>gb|KDO51296.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=569

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  460  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  520  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  553



>ref|XP_006485110.1| PREDICTED: dynactin subunit 1-like isoform X1 [Citrus sinensis]
Length=569

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  460  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  520  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  553



>gb|KDO51297.1| hypothetical protein CISIN_1g008306mg [Citrus sinensis]
Length=570

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  461  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  520

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  521  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  554



>ref|XP_006436938.1| hypothetical protein CICLE_v10031078mg [Citrus clementina]
 gb|ESR50178.1| hypothetical protein CICLE_v10031078mg [Citrus clementina]
Length=574

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS +E+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  465  DPKFIEAFELSEDEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQSPTSH  524

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR+E D  SS
Sbjct  525  DAVDVERGLLELRKLGIEQQLWEASRREIDFPSS  558



>gb|KJB15171.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=553

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+SH
Sbjct  466  DPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPSSH  525

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  526  DAVDVEEGLMELRKLGIERRLWEASRR  552



>ref|XP_009767495.1| PREDICTED: uncharacterized protein LOC104218653 isoform X1 [Nicotiana 
sylvestris]
Length=568

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK M+A ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQFWI RS ++PT+H
Sbjct  462  DPKLMDAYELSQEESEDVLFKEAWLTYFWRRAKMHCVEEDIAEERLQFWINRSGQTPTTH  521

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            D+VDVE+GL+ELRKLGIE +LWEASRKE DQ S   GK
Sbjct  522  DSVDVERGLIELRKLGIEQQLWEASRKEIDQPSVTNGK  559



>emb|CBI15742.3| unnamed protein product [Vitis vinifera]
Length=551

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTSH
Sbjct  432  DPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTSH  491

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  492  DAVDVERGLRELRKLGIEQQLWEASRKENDQPS  524



>ref|XP_002284492.1| PREDICTED: uncharacterized protein LOC100256039 [Vitis vinifera]
Length=571

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTSH
Sbjct  452  DPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTSH  511

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  512  DAVDVERGLRELRKLGIEQQLWEASRKENDQPS  544



>emb|CAN81274.1| hypothetical protein VITISV_021176 [Vitis vinifera]
Length=582

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ME+ EL+ EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI RS ++PTSH
Sbjct  463  DPKSMESFELNQEEAEDVLFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISRSGQTPTSH  522

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ S
Sbjct  523  DAVDVERGLRELRKLGIEQQLWEASRKENDQPS  555



>ref|XP_006341491.1| PREDICTED: uncharacterized protein LOC102585005 isoform X2 [Solanum 
tuberosum]
Length=439

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS +SPT+H
Sbjct  335  DPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQSPTTH  394

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASRKE DQ ++
Sbjct  395  DAVDVERGLIELRKLGIEQQLWEASRKEIDQPNN  428



>ref|XP_006341490.1| PREDICTED: uncharacterized protein LOC102585005 isoform X1 [Solanum 
tuberosum]
Length=566

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS +SPT+H
Sbjct  462  DPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQSPTTH  521

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASRKE DQ ++
Sbjct  522  DAVDVERGLIELRKLGIEQQLWEASRKEIDQPNN  555



>gb|EYU21825.1| hypothetical protein MIMGU_mgv1a021335mg, partial [Erythranthe 
guttata]
Length=319

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY EA ELS EESEDVLFKEAWLTYFWRRAK   +EE+IA+++LQ W  RS +SPTSH
Sbjct  215  DPKYTEAFELSQEESEDVLFKEAWLTYFWRRAKVHSVEEDIADERLQLWKSRSGQSPTSH  274

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK  123
            DAVDVE+GL ELRKLGIE +LW+ASRKE    S   GK
Sbjct  275  DAVDVERGLTELRKLGIEQQLWDASRKEIGHPSFANGK  312



>ref|XP_007038109.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY22610.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=421

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  311  DPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTSH  370

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  371  DAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  406



>ref|XP_010099602.1| hypothetical protein L484_004034 [Morus notabilis]
 gb|EXB79996.1| hypothetical protein L484_004034 [Morus notabilis]
Length=496

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA ELS EE+EDVLFKEAWLTYFWRRAK  G+EE+IA ++LQFWI R  +SPTSH
Sbjct  390  EPKFLEAFELSEEEAEDVLFKEAWLTYFWRRAKEHGVEEDIAEERLQFWISRIGQSPTSH  449

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVE+GL+ELRKLGIE +LWEASRKE D
Sbjct  450  DAVDVERGLLELRKLGIEQQLWEASRKEID  479



>ref|XP_010026209.1| PREDICTED: dynactin subunit 1-like [Eucalyptus grandis]
 gb|KCW83117.1| hypothetical protein EUGRSUZ_B00074 [Eucalyptus grandis]
Length=562

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SPTS 
Sbjct  452  DPKFIEAYELSDEEAEDVLFKEAWLTYFWRRALTHCVEEDIAEERLQFWISRSGQSPTSQ  511

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GL+ELRKLGIE +LWEASRKE D  SSL
Sbjct  512  DAVDVERGLLELRKLGIEQQLWEASRKEIDNPSSL  546



>ref|XP_007038108.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY22609.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=515

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  410  DPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTSH  469

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  470  DAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  505



>emb|CDO98314.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            KYME  ELS EES+DVLFKEAWL YFWRRAK  G+EE+IA+++LQFWI RSA+SPTSHDA
Sbjct  467  KYMEPFELSQEESQDVLFKEAWLAYFWRRAKDHGVEEDIADERLQFWISRSAQSPTSHDA  526

Query  230  VDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VDVE+GL ELRKLGIE +LWEASR+E +Q S
Sbjct  527  VDVERGLTELRKLGIEQQLWEASRRELEQQS  557



>ref|XP_007038107.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY22608.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=561

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTY WRRAK  G+EE+IA ++LQFWI RS +SPTSH
Sbjct  451  DPKLIDAFELSEEEGEDVLFKEAWLTYLWRRAKVHGVEEDIAEERLQFWIRRSGQSPTSH  510

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDV +GL ELRKLGIE +LWEASRKE DQ S+ +
Sbjct  511  DAVDVNRGLFELRKLGIEQQLWEASRKEIDQPSAAL  546



>gb|KJB40055.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=364

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTSH
Sbjct  258  DPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTSH  317

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  318  DAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  351



>ref|XP_006646640.1| PREDICTED: ELKS/Rab6-interacting/CAST family member 1-like [Oryza 
brachyantha]
Length=492

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A++P SH
Sbjct  394  EPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAQAPNSH  453

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DA+DVE+GL ELRKLGIE +LWE SR + DQDSS I
Sbjct  454  DAIDVERGLTELRKLGIEQQLWEGSRADIDQDSSAI  489



>ref|XP_009597748.1| PREDICTED: uncharacterized protein LOC104093670 isoform X1 [Nicotiana 
tomentosiformis]
Length=571

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 79/105 (75%), Gaps = 18/105 (17%)
 Frame = -2

Query  416  DPKYMEAI------------------ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIA  291
            DPKYMEA                   ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ A
Sbjct  467  DPKYMEAFAFWNPFWREYYVKFSLFSELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKA  526

Query  290  NKQLQFWIGRSAESPTSHDAVDVEQGLMELRKLGIEHRLWEASRK  156
            NK+LQFW  RS  +PTSHDAVDVEQGLMELRKLGIE +LWE+SR+
Sbjct  527  NKRLQFWSSRSGHAPTSHDAVDVEQGLMELRKLGIEQKLWESSRR  571



>ref|XP_004971152.1| PREDICTED: uncharacterized protein LOC101760852 [Setaria italica]
Length=560

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQFWIGR+A++P SH
Sbjct  463  EPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQFWIGRNAQAPNSH  522

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  523  DAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  555



>ref|XP_002511106.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51708.1| conserved hypothetical protein [Ricinus communis]
Length=555

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS EE+EDV+FKEAWLTYFWRRAK   +E++IA ++LQFWI RS +SPTSH
Sbjct  447  DPKFTEAFELSEEEAEDVIFKEAWLTYFWRRAKMHAVEDDIAEERLQFWISRSRQSPTSH  506

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKL IE +LWEASR+E DQ +S
Sbjct  507  DAVDVERGLLELRKLSIEQQLWEASRREIDQPTS  540



>gb|KJB40053.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=410

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTSH
Sbjct  304  DPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTSH  363

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  364  DAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  397



>tpg|DAA56002.1| TPA: hypothetical protein ZEAMMB73_352561 [Zea mays]
Length=348

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQ WIGR+A++P SH
Sbjct  250  EPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQLWIGRNAQAPNSH  309

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  310  DAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  342



>ref|XP_002459023.1| hypothetical protein SORBIDRAFT_03g044670 [Sorghum bicolor]
 gb|EES04143.1| hypothetical protein SORBIDRAFT_03g044670 [Sorghum bicolor]
Length=562

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQFWIGR+A++P SH
Sbjct  464  EPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQFWIGRNAQAPNSH  523

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  524  DAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  556



>gb|EEC72087.1| hypothetical protein OsI_05032 [Oryza sativa Indica Group]
Length=444

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PTSH
Sbjct  346  EPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPTSH  405

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  406  DAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  441



>ref|XP_010492074.1| PREDICTED: uncharacterized protein LOC104769543 [Camelina sativa]
Length=537

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK ME +ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWIGRSA SP+SHD
Sbjct  450  PKIMETLELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIARERLRFWIGRSAHSPSSHD  509

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  510  AIEVEQGLTELRKLRIERRLWEASR  534



>ref|XP_010453387.1| PREDICTED: uncharacterized protein LOC104735325 [Camelina sativa]
Length=526

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK ME +ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA + L+FWIGRSA SP+SHD
Sbjct  439  PKIMETLELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIAREHLRFWIGRSAHSPSSHD  498

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  499  AIEVEQGLTELRKLRIERRLWEASR  523



>ref|XP_006286776.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
 gb|EOA19674.1| hypothetical protein CARUB_v10003326mg [Capsella rubella]
Length=542

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK MEA+EL+PEESEDVLFKEAWLTYFWRRA+++GIE +IA ++L+FWIGRSA SP+SHD
Sbjct  455  PKIMEALELTPEESEDVLFKEAWLTYFWRRAESVGIEVDIARERLRFWIGRSAHSPSSHD  514

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  515  AIEVEQGLTELRKLRIERRLWEASR  539



>gb|EEE55938.1| hypothetical protein OsJ_04631 [Oryza sativa Japonica Group]
Length=530

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PTSH
Sbjct  432  EPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPTSH  491

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  492  DAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  527



>ref|XP_004235837.1| PREDICTED: uncharacterized protein LOC101264412 isoform X1 [Solanum 
lycopersicum]
Length=567

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK M+A EL  EESEDVLFKEAWLTYFWRRAK   +EE+IA ++LQ WIGRS ++PT+H
Sbjct  462  DPKLMDAYELGQEESEDVLFKEAWLTYFWRRAKVHCVEEDIAEERLQVWIGRSGQTPTTH  521

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKLGIE +LWEASRKE D 
Sbjct  522  DAVDVERGLIELRKLGIEQQLWEASRKEIDH  552



>ref|XP_010419899.1| PREDICTED: uncharacterized protein LOC104705575 [Camelina sativa]
Length=541

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK  EA+ELSPEESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWIGRSA SP+SHD
Sbjct  454  PKITEALELSPEESEDVLFKEAWLTYFWRRAESLGIEVDIARERLRFWIGRSAHSPSSHD  513

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  514  AIEVEQGLTELRKLRIERRLWEASR  538



>gb|KJB40052.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=555

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTSH
Sbjct  449  DPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTSH  508

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  509  DAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  542



>ref|NP_001045273.1| Os01g0928100 [Oryza sativa Japonica Group]
 dbj|BAD88164.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07187.1| Os01g0928100 [Oryza sativa Japonica Group]
 dbj|BAH00139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=570

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK+AWL YFWRRAK  GIEE+IA ++LQFWIGR+A +PTSH
Sbjct  472  EPKFLEAFDLSHEEAEDVSFKQAWLIYFWRRAKTHGIEEDIAEERLQFWIGRNAVAPTSH  531

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DA+DVE+GL ELRKLGIE +LWE SR + D+DSS I
Sbjct  532  DAIDVERGLTELRKLGIEQQLWEGSRADIDEDSSAI  567



>gb|KJB40054.1| hypothetical protein B456_007G044600 [Gossypium raimondii]
Length=550

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTYFWRRAK   IEE+IA  +LQFWI RS ++PTSH
Sbjct  444  DPKLIDAFELSEEEGEDVLFKEAWLTYFWRRAKVHCIEEDIAEDRLQFWISRSGQTPTSH  503

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDV++GL ELRKLGIE +LWEASRKE D  S+
Sbjct  504  DAVDVDRGLFELRKLGIEQQLWEASRKEIDHPSA  537



>gb|KDP22551.1| hypothetical protein JCGZ_26382 [Jatropha curcas]
Length=553

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA  LS  E+EDV+FKEAWLTYFWRRAK  G+EE+IA ++LQFWI  S +SPTSH
Sbjct  443  DPKFTEAFGLSEGEAEDVIFKEAWLTYFWRRAKVHGVEEDIAEERLQFWISHSGQSPTSH  502

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL+ELRKL IE +LWEASRKE DQ S
Sbjct  503  DAVDVERGLLELRKLSIEQQLWEASRKEIDQPS  535



>ref|XP_006399817.1| hypothetical protein EUTSA_v10013191mg [Eutrema salsugineum]
 gb|ESQ41270.1| hypothetical protein EUTSA_v10013191mg [Eutrema salsugineum]
Length=542

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+MEA+ELSPEESEDVLFKEAWLTYFWRRA +LGIE +IA ++L+FWI RSA SP+SHD
Sbjct  455  PKFMEALELSPEESEDVLFKEAWLTYFWRRALSLGIEVDIARERLRFWISRSAHSPSSHD  514

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  515  AMEVEQGLTELRKLRIERRLWEASR  539



>ref|XP_008674618.1| PREDICTED: myosin heavy chain, striated muscle [Zea mays]
 tpg|DAA56001.1| TPA: hypothetical protein ZEAMMB73_352561 [Zea mays]
Length=558

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PKY+EA +LSPEE+EDV FK+AWL YFWRRAK  G+EE+IA+ +LQ WIGR+A++P SH
Sbjct  460  EPKYLEAFDLSPEEAEDVSFKQAWLIYFWRRAKTHGVEEDIADDRLQLWIGRNAQAPNSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DA+DVE+GL ELRKLGIE +LWE SR + DQ S
Sbjct  520  DAIDVERGLTELRKLGIEQQLWEGSRADIDQAS  552



>ref|XP_003564988.1| PREDICTED: MAP7 domain-containing protein 1-like [Brachypodium 
distachyon]
Length=571

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PKY+EA +LSPEE+EDV FK AWL YFWRRAK+ GIEE+IA+++LQFWIGR+A +P SH
Sbjct  472  EPKYLEAFDLSPEEAEDVSFKHAWLIYFWRRAKSHGIEEDIADERLQFWIGRNAHAPNSH  531

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DA+DVE+GL ELRKLGIE +LWE +R + D+ +S +
Sbjct  532  DAIDVERGLTELRKLGIEQQLWEGTRADIDEAASAM  567



>ref|XP_008777461.1| PREDICTED: uncharacterized protein LOC103697393 [Phoenix dactylifera]
Length=555

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++E+ EL+ EESEDV FK+AWL Y WRRAK  GIEE+IA ++LQFWI RS + PTSH
Sbjct  457  DPKFLESFELNQEESEDVTFKQAWLVYLWRRAKVHGIEEDIAEERLQFWISRSGQPPTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL+ELRKLGIE +LWEASR++ +Q SS
Sbjct  517  DAVDVERGLIELRKLGIEQQLWEASRRDIEQASS  550



>ref|XP_009337520.1| PREDICTED: uncharacterized protein LOC103929969 isoform X2 [Pyrus 
x bretschneideri]
Length=557

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT H
Sbjct  451  DPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWINRSAQTPTCH  510

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  511  DAVDVERGLYELRKLGIEQQLWEASRKEIDQPIS  544



>ref|XP_009337519.1| PREDICTED: uncharacterized protein LOC103929969 isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT H
Sbjct  456  DPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWINRSAQTPTCH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  516  DAVDVERGLYELRKLGIEQQLWEASRKEIDQ  546



>ref|XP_004501741.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like isoform X1 [Cicer arietinum]
Length=569

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTSH
Sbjct  460  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWISRSGQSPTSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKLGIE +LWEASRK  DQ
Sbjct  520  DAVDVERGLLELRKLGIEQQLWEASRKGIDQ  550



>ref|XP_010909766.1| PREDICTED: uncharacterized protein LOC105035770 [Elaeis guineensis]
Length=555

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++E+ EL+ EESEDV FK+AWL YFWRRAK  GIEE+IA ++LQFWI RS + PTSH
Sbjct  457  DPKFLESFELNQEESEDVTFKQAWLVYFWRRAKVHGIEEDIAEERLQFWISRSGQPPTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            D VDVE+GL+ELRKLGIE +LWEASR++ +Q SS
Sbjct  517  DPVDVERGLIELRKLGIEPQLWEASRRDMEQASS  550



>ref|XP_004501742.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like isoform X2 [Cicer arietinum]
Length=565

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTSH
Sbjct  456  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWISRSGQSPTSH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKLGIE +LWEASRK  DQ
Sbjct  516  DAVDVERGLLELRKLGIEQQLWEASRKGIDQ  546



>ref|XP_002321743.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 ref|XP_002321744.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 gb|EEF05870.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
 gb|EEF05871.2| hypothetical protein POPTR_0015s11590g [Populus trichocarpa]
Length=558

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EAIELS  E++DVLFKEAWLTY+WRRA   G+EE+IA  +LQFWI RS ++PTSH
Sbjct  450  DPKFTEAIELSEAEADDVLFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSEQAPTSH  509

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+G++ELRKL IE +LWEASR+E DQ S
Sbjct  510  DAVDVERGVVELRKLSIEQQLWEASRREIDQSS  542



>ref|XP_008351703.1| PREDICTED: uncharacterized protein LOC103415127 [Malus domestica]
Length=562

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RSA++PT H
Sbjct  456  DPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSAQTPTCH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  516  DAVDVERGLYELRKLGIEQQLWEASRKEIDQPVS  549



>gb|KEH35693.1| ripening-regulated protein [Medicago truncatula]
Length=405

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTSH
Sbjct  296  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWIARSGQSPTSH  355

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+ L+ELRKLGIE +LWEASRK  DQ S
Sbjct  356  DAVDVERDLLELRKLGIEQQLWEASRKGIDQPS  388



>ref|XP_008239546.1| PREDICTED: uncharacterized protein LOC103338138 isoform X1 [Prunus 
mume]
 ref|XP_008239547.1| PREDICTED: uncharacterized protein LOC103338138 isoform X2 [Prunus 
mume]
Length=564

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+EE+I   +LQ WI RSA++PT H
Sbjct  456  DPKFMEAFDLSEEEVEDISFKVAWLTYFWRRAKEHGVEEDIGEDRLQLWISRSAQTPTCH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ  S+
Sbjct  516  DAVDVERGLYELRKLGIEQQLWEASRKEIDQPISV  550



>gb|KFK25562.1| hypothetical protein AALP_AA8G131000 [Arabis alpina]
Length=550

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PKYME +ELS EESEDVLFKEAWLTYFWRRA +LGIE EIA ++L+FWI RSA SP+SHD
Sbjct  463  PKYMEVLELSHEESEDVLFKEAWLTYFWRRALSLGIEVEIARERLRFWISRSAHSPSSHD  522

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  523  AMEVEQGLTELRKLRIERRLWEASR  547



>gb|KHN31266.1| hypothetical protein glysoja_012916 [Glycine soja]
Length=576

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA ++LQFWI RS +SP+SH
Sbjct  467  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEERLQFWIARSGQSPSSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  527  DAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>ref|XP_006578723.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like [Glycine max]
Length=576

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA ++LQFWI RS +SP+SH
Sbjct  467  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEERLQFWIARSGQSPSSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  527  DAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>gb|KEH35692.1| ripening-regulated protein [Medicago truncatula]
Length=573

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA   G+EE+IA  +L+FWI RS +SPTSH
Sbjct  464  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHGVEEDIAEDRLRFWIARSGQSPTSH  523

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+ L+ELRKLGIE +LWEASRK  DQ S
Sbjct  524  DAVDVERDLLELRKLGIEQQLWEASRKGIDQPS  556



>ref|XP_006376918.1| hypothetical protein POPTR_0012s10720g [Populus trichocarpa]
 gb|ERP54715.1| hypothetical protein POPTR_0012s10720g [Populus trichocarpa]
Length=565

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +SPTSH
Sbjct  457  DPKFTEATELSKAEAEDVDFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSPTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            DAVDVE+G++ELRKL IE +LWEASRKE D  S   G
Sbjct  517  DAVDVERGVLELRKLSIEQQLWEASRKEIDHSSLAPG  553



>ref|XP_009334313.1| PREDICTED: uncharacterized protein LOC103927142 isoform X2 [Pyrus 
x bretschneideri]
Length=557

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI  SA++PT H
Sbjct  451  DPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWISHSAQTPTCH  510

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  511  DAVDVERGLYELRKLGIEQQLWEASRKEIDQPIS  544



>ref|XP_009334312.1| PREDICTED: uncharacterized protein LOC103927142 isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI  SA++PT H
Sbjct  456  DPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKVHGVEDDIADDRLQLWISHSAQTPTCH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ
Sbjct  516  DAVDVERGLYELRKLGIEQQLWEASRKEIDQ  546



>gb|KJB51281.1| hypothetical protein B456_008G210100 [Gossypium raimondii]
Length=556

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK ++A ELS EE EDVLFKEAWLTYFWRRAK  G+E++IA ++L+FWI  S ++PTSH
Sbjct  450  DPKLIDAFELSEEEREDVLFKEAWLTYFWRRAKVYGVEDDIAEERLEFWISHSGQTPTSH  509

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDV++GL ELRKLGIE +LWEASRKE D 
Sbjct  510  DAVDVDRGLYELRKLGIEQQLWEASRKEIDH  540



>ref|XP_007209092.1| hypothetical protein PRUPE_ppa003575mg [Prunus persica]
 gb|EMJ10291.1| hypothetical protein PRUPE_ppa003575mg [Prunus persica]
Length=564

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+EE+I   +L  WI RSA++PT H
Sbjct  456  DPKFMEAFDLSEEEVEDISFKVAWLTYFWRRAKEHGVEEDIGEDRLHLWISRSAQTPTCH  515

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            DAVDVE+GL ELRKLGIE +LWEASRKE DQ  S+
Sbjct  516  DAVDVERGLYELRKLGIEQQLWEASRKEIDQPISV  550



>emb|CDX69654.1| BnaA10g20030D [Brassica napus]
Length=541

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+SHD
Sbjct  454  PKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPSSHD  513

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRK  IE RLWEASR
Sbjct  514  AMEVEQGLTELRKRRIERRLWEASR  538



>ref|XP_009121778.1| PREDICTED: uncharacterized protein LOC103846586 [Brassica rapa]
Length=544

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+SHD
Sbjct  457  PKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPSSHD  516

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRK  IE RLWEASR
Sbjct  517  AMEVEQGLTELRKRRIERRLWEASR  541



>gb|KHN09724.1| hypothetical protein glysoja_011998, partial [Glycine soja]
Length=390

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SP+SH
Sbjct  281  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHCVEEDIAEERLQFWIARSGQSPSSH  340

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  341  DAVDVERGLLELRKLSIEQQLWEASRKGIDQ  371



>emb|CDY09779.1| BnaC09g43820D [Brassica napus]
Length=538

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +EA+ELSPEESEDVLFKEAWLTYFWRRA +LGI+ +IA ++LQFWI RSA SP+SHD
Sbjct  451  PKLLEALELSPEESEDVLFKEAWLTYFWRRALSLGIDVDIARERLQFWISRSAHSPSSHD  510

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRK  IE RLWEASR
Sbjct  511  AMEVEQGLTELRKRRIERRLWEASR  535



>ref|XP_010550755.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104821536 
[Tarenaya hassleriana]
Length=573

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK++EA  LS EE+EDV FK+AWL YFW RAK   +EE+IA ++LQFWI RS +SPTSH
Sbjct  463  DPKFVEAYALSDEEAEDVAFKQAWLMYFWGRAKLHNVEEDIAEERLQFWISRSGQSPTSH  522

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL+E+RKLGIE +LWEASR+E DQ S
Sbjct  523  DAVDVERGLVEVRKLGIEQQLWEASRREIDQPS  555



>ref|XP_007137890.1| hypothetical protein PHAVU_009G164500g [Phaseolus vulgaris]
 gb|ESW09884.1| hypothetical protein PHAVU_009G164500g [Phaseolus vulgaris]
Length=575

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKE+WLTY WRRA   G+EE+IA +QLQFWI RS ++PTSH
Sbjct  466  DAKYSEAFELSEEEAEDVLFKESWLTYIWRRALFHGVEEDIAEEQLQFWIARSGQAPTSH  525

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  526  DAVDVERGLLELRKLSIEPQLWEASRKGIDQ  556



>ref|XP_011002098.1| PREDICTED: uncharacterized protein LOC105109182 [Populus euphratica]
 ref|XP_011002099.1| PREDICTED: uncharacterized protein LOC105109182 [Populus euphratica]
Length=565

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EAIELS  E++DVLFKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TSH
Sbjct  457  DPKFTEAIELSEAEADDVLFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTSH  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+G++ELRKL IE +LWEASR+E D  S
Sbjct  517  DAVDVERGIVELRKLSIEQQLWEASRREIDHSS  549



>gb|EPS59084.1| hypothetical protein M569_15727, partial [Genlisea aurea]
Length=561

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+++A  L+ EE EDVLFKEAWLTYFWRRAK  G+EE++A  +LQ W+GRS ++PTSH
Sbjct  453  DHKFLDAFALTQEEIEDVLFKEAWLTYFWRRAKVHGVEEDVAEDRLQLWVGRSGQTPTSH  512

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DAVDVE+GL+ELRKLGIE +LWEASRKE
Sbjct  513  DAVDVERGLIELRKLGIEQQLWEASRKE  540



>ref|XP_008356569.1| PREDICTED: uncharacterized protein LOC103420283 isoform X4 [Malus 
domestica]
Length=417

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  311  BPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  370

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  371  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  404



>ref|XP_008374187.1| PREDICTED: uncharacterized protein LOC103437491 isoform X4 [Malus 
domestica]
Length=417

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  311  BPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  370

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  371  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  404



>ref|XP_002871557.1| hypothetical protein ARALYDRAFT_488142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47816.1| hypothetical protein ARALYDRAFT_488142 [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK  EA+ELS EESEDVLFKEAWLTYFWRRA++LGIE +IA ++L+FWI RSA SP+SHD
Sbjct  452  PKITEALELSQEESEDVLFKEAWLTYFWRRAQSLGIEVDIARERLRFWISRSAHSPSSHD  511

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  512  AMEVEQGLTELRKLRIERRLWEASR  536



>gb|KJB15172.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=549

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 4/87 (5%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA E    ESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+SH
Sbjct  466  DPKFMEAFE----ESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPSSH  521

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRK  156
            DAVDVE+GLMELRKLGIE RLWEASR+
Sbjct  522  DAVDVEEGLMELRKLGIERRLWEASRR  548



>ref|XP_006581845.1| PREDICTED: plectin-like [Glycine max]
Length=576

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D KY EA ELS EE+EDVLFKEAWLTYFWRRA    +EE+IA ++LQFWI RS +SP+SH
Sbjct  467  DAKYSEAFELSEEEAEDVLFKEAWLTYFWRRALFHCVEEDIAEERLQFWIARSGQSPSSH  526

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+GL+ELRKL IE +LWEASRK  DQ
Sbjct  527  DAVDVERGLLELRKLSIEQQLWEASRKGIDQ  557



>ref|XP_008356568.1| PREDICTED: uncharacterized protein LOC103420283 isoform X3 [Malus 
domestica]
Length=494

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  388  BPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  447

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  448  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  481



>ref|XP_008374186.1| PREDICTED: uncharacterized protein LOC103437491 isoform X3 [Malus 
domestica]
Length=495

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  389  BPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  448

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  449  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  482



>ref|XP_008356567.1| PREDICTED: uncharacterized protein LOC103420283 isoform X2 [Malus 
domestica]
Length=559

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  453  BPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  512

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  513  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_008356566.1| PREDICTED: uncharacterized protein LOC103420283 isoform X1 [Malus 
domestica]
Length=561

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  455  BPKFMEAFDLSBEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  514

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  515  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  548



>ref|XP_008374184.1| PREDICTED: uncharacterized protein LOC103437491 isoform X1 [Malus 
domestica]
Length=561

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  455  BPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  514

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  515  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  548



>ref|XP_008374185.1| PREDICTED: uncharacterized protein LOC103437491 isoform X2 [Malus 
domestica]
Length=559

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+MEA +LS EE ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT H
Sbjct  453  BPKFMEAFDLSDEEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCH  512

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DAVD E+G+ ELRKLGIE +LWEASRKE DQ  S
Sbjct  513  DAVDAERGVYELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_010247124.1| PREDICTED: uncharacterized protein LOC104590245, partial [Nelumbo 
nucifera]
Length=344

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D   +EA ELS EESEDV+FK+AWLTYFWRRAK  G+E++IA++ LQFWI  S+ SPTSH
Sbjct  241  DEGQIEAFELSQEESEDVIFKQAWLTYFWRRAKNHGLEQDIADEHLQFWINHSSRSPTSH  300

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            DAVDVE+G++ELRKLGIE +LWE SRK  DQD
Sbjct  301  DAVDVERGMVELRKLGIETQLWEESRKWIDQD  332



>ref|XP_010556094.1| PREDICTED: GRIP1-associated protein 1 [Tarenaya hassleriana]
Length=563

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 75/95 (79%), Gaps = 9/95 (9%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA+ELSPEESEDVLFKEAWLTYFWRRA +LGIE  IA ++L+FWI RSA SP+SH
Sbjct  466  DPKFMEALELSPEESEDVLFKEAWLTYFWRRALSLGIEVHIARERLRFWISRSAHSPSSH  525

Query  236  DA---------VDVEQGLMELRKLGIEHRLWEASR  159
                       + VEQGL ELRKL IEHRLWEASR
Sbjct  526  SRGGGFLCLVLISVEQGLTELRKLRIEHRLWEASR  560



>ref|XP_008791048.1| PREDICTED: uncharacterized protein LOC103708063 [Phoenix dactylifera]
Length=551

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA ELS EE++DVLFK+AWLTYFWRRAK   +EE+IA+++L+FWIGR  + PTSH
Sbjct  454  DQKFAEAFELSEEEAQDVLFKQAWLTYFWRRAKTHVVEEDIADERLEFWIGRIGQPPTSH  513

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVE+GLMELRKL IE +LWEASR+E D
Sbjct  514  DAVDVERGLMELRKLSIEQQLWEASRREID  543



>ref|XP_009368792.1| PREDICTED: uncharacterized protein LOC103958268 isoform X1 [Pyrus 
x bretschneideri]
Length=566

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT HD
Sbjct  461  PKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCHD  520

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            AVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  521  AVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  553



>ref|XP_009368795.1| PREDICTED: uncharacterized protein LOC103958268 isoform X3 [Pyrus 
x bretschneideri]
Length=559

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT HD
Sbjct  454  PKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCHD  513

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            AVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  514  AVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  546



>ref|XP_009368793.1| PREDICTED: uncharacterized protein LOC103958268 isoform X2 [Pyrus 
x bretschneideri]
Length=561

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+MEA +LS +E ED+ FK AWLTYFWRRAK  G+E++IA+ +LQ WI RS ++PT HD
Sbjct  456  PKFMEAFDLSDDEIEDISFKVAWLTYFWRRAKEHGVEDDIADDRLQLWISRSVQTPTCHD  515

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            AVD E+GL ELRKLGIE +LWEASRKE DQ  S
Sbjct  516  AVDAERGLSELRKLGIEQQLWEASRKEIDQPVS  548



>gb|AFN54517.1| ripening-regulated protein [Fragaria x ananassa]
Length=566

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR----SAES  249
            DPK+MEA ELS EE  D+ FKEAWL YFW+RAK  G+E++IA+ +LQ WI      S +S
Sbjct  450  DPKFMEAFELSEEEINDIRFKEAWLAYFWKRAKIHGVEDDIADDRLQLWISHISRSSTQS  509

Query  248  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            PTSHDAVDVE GL+ELRKLGIE +LWEASRKE D  SS I
Sbjct  510  PTSHDAVDVEGGLLELRKLGIEKQLWEASRKEIDHPSSDI  549



>ref|XP_008798921.1| PREDICTED: uncharacterized protein LOC103713683 [Phoenix dactylifera]
Length=325

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            +EA+ELS EESEDVLFK+AWLTYFWRR K  G+EE+IA+++LQFWI ++  SPTSHD V+
Sbjct  229  VEAVELSQEESEDVLFKQAWLTYFWRRVKNHGLEEDIADERLQFWIEQNNHSPTSHDVVE  288

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+EL+KLGIE +LWEA+R+ +DQD+
Sbjct  289  VERGLLELKKLGIESQLWEAARRGSDQDA  317



>ref|NP_196830.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36392.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44898.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99384.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91872.1| uncharacterized protein AT5G13260 [Arabidopsis thaliana]
Length=537

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK  E +ELS EESEDVLFKEAWLTYFWRRA++LGIE + A ++L+FWI RSA SP+SHD
Sbjct  450  PKITETLELSQEESEDVLFKEAWLTYFWRRAQSLGIEVDTARERLRFWISRSAHSPSSHD  509

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRKL IE RLWEASR
Sbjct  510  AMEVEQGLTELRKLRIERRLWEASR  534



>ref|XP_004297498.1| PREDICTED: coiled-coil domain-containing protein SCD2 [Fragaria 
vesca subsp. vesca]
Length=572

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 4/100 (4%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGR----SAES  249
            DPK+MEA ELS EE  D+ FKEAWL YFW+RAK  G+E++IA+ +LQ WI      S +S
Sbjct  456  DPKFMEAFELSEEEINDIRFKEAWLAYFWKRAKIHGVEDDIADDRLQLWISHISRSSTQS  515

Query  248  PTSHDAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            PTSHDAVDVE GL+ELRKLGIE +LWEASRKE D  SS I
Sbjct  516  PTSHDAVDVEGGLLELRKLGIEKQLWEASRKEIDHPSSDI  555



>dbj|BAJ93558.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK AWL YFWRRAK  GIEE+IA+++LQFWI R+A +P SH
Sbjct  472  EPKFLEAFDLSNEEAEDVSFKHAWLIYFWRRAKTHGIEEDIADERLQFWIARNAVAPNSH  531

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DA+DVE+GL ELRKLGIE +LWE +R + D+ +S
Sbjct  532  DAIDVERGLTELRKLGIEQQLWEGTRADIDEAAS  565



>ref|XP_008790703.1| PREDICTED: uncharacterized protein LOC103707818 isoform X1 [Phoenix 
dactylifera]
Length=554

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK +E+ EL+ EES+DV FK+AWL YFWRRAK  GI+E+IA ++LQFWI RS +  TSH
Sbjct  454  DPKLLESFELNQEESQDVTFKQAWLVYFWRRAKVHGIKEDIAEERLQFWISRSGQPQTSH  513

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            +AVDVE+GL+ELRKLGIE  LWEASR++ +Q SS
Sbjct  514  EAVDVERGLIELRKLGIEQHLWEASRRDIEQASS  547



>emb|CDM85875.1| unnamed protein product [Triticum aestivum]
Length=572

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK++EA +LS EE+EDV FK AWL YFWRRAK  GIEE+IA+++LQFWI R+A +P SH
Sbjct  473  EPKFLEAFDLSNEEAEDVSFKHAWLIYFWRRAKTHGIEEDIADERLQFWIARNAVAPNSH  532

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            DA+DVE+GL ELRKLGIE +LWE +R + D+ +S
Sbjct  533  DAIDVERGLTELRKLGIEQQLWEGTRADIDEAAS  566



>ref|XP_006405440.1| hypothetical protein EUTSA_v10028083mg [Eutrema salsugineum]
 gb|ESQ46893.1| hypothetical protein EUTSA_v10028083mg [Eutrema salsugineum]
Length=306

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +EA+ELSPE+SEDV FKEAWLTYFWRRA +LGI+ +IA ++L+FWI RSA SP+SHD
Sbjct  221  PKLVEALELSPEDSEDVHFKEAWLTYFWRRALSLGIDVDIARERLRFWISRSAHSPSSHD  280

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            A++VEQGL ELRK  IE RLWEASR
Sbjct  281  AMEVEQGLTELRKRRIERRLWEASR  305



>ref|XP_010929654.1| PREDICTED: protein Hook homolog 2-like isoform X1 [Elaeis guineensis]
Length=559

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA ELS EE++DVLFK+AWLTYFWRRA    +EE+IA+++LQFWIGR  + PTSH
Sbjct  458  DQKFTEAFELSEEEAQDVLFKQAWLTYFWRRANTHVVEEDIADERLQFWIGRIGQPPTSH  517

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            D VDVE+GLMEL+KL IE +LWEASR+E D +  L
Sbjct  518  DVVDVERGLMELKKLSIELQLWEASRREIDVNQKL  552



>ref|XP_010929655.1| PREDICTED: protein Hook homolog 2-like isoform X2 [Elaeis guineensis]
Length=545

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA ELS EE++DVLFK+AWLTYFWRRA    +EE+IA+++LQFWIGR  + PTSH
Sbjct  444  DQKFTEAFELSEEEAQDVLFKQAWLTYFWRRANTHVVEEDIADERLQFWIGRIGQPPTSH  503

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSL  132
            D VDVE+GLMEL+KL IE +LWEASR+E D +  L
Sbjct  504  DVVDVERGLMELKKLSIELQLWEASRREIDVNQKL  538



>ref|XP_010904828.1| PREDICTED: uncharacterized protein LOC105032156 [Elaeis guineensis]
Length=510

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            +EAIELS EESEDVLFK+AWLTYFWRR K  G+EE+IA+++LQFWI ++  SPTSHD V+
Sbjct  414  VEAIELSQEESEDVLFKQAWLTYFWRRVKNHGLEEDIADERLQFWIEQNNHSPTSHDVVE  473

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+EL+KLGIE +LWEA+R+ +DQD+
Sbjct  474  VERGLLELKKLGIESQLWEAARRGSDQDA  502



>ref|XP_011042949.1| PREDICTED: uncharacterized protein LOC105138542 isoform X1 [Populus 
euphratica]
 ref|XP_011042950.1| PREDICTED: uncharacterized protein LOC105138542 isoform X1 [Populus 
euphratica]
Length=567

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TSH
Sbjct  460  DPKFTEANELSKAEAEDVHFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTSH  519

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            DAVDVE+G++ELRKL IE +LWEASR+E D  S   G
Sbjct  520  DAVDVERGVLELRKLSIEQQLWEASRREIDHSSLAPG  556



>ref|XP_011042951.1| PREDICTED: uncharacterized protein LOC105138542 isoform X2 [Populus 
euphratica]
Length=565

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ EA ELS  E+EDV FKEAWLTY+WRRA   G+EE+IA  +LQFWI RS +S TSH
Sbjct  458  DPKFTEANELSKAEAEDVHFKEAWLTYYWRRALVHGVEEDIAEDRLQFWISRSGQSLTSH  517

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            DAVDVE+G++ELRKL IE +LWEASR+E D  S   G
Sbjct  518  DAVDVERGVLELRKLSIEQQLWEASRREIDHSSLAPG  554



>emb|CBI34283.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQG  213
            ELS EESEDVLFK+AWLTYFWRRAK LG+E +IA+++LQFWI  +   P  HDAVDVE+G
Sbjct  117  ELSQEESEDVLFKQAWLTYFWRRAKNLGVERDIADERLQFWINHTTRQPAFHDAVDVERG  176

Query  212  LMELRKLGIEHRLWEASRKETDQD  141
            L+ELRKLGIEH+LWE SRK   QD
Sbjct  177  LVELRKLGIEHQLWEESRKWIGQD  200



>ref|XP_010531859.1| PREDICTED: uncharacterized protein LOC104808047 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010531860.1| PREDICTED: uncharacterized protein LOC104808047 isoform X2 [Tarenaya 
hassleriana]
Length=538

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K++EA ELS EE++DVLFKEAWL YFW+RAKA G+E +IA ++LQFWI R  + P SH
Sbjct  435  DSKFVEAFELSEEEAQDVLFKEAWLMYFWKRAKAHGVESDIAEERLQFWINRIGQPPMSH  494

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DAVDVE+G++ELRKLGIE +LWEASR+E
Sbjct  495  DAVDVERGMVELRKLGIEQQLWEASRRE  522



>ref|XP_010659988.1| PREDICTED: uncharacterized protein LOC100260652 [Vitis vinifera]
Length=626

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
              +E+ ELS EESEDVLFK+AWLTYFWRRAK LG+E +IA+++LQFWI  +   P  HDA
Sbjct  525  NLLESFELSQEESEDVLFKQAWLTYFWRRAKNLGVERDIADERLQFWINHTTRQPAFHDA  584

Query  230  VDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            VDVE+GL+ELRKLGIEH+LWE SRK   QD
Sbjct  585  VDVERGLVELRKLGIEHQLWEESRKWIGQD  614



>ref|XP_009415852.1| PREDICTED: uncharacterized protein LOC103996631 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PTSH
Sbjct  438  DPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPTSH  496

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            D VDVE+GL+ELRKLGIE +LWEA R E D +
Sbjct  497  DVVDVERGLIELRKLGIEQQLWEACRMEFDAN  528



>ref|XP_009415853.1| PREDICTED: uncharacterized protein LOC103996631 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PTSH
Sbjct  431  DPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPTSH  489

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            D VDVE+GL+ELRKLGIE +LWEA R E D +
Sbjct  490  DVVDVERGLIELRKLGIEQQLWEACRMEFDAN  521



>ref|XP_009415851.1| PREDICTED: uncharacterized protein LOC103996631 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=555

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ E  ELS EE+EDVLFK++WLTYFWRRAK  GIEE+IA + L+FWIGR  + PTSH
Sbjct  455  DPKWDE-FELSQEEAEDVLFKQSWLTYFWRRAKTHGIEEDIAEEHLRFWIGRMGQPPTSH  513

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            D VDVE+GL+ELRKLGIE +LWEA R E D +
Sbjct  514  DVVDVERGLIELRKLGIEQQLWEACRMEFDAN  545



>ref|XP_010678340.1| PREDICTED: myosin heavy chain, non-muscle [Beta vulgaris subsp. 
vulgaris]
Length=567

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+ME+ ELS EES+DVLFKEAWLTYFW+RA+   +EE+IA +QLQ W  RS +SP   
Sbjct  457  DPKFMESFELSQEESDDVLFKEAWLTYFWKRARDHQVEEDIAEEQLQLWTSRSGQSPALQ  516

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DAVDVE+GL+ELRKLG+E +LWE SRKE +  S
Sbjct  517  DAVDVERGLIELRKLGLEQQLWETSRKEIENYS  549



>ref|XP_002975311.1| hypothetical protein SELMODRAFT_442801 [Selaginella moellendorffii]
 gb|EFJ23512.1| hypothetical protein SELMODRAFT_442801 [Selaginella moellendorffii]
Length=540

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +E+++LS EE EDV FK+AWL+YFWRRA+A  IE +IA+++LQ+W  R+A SPT HD
Sbjct  441  PKLVESMDLSSEEVEDVQFKQAWLSYFWRRARANKIESDIADERLQYWASRNAVSPTFHD  500

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            AVDVE+GLMELRKLGIE +LWEASRKE  Q  +  G
Sbjct  501  AVDVERGLMELRKLGIEDQLWEASRKEIAQQQAQKG  536



>ref|XP_002964484.1| hypothetical protein SELMODRAFT_438807 [Selaginella moellendorffii]
 gb|EFJ34817.1| hypothetical protein SELMODRAFT_438807 [Selaginella moellendorffii]
Length=540

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK +E+++LS EE EDV FK+AWL+YFWRRA+A  IE +IA+++LQ+W  R+A SPT HD
Sbjct  441  PKLVESMDLSSEEVEDVQFKQAWLSYFWRRARANKIESDIADERLQYWASRNAVSPTFHD  500

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIG  126
            AVDVE+GLMELRKLGIE +LWEASRKE  Q  +  G
Sbjct  501  AVDVERGLMELRKLGIEDQLWEASRKEIAQQQAQKG  536



>ref|XP_006855399.1| hypothetical protein AMTR_s00057p00146260 [Amborella trichopoda]
 gb|ERN16866.1| hypothetical protein AMTR_s00057p00146260 [Amborella trichopoda]
Length=541

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            +EA ELS EE EDVLFK+AWLTYFW+RAK  G+EE+IA+++LQFWI  S ++PTSHD VD
Sbjct  446  VEAFELSQEEYEDVLFKQAWLTYFWKRAKNHGLEEDIADERLQFWISHSTQTPTSHDVVD  505

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+ELRKL IE +LWEASRK+ + +S
Sbjct  506  VERGLIELRKLSIETQLWEASRKDINPES  534



>gb|EPS67968.1| hypothetical protein M569_06807 [Genlisea aurea]
Length=101

 Score =   119 bits (299),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 8/91 (9%)
 Frame = -2

Query  392  ELSPEESEDVLFKE-------AWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            ELSPEESEDVLFKE       AWLTYFWRRAK  G+E E A+++L FW  RS ++PTSHD
Sbjct  3    ELSPEESEDVLFKEPHHISLQAWLTYFWRRAKVYGVEVEKADERLNFWNSRSGQAPTSHD  62

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQD  141
            AVDVEQGL+ELRKL IE RLWE SR++ DQD
Sbjct  63   AVDVEQGLIELRKLEIERRLWE-SRRDIDQD  92



>ref|XP_010545937.1| PREDICTED: uncharacterized protein LOC104818173 isoform X3 [Tarenaya 
hassleriana]
Length=425

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S 
Sbjct  248  DPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSSQ  307

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  308  DAVDVERGMEELRKLGMEKLLWEASRREMDQ  338



>ref|XP_010545934.1| PREDICTED: uncharacterized protein LOC104818173 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010545935.1| PREDICTED: uncharacterized protein LOC104818173 isoform X2 [Tarenaya 
hassleriana]
Length=506

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S 
Sbjct  329  DPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSSQ  388

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  389  DAVDVERGMEELRKLGMEKLLWEASRREMDQ  419



>ref|XP_010545933.1| PREDICTED: uncharacterized protein LOC104818173 isoform X1 [Tarenaya 
hassleriana]
Length=512

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+++  ELS EE+EDV FK+AWL Y W RAK  G+EE+I++++L FWIGR  +SP+S 
Sbjct  335  DPKFVDGYELSEEEAEDVAFKQAWLMYLWGRAKLYGVEEDISDERLHFWIGRCGQSPSSQ  394

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            DAVDVE+G+ ELRKLG+E  LWEASR+E DQ
Sbjct  395  DAVDVERGMEELRKLGMEKLLWEASRREMDQ  425



>emb|CDX88044.1| BnaA06g26350D [Brassica napus]
Length=542

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            K++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES TSHD
Sbjct  437  KFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTTSHD  496

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            AVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  497  AVDVERGMLELRKLGIEQQLWEACRKETEH  526



>ref|XP_009150900.1| PREDICTED: uncharacterized protein LOC103874239 [Brassica rapa]
Length=543

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            K++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES TSHD
Sbjct  438  KFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTTSHD  497

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            AVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  498  AVDVERGMLELRKLGIEQQLWEACRKETEH  527



>gb|KJB15175.1| hypothetical protein B456_002G163500 [Gossypium raimondii]
Length=606

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 78/140 (56%), Gaps = 53/140 (38%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPK+MEA ELSPEESEDVLFKEAWLTY WRRAK+ GIEE+ A ++L+FWI RS  SP+SH
Sbjct  466  DPKFMEAFELSPEESEDVLFKEAWLTYIWRRAKSHGIEEDTAKERLKFWISRSVHSPSSH  525

Query  236  DAVD-----------------------------------------------------VEQ  216
            DAVD                                                     VE+
Sbjct  526  DAVDGNIYCSINFFKWKYWCNVSYSLNFELKNVNYFLAYTRPNPIFLASKHLSCFSLVEE  585

Query  215  GLMELRKLGIEHRLWEASRK  156
            GLMELRKLGIE RLWEASR+
Sbjct  586  GLMELRKLGIERRLWEASRR  605



>ref|XP_009395181.1| PREDICTED: uncharacterized protein LOC103980467 [Musa acuminata 
subsp. malaccensis]
Length=538

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQG  213
            ELS EE EDV FK+AWL YFWRRAKA G+EE+IA+++LQ WIGR  + PTSHD VDVE+G
Sbjct  454  ELSQEEIEDVTFKQAWLIYFWRRAKAHGVEEDIADERLQSWIGRIGQPPTSHDVVDVERG  513

Query  212  LMELRKLGIEHRLWEASRKETDQDS  138
            L+EL+KLGIE +LWEASR+E + D+
Sbjct  514  LIELKKLGIEQQLWEASRREIELDT  538



>emb|CAB86633.1| putative protein [Arabidopsis thaliana]
Length=576

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQG  213
            ELS EESEDVLFKEAWLTYFWRRA++LGIE + A ++L+FWI RSA SP+SHDA++VEQG
Sbjct  496  ELSQEESEDVLFKEAWLTYFWRRAQSLGIEVDTARERLRFWISRSAHSPSSHDAMEVEQG  555

Query  212  LMELRKLGIEHRLWEASR  159
            L ELRKL IE RLWEASR
Sbjct  556  LTELRKLRIERRLWEASR  573



>emb|CDX80382.1| BnaC07g30620D [Brassica napus]
Length=543

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            +++EA EL  EE EDV+FK+AWL YFW RAK LG+EE+IA+++LQFWI  S  ES TSHD
Sbjct  438  RFVEAYELKEEEQEDVVFKQAWLLYFWARAKLLGVEEDIADERLQFWISCSEGESTTSHD  497

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            AVDVE+G++ELRKLGIE +LWEA RKET+ 
Sbjct  498  AVDVERGMLELRKLGIEQQLWEACRKETEH  527



>gb|EYU38200.1| hypothetical protein MIMGU_mgv1a002994mg [Erythranthe guttata]
Length=618

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            P + EA ELS EE+EDVL K+AWL YFWRRAK  G+E +IA ++LQ WI +  + PTSHD
Sbjct  513  PNFSEAYELSSEETEDVLLKQAWLLYFWRRAKNQGLEADIAEERLQLWINQWNKQPTSHD  572

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            AVDVE+GLMELRKLG+E +LWE  R+  DQ+SS
Sbjct  573  AVDVERGLMELRKLGVETKLWEEPRRLVDQESS  605



>ref|XP_008790705.1| PREDICTED: uncharacterized protein LOC103707818 isoform X2 [Phoenix 
dactylifera]
Length=540

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQG  213
            EL+ EES+DV FK+AWL YFWRRAK  GI+E+IA ++LQFWI RS +  TSH+AVDVE+G
Sbjct  448  ELNQEESQDVTFKQAWLVYFWRRAKVHGIKEDIAEERLQFWISRSGQPQTSHEAVDVERG  507

Query  212  LMELRKLGIEHRLWEASRKETDQDSS  135
            L+ELRKLGIE  LWEASR++ +Q SS
Sbjct  508  LIELRKLGIEQHLWEASRRDIEQASS  533



>ref|XP_010097351.1| hypothetical protein L484_010229 [Morus notabilis]
 gb|EXB67661.1| hypothetical protein L484_010229 [Morus notabilis]
Length=729

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELS EES+DVLFK+AWLTYFWRRAK  G+E +++ ++L+FW+  + + PTSHDAVDV
Sbjct  632  EAFELSKEESDDVLFKQAWLTYFWRRAKNHGLEPDVSEERLEFWVNHNTKPPTSHDAVDV  691

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSS  135
            E+GL+ELRK GIE++LWE SRKE + D++
Sbjct  692  ERGLIELRKFGIENQLWEESRKELELDTN  720



>ref|XP_011082849.1| PREDICTED: uncharacterized protein LOC105165513 [Sesamum indicum]
 ref|XP_011082850.1| PREDICTED: uncharacterized protein LOC105165513 [Sesamum indicum]
 ref|XP_011082851.1| PREDICTED: uncharacterized protein LOC105165513 [Sesamum indicum]
 ref|XP_011082853.1| PREDICTED: uncharacterized protein LOC105165513 [Sesamum indicum]
 ref|XP_011082854.1| PREDICTED: uncharacterized protein LOC105165513 [Sesamum indicum]
Length=582

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            + EA ELS EESEDVL K+AWLTYFWRRAK  G+E ++A ++LQFWI +  + PTSHDAV
Sbjct  479  FAEAFELSEEESEDVLLKQAWLTYFWRRAKNQGVEVDVAEERLQFWINQGNKPPTSHDAV  538

Query  227  DVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DVE+G++ELR+L IE +LWE +R++ D D+
Sbjct  539  DVERGMLELRRLAIETKLWEETRRDIDPDA  568



>ref|XP_006413349.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
 gb|ESQ54802.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
Length=620

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ EA ELS +E +D+LFKEAWL YFW+RAK  G+E +IA  +L+FWI R  E P+SH
Sbjct  515  EPKFAEAFELSEDERQDILFKEAWLLYFWKRAKIHGVESDIAEDRLKFWISRIGEQPSSH  574

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDVE+G+ ELRKLGIE +LWE SR E   DS+ I
Sbjct  575  DAVDVERGMRELRKLGIEQQLWETSRTEL-MDSTFI  609



>ref|XP_006413348.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
 gb|ESQ54801.1| hypothetical protein EUTSA_v10024690mg [Eutrema salsugineum]
Length=614

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ EA ELS +E +D+LFKEAWL YFW+RAK  G+E +IA  +L+FWI R  E P+SH
Sbjct  509  EPKFAEAFELSEDERQDILFKEAWLLYFWKRAKIHGVESDIAEDRLKFWISRIGEQPSSH  568

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            DAVDVE+G+ ELRKLGIE +LWE SR E   DS+ I
Sbjct  569  DAVDVERGMRELRKLGIEQQLWETSRTEL-MDSTFI  603



>ref|XP_010438932.1| PREDICTED: caldesmon-like [Camelina sativa]
Length=639

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  536  KFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  595

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  596  VDVERGMRELRKLGIEQQLWETSRKE  621



>ref|XP_010448485.1| PREDICTED: uncharacterized protein LOC104730936 isoform X1 [Camelina 
sativa]
Length=644

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  541  KFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  600

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  601  VDVERGMRELRKLGIEQQLWETSRKE  626



>ref|XP_010448486.1| PREDICTED: uncharacterized protein LOC104730936 isoform X2 [Camelina 
sativa]
Length=642

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  539  KFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  598

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  599  VDVERGMRELRKLGIEQQLWETSRKE  624



>gb|KCW61705.1| hypothetical protein EUGRSUZ_H04425 [Eucalyptus grandis]
Length=233

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  SPTS DAVDV
Sbjct  137  EVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRSPTSQDAVDV  196

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            E+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  197  ERGLTELRKLGIEDQLWEDSRKGSALDNGNV  227



>ref|XP_010433693.1| PREDICTED: uncharacterized protein LOC104717762 [Camelina sativa]
Length=651

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS EE +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  548  KFSEAFELSEEEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  607

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  608  VDVERGMRELRKLGIEQQLWETSRKE  633



>ref|XP_011465885.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X3 [Fragaria vesca subsp. vesca]
Length=660

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTSHDAVDV
Sbjct  564  EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTSHDAVDV  623

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDS  138
            E+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  624  ERGLLELRKLGIETKLWAKSRKGLEHDS  651



>dbj|BAJ95178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK   +EE+IA ++LQ W+ R  + PTSH
Sbjct  608  DEKFTEAFDLSKEEEEDVLFKQAWLMYFWRRAKTHNVEEDIAEERLQMWVDRHGQQPTSH  667

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  668  DAVDVEQGIHELRKLGIEQLLWEFSRQEVN  697



>ref|XP_011465884.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=666

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTSHDAVDV
Sbjct  570  EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTSHDAVDV  629

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDS  138
            E+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  630  ERGLLELRKLGIETKLWAKSRKGLEHDS  657



>ref|XP_011465883.1| PREDICTED: coiled-coil domain-containing protein SCD2-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=670

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EE +DV FK+AWLTYFWRRAK  G+E +I + +LQFW+ R+   PTSHDAVDV
Sbjct  574  EGFELSKEECDDVFFKQAWLTYFWRRAKNHGLEADIVDDRLQFWMNRNTNPPTSHDAVDV  633

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDS  138
            E+GL+ELRKLGIE +LW  SRK  + DS
Sbjct  634  ERGLLELRKLGIETKLWAKSRKGLEHDS  661



>emb|CDY03383.1| BnaC01g16990D [Brassica napus]
Length=653

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTSH
Sbjct  550  EPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTSH  609

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DAVDVE+G+ ELRKLGIE +LWEASR +
Sbjct  610  DAVDVERGMRELRKLGIEQQLWEASRAQ  637



>gb|KCW48522.1| hypothetical protein EUGRSUZ_K02199 [Eucalyptus grandis]
Length=531

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 10/103 (10%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D ++++ +ELS EE+ED+LFK+AWLTYFWRRA    IEE+IA ++LQ WIGRS ++P+ H
Sbjct  422  DFRFIDTLELSKEEAEDILFKQAWLTYFWRRAVVHHIEEDIARERLQSWIGRSGQTPSPH  481

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  108
            DAV+VE+G  EL+KLGIE +LWEASRK TD          HPP
Sbjct  482  DAVEVERGSRELQKLGIERQLWEASRKLTD----------HPP  514



>ref|XP_010237694.1| PREDICTED: uncharacterized protein LOC100834428 isoform X2 [Brachypodium 
distachyon]
Length=721

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK+  +E++IA ++LQ WI R  + PTSH
Sbjct  618  DEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKSHNVEDDIAEERLQMWIDRQDQQPTSH  677

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  678  DAVDVEQGMHELRKLGIEQMLWEFSRQEVN  707



>ref|XP_010237693.1| PREDICTED: uncharacterized protein LOC100834428 isoform X1 [Brachypodium 
distachyon]
Length=725

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK+  +E++IA ++LQ WI R  + PTSH
Sbjct  622  DEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKSHNVEDDIAEERLQMWIDRQDQQPTSH  681

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  682  DAVDVEQGMHELRKLGIEQMLWEFSRQEVN  711



>emb|CDY34338.1| BnaA01g14410D [Brassica napus]
Length=651

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTSH
Sbjct  542  EPKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTSH  601

Query  236  DAVDVEQGLMELRKLGIEHRLWEASR  159
            DAVDVE+G+ ELRKLGIE +LWEASR
Sbjct  602  DAVDVERGMRELRKLGIEQQLWEASR  627



>ref|XP_009138807.1| PREDICTED: triadin isoform X1 [Brassica rapa]
Length=700

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTSHD
Sbjct  592  PKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTSHD  651

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            AVDVE+G+ ELRKLGIE +LWEASR
Sbjct  652  AVDVERGMRELRKLGIEQQLWEASR  676



>ref|XP_009138814.1| PREDICTED: triadin isoform X2 [Brassica rapa]
Length=698

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  413  PKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHD  234
            PK+ EA ELS +E +D+LFKEAWL Y+W+RAK   +E +IA  +L+FWI R AE PTSHD
Sbjct  590  PKFAEAFELSHDEKQDILFKEAWLMYYWKRAKIHSVESDIAEDRLKFWISRIAEQPTSHD  649

Query  233  AVDVEQGLMELRKLGIEHRLWEASR  159
            AVDVE+G+ ELRKLGIE +LWEASR
Sbjct  650  AVDVERGMRELRKLGIEQQLWEASR  674



>ref|XP_007207715.1| hypothetical protein PRUPE_ppa025957mg [Prunus persica]
 gb|EMJ08914.1| hypothetical protein PRUPE_ppa025957mg [Prunus persica]
Length=659

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP-TSHDAVD  225
            EA ELS EESEDVLFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SP TSHDAVD
Sbjct  556  EAFELSKEESEDVLFKQAWLAYFWRRAKNHGVEADIADERLQFWINHNSKSPTTSHDAVD  615

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  616  VERGLLELKKLGIETQLWRESRKWLEHDS  644



>ref|XP_008218218.1| PREDICTED: uncharacterized protein LOC103318595 [Prunus mume]
Length=708

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPT-SHDAVD  225
            EA ELS EESEDVLFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SPT SHDAVD
Sbjct  610  EAFELSKEESEDVLFKQAWLAYFWRRAKNHGVEADIADERLQFWINHNSKSPTASHDAVD  669

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  670  VERGLLELKKLGIETQLWRESRKWLEHDS  698



>gb|EMT30590.1| hypothetical protein F775_12884 [Aegilops tauschii]
Length=995

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK   +EE+IA ++LQ W+ R  + PTSH
Sbjct  892  DEKFTEAFDLSKEEEEDVLFKQAWLMYFWRRAKIHNVEEDIAEERLQMWVDRHGQQPTSH  951

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR+E +
Sbjct  952  DAVDVEQGIHELRKLGIEQLLWEFSRQEVN  981



>ref|XP_006382705.1| hypothetical protein POPTR_0005s04600g [Populus trichocarpa]
 gb|ERP60502.1| hypothetical protein POPTR_0005s04600g [Populus trichocarpa]
Length=654

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            +EA ELS EESEDV FK+AWLTYFWRRAK  G+E +IA ++LQFWI  S+ S +SHDAVD
Sbjct  556  LEAFELSQEESEDVRFKQAWLTYFWRRAKNHGLEPDIAEERLQFWINHSSRSSSSHDAVD  615

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            VE+GLMELRKLGIE++LW+ASR+  + DS+
Sbjct  616  VERGLMELRKLGIENQLWQASRRGLEVDSN  645



>ref|XP_004980549.1| PREDICTED: pre-mRNA-splicing factor CWC22 homolog [Setaria italica]
Length=720

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDV FK+AWL YFWRRAK   +EE+IA ++LQ WI R ++ PTSH
Sbjct  618  DEKFTEAFDLSKEEEEDVKFKQAWLIYFWRRAKTHNVEEDIAEERLQMWIDRHSQEPTSH  677

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQGL ELRKLGIE  LWE SR E +
Sbjct  678  DAVDVEQGLHELRKLGIEQLLWELSRHEVN  707



>ref|XP_006283270.1| hypothetical protein CARUB_v10004304mg, partial [Capsella rubella]
 gb|EOA16168.1| hypothetical protein CARUB_v10004304mg, partial [Capsella rubella]
Length=670

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ +A ELS +E  D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  567  KFSDAFELSEDEQHDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  626

Query  230  VDVEQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            VDVE+G+ ELRKLGIE +LWE SRKE   DSS +
Sbjct  627  VDVERGMRELRKLGIEQQLWETSRKEL-IDSSFL  659



>ref|XP_006663480.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Oryza 
brachyantha]
Length=660

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + PTSH
Sbjct  534  DEKFTEAFDLSKEEEEDVLFKQAWLIYFWRRAKIHNVEDDIAEERLQMWIDRHGQQPTSH  593

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDV+QG+ ELR+LGIE  LWE SR+E +
Sbjct  594  DAVDVDQGIRELRRLGIEQLLWELSRREVN  623



>gb|KDP23593.1| hypothetical protein JCGZ_23426 [Jatropha curcas]
Length=787

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELSPEESEDV FK+AWLTYFW+RAK  G+EE+IA+++LQFWI  S    +S DAVDV
Sbjct  692  EAFELSPEESEDVRFKQAWLTYFWKRAKTHGLEEDIADERLQFWINHSNRFSSSLDAVDV  751

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDS  138
            E+GL+EL+KLG+E++LW+ASR+  + DS
Sbjct  752  ERGLLELKKLGMENQLWQASRRGLETDS  779



>emb|CDY64711.1| BnaA06g38700D [Brassica napus]
Length=292

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS  +S TSHD
Sbjct  186  RFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSNGKSTTSHD  245

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            ++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  246  SLDVERGLIELRKLGIEQQLWEASRREIDQ  275



>ref|XP_006287432.1| hypothetical protein CARUB_v10000636mg [Capsella rubella]
 gb|EOA20330.1| hypothetical protein CARUB_v10000636mg [Capsella rubella]
Length=546

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            +++E  E+   E EDV FK+AWL YFW RAK  G+EE++A+++LQFWI RS  +SPTS D
Sbjct  439  RFVETYEIKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDVADERLQFWISRSEGKSPTSQD  498

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
             VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  499  IVDVERGLLELRKLGVEQQLWEACRKETDQ  528



>ref|XP_007030136.1| Uncharacterized protein TCM_025951 [Theobroma cacao]
 gb|EOY10638.1| Uncharacterized protein TCM_025951 [Theobroma cacao]
Length=870

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELS EESEDV FK+AWLTYFWRRA   G+E +IA+++LQFWI  S+ S TSHDAVDV
Sbjct  773  EAFELSQEESEDVRFKQAWLTYFWRRAMNHGVEPDIADERLQFWINHSSRSSTSHDAVDV  832

Query  221  EQGLMELRKLGIEHRLWEASR  159
            E+GLMELRKLG+E +LW+ SR
Sbjct  833  ERGLMELRKLGLESQLWKKSR  853



>ref|XP_002869690.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45949.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=729

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +SH
Sbjct  624  EPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSSH  683

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DAVDVE+G+ ELRKLGIE +LWE SRKE
Sbjct  684  DAVDVERGMRELRKLGIEQQLWETSRKE  711



>gb|KFK27654.1| hypothetical protein AALP_AA8G411300 [Arabis alpina]
Length=553

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            K++E  EL   E E+V FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  +S TSHD
Sbjct  444  KFVETYELKEGEQEEVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSGGKSLTSHD  503

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            A+DVE+GL+ELRKLGIE +LWEA RKETDQ
Sbjct  504  AMDVERGLLELRKLGIEQQLWEARRKETDQ  533



>ref|XP_002449559.1| hypothetical protein SORBIDRAFT_05g019070 [Sorghum bicolor]
 gb|EES08547.1| hypothetical protein SORBIDRAFT_05g019070 [Sorghum bicolor]
Length=830

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDV FK+AWL YFWRRAK   +EE+IA ++LQ WI R  + PTSH
Sbjct  728  DEKFTEAFDLSKEEEEDVQFKQAWLIYFWRRAKTNSVEEDIAEERLQMWIDRHGQQPTSH  787

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR E +
Sbjct  788  DAVDVEQGIHELRKLGIEQLLWELSRHEAN  817



>ref|XP_010025108.1| PREDICTED: uncharacterized protein LOC104415497 isoform X4 [Eucalyptus 
grandis]
Length=666

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  SPTS DAVDV
Sbjct  570  EVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRSPTSQDAVDV  629

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            E+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  630  ERGLTELRKLGIEDQLWEDSRKGSALDNGNV  660



>ref|XP_010025107.1| PREDICTED: uncharacterized protein LOC104415497 isoform X3 [Eucalyptus 
grandis]
Length=669

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  SPTS DAVDV
Sbjct  573  EVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRSPTSQDAVDV  632

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            E+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  633  ERGLTELRKLGIEDQLWEDSRKGSALDNGNV  663



>ref|XP_010025106.1| PREDICTED: uncharacterized protein LOC104415497 isoform X2 [Eucalyptus 
grandis]
Length=672

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  SPTS DAVDV
Sbjct  576  EVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRSPTSQDAVDV  635

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            E+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  636  ERGLTELRKLGIEDQLWEDSRKGSALDNGNV  666



>ref|XP_010025105.1| PREDICTED: uncharacterized protein LOC104415497 isoform X1 [Eucalyptus 
grandis]
Length=673

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            E  ELS EESEDVLFK+AWLTYFWRRAK  G+E ++A+++LQF I +S  SPTS DAVDV
Sbjct  577  EVFELSKEESEDVLFKQAWLTYFWRRAKNHGLEIDVADERLQFLINQSTRSPTSQDAVDV  636

Query  221  EQGLMELRKLGIEHRLWEASRKETDQDSSLI  129
            E+GL ELRKLGIE +LWE SRK +  D+  +
Sbjct  637  ERGLTELRKLGIEDQLWEDSRKGSALDNGNV  667



>ref|NP_001119051.1| uncharacterized protein [Arabidopsis thaliana]
 gb|ABK28788.1| expressed protein [Arabidopsis thaliana]
 gb|AEE84999.1| uncharacterized protein AT4G25070 [Arabidopsis thaliana]
Length=767

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +SH
Sbjct  662  EPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSSH  721

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DA+DVE+G+ ELRKLGIE +LWE SRKE
Sbjct  722  DAIDVERGMRELRKLGIEQQLWETSRKE  749



>ref|NP_194237.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU44520.1| hypothetical protein AT4G25070 [Arabidopsis thaliana]
 gb|AEE84998.1| uncharacterized protein AT4G25070 [Arabidopsis thaliana]
Length=765

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            +PK+ E  ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +SH
Sbjct  660  EPKFSETFELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSSH  719

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKE  153
            DA+DVE+G+ ELRKLGIE +LWE SRKE
Sbjct  720  DAIDVERGMRELRKLGIEQQLWETSRKE  747



>ref|XP_010493493.1| PREDICTED: uncharacterized protein LOC104770731 [Camelina sativa]
Length=555

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            +++E  EL   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + PTS D
Sbjct  449  RFVETYELKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPTSQD  508

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
             VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  509  VVDVERGLLELRKLGVEQQLWEACRKETDQ  538



>ref|XP_009615103.1| PREDICTED: uncharacterized protein LOC104107890 [Nicotiana tomentosiformis]
Length=243

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
             + EA ELSPEE+EDV FK+AWLTY WRR K  G+E +IA ++LQFWI +  +  TSHDA
Sbjct  143  NFSEAFELSPEETEDVQFKQAWLTYLWRRTKNHGVEPDIAEERLQFWINQGGQPLTSHDA  202

Query  230  VDVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            V VE+GL+EL+KLGIE +LW+ SR+  D +++
Sbjct  203  VHVERGLIELKKLGIETQLWKESRRSIDPENT  234



>ref|XP_011032546.1| PREDICTED: uncharacterized protein LOC105131319 [Populus euphratica]
Length=703

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
            +EA ELS EESEDV FK+AWLTYFWRRAK  G+E +IA ++LQFW   S+ S +SHDAVD
Sbjct  605  LEAFELSQEESEDVRFKQAWLTYFWRRAKNHGLEPDIAEERLQFWTNHSSRSSSSHDAVD  664

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            VE+GLMELRKLGIE++LW+ASR+  + DS+
Sbjct  665  VERGLMELRKLGIENQLWQASRRGLEVDSN  694



>gb|ABA93965.1| expressed protein [Oryza sativa Japonica Group]
Length=802

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + PTSH
Sbjct  676  DEKFTEAFDLSKEEEEDVLFKQAWLVYFWRRAKTHNVEDDIAEERLQMWIDRHGQQPTSH  735

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  736  DAVDVDMGIRELRRLGIEQLLWELSRREAN  765



>gb|KFK29000.1| hypothetical protein AALP_AA7G076100 [Arabis alpina]
Length=686

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS +E +D+LFKEAWL Y+W+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  583  KFSEAFELSEDEHQDILFKEAWLLYYWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  642

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SR E
Sbjct  643  VDVERGMRELRKLGIEQQLWETSRTE  668



>gb|KFK29001.1| hypothetical protein AALP_AA7G076100 [Arabis alpina]
Length=684

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDA  231
            K+ EA ELS +E +D+LFKEAWL Y+W+RAK  G+E +IA ++LQFWI R  + P+SHDA
Sbjct  581  KFSEAFELSEDEHQDILFKEAWLLYYWKRAKIHGVESDIAEERLQFWINRLGQQPSSHDA  640

Query  230  VDVEQGLMELRKLGIEHRLWEASRKE  153
            VDVE+G+ ELRKLGIE +LWE SR E
Sbjct  641  VDVERGMRELRKLGIEQQLWETSRTE  666



>ref|XP_010421179.1| PREDICTED: uncharacterized protein LOC104706668 [Camelina sativa]
Length=548

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            +++E  E+   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + PTS D
Sbjct  441  RFVETYEIKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPTSQD  500

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
             VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  501  VVDVERGLLELRKLGVEQQLWEACRKETDQ  530



>ref|XP_006404211.1| hypothetical protein EUTSA_v10010238mg [Eutrema salsugineum]
 gb|ESQ45664.1| hypothetical protein EUTSA_v10010238mg [Eutrema salsugineum]
Length=579

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA ++ Q WI RS  +SPTSHD
Sbjct  473  RFIDAYELGEAEQEDVTFKQAWLLYFWSRAKLHGVEEDIAEERFQLWISRSNGKSPTSHD  532

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            ++DVE+GL ELRKLGIE +LWEASR+E DQ
Sbjct  533  SLDVERGLTELRKLGIEQQLWEASRREIDQ  562



>ref|XP_009149792.1| PREDICTED: uncharacterized protein LOC103873113 [Brassica rapa]
Length=575

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS  +S TSHD
Sbjct  469  RFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSNGKSTTSHD  528

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            ++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  529  SLDVERGLIELRKLGIEQQLWEASRREIDQ  558



>ref|NP_001067981.2| Os11g0520500 [Oryza sativa Japonica Group]
 dbj|BAF28344.2| Os11g0520500 [Oryza sativa Japonica Group]
Length=831

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDVLFK+AWL YFWRRAK   +E++IA ++LQ WI R  + PTSH
Sbjct  704  DEKFTEAFDLSKEEEEDVLFKQAWLVYFWRRAKTHNVEDDIAEERLQMWIDRHGQQPTSH  763

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDV+ G+ ELR+LGIE  LWE SR+E +
Sbjct  764  DAVDVDMGIRELRRLGIEQLLWELSRREAN  793



>emb|CDY05877.1| BnaC08g20540D [Brassica napus]
Length=567

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            ++++A EL   E EDV FK+AWL YFW RAK LG+EE+IA +++Q WI RS  +S TSHD
Sbjct  461  RFVDAYELGEAEQEDVAFKQAWLMYFWGRAKLLGVEEDIAEERVQLWISRSNGKSTTSHD  520

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            ++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  521  SLDVERGLIELRKLGIEQQLWEASRREIDQ  550



>ref|XP_009772645.1| PREDICTED: uncharacterized protein LOC104222992 isoform X1 [Nicotiana 
sylvestris]
Length=653

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            + EA ELSPEE+EDV FK+AWLTY WRRAK  G+E +IA ++LQFWI +  +  TSHDAV
Sbjct  554  FSEAFELSPEETEDVQFKQAWLTYLWRRAKNHGVEPDIAEERLQFWINQGGQPLTSHDAV  613

Query  227  DVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
             VE+GL+EL+KLGIE +LW+ SR+  D +++
Sbjct  614  HVERGLIELKKLGIETQLWKESRRSIDPENT  644



>ref|XP_009342037.1| PREDICTED: fas-binding factor 1-like [Pyrus x bretschneideri]
Length=695

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP-TSHDAVD  225
            EA  LS EESED+LFK+AWL YFWRRAK  G+E +IA+++LQFWI  +++SP TSHDAVD
Sbjct  597  EAFVLSKEESEDILFKQAWLAYFWRRAKNHGVEPDIADERLQFWINHNSKSPATSHDAVD  656

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            VE+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  657  VERGLLELKKLGIETQLWRESRKWLEHDS  685



>ref|XP_009595702.1| PREDICTED: uncharacterized protein LOC104091958 [Nicotiana tomentosiformis]
Length=144

 Score =   110 bits (276),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            + EA ELSPEE+EDV FK+AWLTY WRRAK  G+E +IA ++LQFWI +  +  TSHDAV
Sbjct  48   FSEAFELSPEETEDVQFKQAWLTYLWRRAKNHGVEPDIAEERLQFWINQGGQPLTSHDAV  107

Query  227  DVEQGLMELRKLGIEHRLWEASR  159
             VE+GL+EL+KLGIE +LW+  R
Sbjct  108  HVERGLIELKKLGIETQLWKECR  130



>ref|XP_008388995.1| PREDICTED: uncharacterized protein LOC103451360 [Malus domestica]
Length=671

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP-TSHDAVD  225
            EA ELS EESEDVLFK+AWL YFWRRA   G+E +IA+++LQFWI  +++SP TSHDAVD
Sbjct  573  EAFELSKEESEDVLFKQAWLAYFWRRAXNHGVEPDIADERLQFWINHNSKSPATSHDAVD  632

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDS  138
            +E+GL+EL+KLGIE +LW  SRK  + DS
Sbjct  633  LERGLLELKKLGIETQLWRESRKWLEHDS  661



>ref|XP_010327287.1| PREDICTED: uncharacterized protein LOC101260484 [Solanum lycopersicum]
Length=592

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            + E+ ELSPEESEDV FK+AWLTYFWRRAK   +E +IA ++LQFWI +S +  TSHDAV
Sbjct  493  FTESYELSPEESEDVQFKQAWLTYFWRRAKNHEVEADIAEERLQFWINQSGQPLTSHDAV  552

Query  227  DVEQGLMELRKLGIEHRLWEASRKETDQDSS  135
             VE+GL+EL+KLGIE +LW+ +R+  D +++
Sbjct  553  HVERGLIELKKLGIETQLWQETRRSIDPENT  583



>ref|XP_008370656.1| PREDICTED: uncharacterized protein LOC103434129 [Malus domestica]
Length=124

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESP-TSHDAV  228
             EA  LS EESED+LFK+AWL YFWRRAK   +E +IA+++LQFWI  +++SP TS DAV
Sbjct  25   FEAFVLSKEESEDILFKQAWLAYFWRRAKNHEVEPDIADERLQFWINHNSKSPATSQDAV  84

Query  227  DVEQGLMELRKLGIEHRLWEASRKETDQDS  138
            DVE+GL+EL+KLGIE +LW  SRK  + +S
Sbjct  85   DVERGLLELKKLGIETQLWRESRKWLEHBS  114



>ref|XP_006394633.1| hypothetical protein EUTSA_v10003911mg [Eutrema salsugineum]
 gb|ESQ31919.1| hypothetical protein EUTSA_v10003911mg [Eutrema salsugineum]
Length=571

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHDA  231
            +    EL   E EDV FK+AWL YFW RA   G+EE+IA+++LQFWI RS  ++PTSHDA
Sbjct  464  HFSNAELKEGEQEDVAFKQAWLMYFWGRATLHGVEEDIADERLQFWISRSGGKTPTSHDA  523

Query  230  VDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            VDVE+GL+ELRKLGIE +LWEA RK+T+Q
Sbjct  524  VDVERGLLELRKLGIEQQLWEACRKDTNQ  552



>ref|XP_010454658.1| PREDICTED: uncharacterized protein LOC104736385 [Camelina sativa]
Length=556

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHD  234
            +++E  E+   E EDV FK+AWL YFW RAK  G+EE+IA+++LQFWI RS  + P+S D
Sbjct  451  RFVETYEIKEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERLQFWISRSEGKFPSSQD  510

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
             VDVE+GL+ELRKLG+E +LWEA RKETDQ
Sbjct  511  VVDVERGLLELRKLGVEQQLWEACRKETDQ  540



>emb|CDP18381.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            + EA ELSPEESEDV FKEAWL YFWRRAK  G+E +IA ++LQFWI +    P S+ AV
Sbjct  523  FAEAFELSPEESEDVRFKEAWLAYFWRRAKNHGVEPDIAEERLQFWISQGNGVPNSNTAV  582

Query  227  DVEQGLMELRKLGIEHRLWEASRKETD  147
            D E+GL+EL+KLGIE +LWE SRK  D
Sbjct  583  DAERGLIELKKLGIEIQLWEESRKMID  609



>ref|XP_008678157.1| PREDICTED: protein SOGA3-like [Zea mays]
 gb|AFW60866.1| hypothetical protein ZEAMMB73_571867 [Zea mays]
Length=715

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            D K+ EA +LS EE EDV FK+AWL +FWRRAK   +EE+IA ++L  WI R  + PTSH
Sbjct  613  DEKFTEAFDLSKEEEEDVQFKQAWLIFFWRRAKTNNVEEDIAEERLHMWIDRHGQQPTSH  672

Query  236  DAVDVEQGLMELRKLGIEHRLWEASRKETD  147
            DAVDVEQG+ ELRKLGIE  LWE SR E +
Sbjct  673  DAVDVEQGIHELRKLGIEQLLWELSRHEAN  702



>ref|XP_009381579.1| PREDICTED: uncharacterized protein LOC103969678 [Musa acuminata 
subsp. malaccensis]
Length=565

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELS EESEDVLFK+AWL YFWRR K   +EE+IA+++LQFWI +S  SPTSHDAV+V
Sbjct  476  EAFELSQEESEDVLFKQAWLAYFWRRVKDHDLEEDIADERLQFWIEQSNHSPTSHDAVEV  535

Query  221  EQGLMELRKLGIEHRLWEAS--RKETDQDS  138
            E+GL EL+KLGIE +LWEA   R E   D+
Sbjct  536  ERGLFELKKLGIELQLWEACHHRSEAPSDT  565



>ref|XP_009781778.1| PREDICTED: uncharacterized protein LOC104230617 isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY+EA ELSPEESEDVLFKEAWLTYFWRRAKA GI+E+ ANK  QFW  RS  +PTSH
Sbjct  471  DPKYIEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIQEDKANKNFQFWSSRSGHAPTSH  530

Query  236  DAVDVEQGL  210
            DAVD E+ +
Sbjct  531  DAVDDERNV  539



>gb|KFK34186.1| hypothetical protein AALP_AA5G111700 [Arabis alpina]
Length=581

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = -2

Query  410  KYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSA-ESPTSHD  234
            ++++A EL   E EDV FK+AWL YFW RAK  G+EE+IA +++Q WI RS+ +S TSHD
Sbjct  475  RFIDAYELGEAEQEDVAFKQAWLMYFWGRAKLHGVEEDIAEERVQLWISRSSGKSATSHD  534

Query  233  AVDVEQGLMELRKLGIEHRLWEASRKETDQ  144
            ++DVE+GL+ELRKLGIE +LWEASR+E DQ
Sbjct  535  SLDVERGLIELRKLGIEQQLWEASRREIDQ  564



>ref|XP_010039005.1| PREDICTED: uncharacterized protein LOC104427641 [Eucalyptus grandis]
Length=541

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 10/100 (10%)
 Frame = -2

Query  407  YMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAV  228
            ++   +LS EE+ED+LFK+AWLTYFWRRA    IEE+IA ++LQ WIGRS ++P+ HDAV
Sbjct  435  WVRGNQLSKEEAEDILFKQAWLTYFWRRAVVHHIEEDIARERLQSWIGRSGQTPSPHDAV  494

Query  227  DVEQGLMELRKLGIEHRLWEASRKETDQDSSLIGK*LHPP  108
            +VE+G  EL+KLGIE +LWEASRK TD          HPP
Sbjct  495  EVERGSRELQKLGIERQLWEASRKLTD----------HPP  524



>ref|XP_006471854.1| PREDICTED: golgin candidate 5-like [Citrus sinensis]
Length=881

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELSPEESED  FK+AWLTYFWRRAK  G+E +IA+ + +FW+  S +S +S DAVDV
Sbjct  786  EAFELSPEESEDTRFKQAWLTYFWRRAKDHGVESDIADDRFEFWVVHSGQSSSSQDAVDV  845

Query  221  EQGLMELRKLGIEHRLWEASRKETDQD  141
            E+GL ELRKLG+E +LW+ SRK  ++D
Sbjct  846  ERGLAELRKLGLESQLWQRSRKGLEED  872



>emb|CAB36749.1| putative protein [Arabidopsis thaliana]
 emb|CAB79416.1| putative protein [Arabidopsis thaliana]
Length=317

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDVEQG  213
            ELS +E +D+LFKEAWL YFW+RAK  G+E +IA ++LQFWI R  +  +SHDA+DVE+G
Sbjct  220  ELSHDEQQDILFKEAWLLYFWKRAKIHGVESDIAEERLQFWINRLGQHSSSHDAIDVERG  279

Query  212  LMELRKLGIEHRLWEASRKE  153
            + ELRKLGIE +LWE SRKE
Sbjct  280  MRELRKLGIEQQLWETSRKE  299



>gb|AES82578.2| ripening-regulated protein [Medicago truncatula]
Length=637

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
             +A +LS EE++DV+FK+AWLTY WRRAK   IE EIA+++LQ+WI  ++++PTS DAVD
Sbjct  538  CDAFQLSQEEAQDVIFKQAWLTYIWRRAKRHEIEPEIADERLQYWIDHNSKTPTSQDAVD  597

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            VE+GL E+RKLGIE +LW+ SRKE +Q+++
Sbjct  598  VERGLAEIRKLGIETQLWDESRKELEQETN  627



>gb|KGN60847.1| hypothetical protein Csa_2G013280 [Cucumis sativus]
Length=661

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = -2

Query  401  EAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVDV  222
            EA ELSPEESEDV FK+AWLTYFW+RAK   +E +IA+++L+FWI  + +S TSHDAVDV
Sbjct  566  EAFELSPEESEDVAFKQAWLTYFWKRAKLDELEPDIADERLEFWINHTNKS-TSHDAVDV  624

Query  221  EQGLMELRKLGIEHRLWEASRK  156
            E+GL+ELRKLGIE++LWE SR+
Sbjct  625  ERGLIELRKLGIENQLWERSRR  646



>ref|XP_003626360.1| hypothetical protein MTR_7g114220 [Medicago truncatula]
Length=661

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  404  MEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSHDAVD  225
             +A +LS EE++DV+FK+AWLTY WRRAK   IE EIA+++LQ+WI  ++++PTS DAVD
Sbjct  562  CDAFQLSQEEAQDVIFKQAWLTYIWRRAKRHEIEPEIADERLQYWIDHNSKTPTSQDAVD  621

Query  224  VEQGLMELRKLGIEHRLWEASRKETDQDSS  135
            VE+GL E+RKLGIE +LW+ SRKE +Q+++
Sbjct  622  VERGLAEIRKLGIETQLWDESRKELEQETN  651



>ref|XP_006368855.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
 gb|ERP65424.1| hypothetical protein POPTR_0001s13160g [Populus trichocarpa]
Length=538

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  416  DPKYMEAIELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRSAESPTSH  237
            DPKY EA ELSPEESEDVLFKEAWLTYFWRRAKA GIEE+ A ++ QFWI RSA SP+SH
Sbjct  447  DPKYTEAFELSPEESEDVLFKEAWLTYFWRRAKAHGIEEDTAKERFQFWISRSAHSPSSH  506

Query  236  DAVD  225
            DAVD
Sbjct  507  DAVD  510



>ref|XP_002872068.1| hypothetical protein ARALYDRAFT_489231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48327.1| hypothetical protein ARALYDRAFT_489231 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  392  ELSPEESEDVLFKEAWLTYFWRRAKALGIEEEIANKQLQFWIGRS-AESPTSHDAVDVEQ  216
            EL   E EDV FK+AWL YFW RAK  G+EE+IA++++QFWI RS  ++PTS D VDVE+
Sbjct  456  ELKEGEQEDVAFKQAWLMYFWGRAKLHGVEEDIADERMQFWISRSDGKNPTSQDVVDVER  515

Query  215  GLMELRKLGIEHRLWEASRKETDQ  144
            G++ELRKLG+E +LWEA RKETDQ
Sbjct  516  GMLELRKLGVEQQLWEACRKETDQ  539



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700