BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF005C09

Length=126
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB54393.1|  hypothetical protein B456_009G074800                  79.7    1e-16   Gossypium raimondii
gb|ABR16109.1|  unknown                                               79.7    2e-16   Picea sitchensis
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein     79.7    4e-16   Gossypium arboreum [tree cotton]
gb|ACN39798.1|  unknown                                               79.7    4e-16   Picea sitchensis
gb|ABK24112.1|  unknown                                               79.7    4e-16   Picea sitchensis
gb|KJB54391.1|  hypothetical protein B456_009G074800                  77.4    5e-16   Gossypium raimondii
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative       79.3    5e-16   Ricinus communis
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase           79.3    5e-16   Fritillaria agrestis
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein     79.0    6e-16   Gossypium arboreum [tree cotton]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase   79.0    7e-16   Nelumbo nucifera [Indian lotus]
gb|KJB54389.1|  hypothetical protein B456_009G074800                  79.0    7e-16   Gossypium raimondii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase              78.2    8e-16   Morus notabilis
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg              78.2    9e-16   Erythranthe guttata [common monkey flower]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase   78.6    9e-16   Brassica rapa
emb|CDX81443.1|  BnaC09g08540D                                        78.6    9e-16   
emb|CDY37208.1|  BnaA09g08290D                                        78.6    9e-16   Brassica napus [oilseed rape]
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg           78.6    1e-15   
gb|AEX09246.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia elatior
emb|CDP08481.1|  unnamed protein product                              78.2    1e-15   Coffea canephora [robusta coffee]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...  78.2    1e-15   
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase   78.2    1e-15   Pyrus x bretschneideri [bai li]
gb|AEX09256.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia bracteata
gb|AEX09306.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia peruviana
gb|AEX09262.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia aff. ovatopeltata JN-2011
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1    78.2    1e-15   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase   78.2    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase   78.2    1e-15   Malus domestica [apple tree]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia bracteata
dbj|BAJ33858.1|  unnamed protein product                              78.6    1e-15   Eutrema halophilum
gb|AEX09276.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia parvisagittata
gb|AEX09267.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia radiatinervosa
gb|AEX09288.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia parvisagittata
gb|AEX09252.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia exclamationis
gb|AEX09287.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia cerrateae
gb|AEX09248.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia questionis
gb|AEX09282.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia cerrateae
gb|AEX09275.1|  alanine glyoxylate aminotransferase                   77.8    1e-15   Peperomia parvisagittata
gb|AEX09273.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia cerrateae
gb|AEX09302.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia sp. JN-2011
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase   78.2    1e-15   
gb|AEX09310.1|  alanine glyoxylate aminotransferase                   77.0    1e-15   Peperomia wernerrauhii
gb|AGT38285.1|  serine--glyoxylate aminotransferase                   78.2    1e-15   Gossypium hirsutum [American cotton]
gb|AEX09292.1|  alanine glyoxylate aminotransferase                   77.0    1e-15   Peperomia klopfensteinii
gb|AEX09294.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia sp. JN-2011
gb|AEX09268.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia peruviana
gb|AEX09244.1|  alanine glyoxylate aminotransferase                   77.0    1e-15   Peperomia basiradicans
gb|AEX09253.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia bracteata
ref|NP_001265946.1|  Hop-interacting protein THI032                   77.8    1e-15   Solanum lycopersicum
gb|AEX09309.1|  alanine glyoxylate aminotransferase                   77.0    1e-15   Peperomia wernerrauhii
gb|KJB83533.1|  hypothetical protein B456_013G252200                  77.4    1e-15   Gossypium raimondii
gb|AEX09283.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia peruviana
gb|AEX09242.1|  alanine glyoxylate aminotransferase                   77.0    1e-15   Peperomia aff. pinoi JN-2011
gb|AEX09257.1|  alanine glyoxylate aminotransferase                   77.4    1e-15   Peperomia bracteata
gb|AEX09266.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia peruviana
gb|AEX09274.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia peruviana
gb|AEX09243.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia sp. JN-2011
gb|AEX09265.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia radiatinervosa
gb|AEX09298.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia cerrateae
gb|AEX09259.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia bracteata
gb|AEX09258.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia cavispicata
gb|AEX09295.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia pugnicaudex
gb|AEX09299.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia cerrateae
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g           76.3    2e-15   
gb|AEX09286.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia aff. gracillima JN-2011
gb|AEX09290.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia dolabella
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like         77.8    2e-15   Cucumis melo [Oriental melon]
gb|AEX09270.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia verruculosa
gb|AEX09245.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia putlaensis
gb|AEX09308.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia polycephala
gb|AEX09301.1|  alanine glyoxylate aminotransferase                   77.4    2e-15   Peperomia sp. JN-2011
gb|AEX09303.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia ayacuchoana
gb|AAL62332.1|AF461048_1  aminotransferase 2                          77.8    2e-15   Cucumis melo [Oriental melon]
gb|AEX09291.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia jalcaensis
gb|AEX09269.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia peruviana
gb|AEX09293.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia rupiseda
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...  77.8    2e-15   Cucumis melo [Oriental melon]
gb|AEX09304.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia chutanka
gb|AEX09263.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia putlaensis
gb|AEX09285.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia radiatinervosa
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like         77.8    2e-15   Glycine max [soybeans]
gb|ABQ81924.1|  aminotransferase 2                                    77.8    2e-15   Cucumis sativus [cucumbers]
gb|ABQ81922.1|  aminotransferase 2                                    77.8    2e-15   Cucumis sativus [cucumbers]
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase   77.4    2e-15   Nicotiana sylvestris
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase   77.4    2e-15   Nicotiana tomentosiformis
gb|AEX09254.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia bracteata
gb|AEX09251.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia schizandra
gb|AEX09271.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia peruviana
gb|AEX09250.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia schizandra
gb|AEX09261.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia aff. ovatopeltata JN-2011
gb|AEX09284.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia peruviana
gb|AEX09289.1|  alanine glyoxylate aminotransferase                   76.3    2e-15   Peperomia gigantea
ref|NP_001237048.1|  enzymatic resistance protein                     77.4    2e-15   
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                   77.4    2e-15   Glycine soja [wild soybean]
gb|AEX09264.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia radiatinervosa
gb|AEX09277.1|  alanine glyoxylate aminotransferase                   77.0    2e-15   Peperomia cyclaminoides
gb|AEX09307.1|  alanine glyoxylate aminotransferase                   76.6    2e-15   Peperomia verruculosa
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase   77.4    2e-15   Prunus mume [ume]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase   77.4    3e-15   Fragaria vesca subsp. vesca
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg           77.4    3e-15   Prunus persica
gb|EPS59280.1|  serine-glyoxylate aminotransferase                    77.4    3e-15   Genlisea aurea
gb|AEX09281.1|  alanine glyoxylate aminotransferase                   76.3    3e-15   Peperomia cyclaminoides
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase   77.0    3e-15   Phoenix dactylifera
gb|AAQ56193.1|  aminotransferase 2                                    77.0    3e-15   Cucumis melo [Oriental melon]
gb|AAL47679.1|  aminotransferase 1                                    77.0    3e-15   Cucumis melo [Oriental melon]
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080        77.0    3e-15   Sorghum bicolor [broomcorn]
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...  77.0    3e-15   Elaeis guineensis
gb|AEX09272.1|  alanine glyoxylate aminotransferase                   76.3    3e-15   Peperomia cyclaminoides
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...  77.0    3e-15   Cucumis sativus [cucumbers]
ref|NP_001284450.1|  serine--glyoxylate aminotransferase              77.0    3e-15   Cucumis melo [Oriental melon]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305           77.0    3e-15   
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...  77.0    3e-15   
gb|AFK37194.1|  unknown                                               75.1    3e-15   Medicago truncatula
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase   77.0    4e-15   Eucalyptus grandis [rose gum]
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g           76.6    4e-15   
gb|AEA48973.1|  glyoxylate aminotransferase                           74.3    4e-15   Rosa roxburghii [chestnut rose]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...  76.6    4e-15   Cucumis sativus [cucumbers]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                    76.6    4e-15   Spirodela polyrhiza
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase   77.0    4e-15   Brachypodium distachyon [annual false brome]
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                   75.5    4e-15   
emb|CDX89604.1|  BnaC03g45180D                                        76.6    4e-15   
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...  76.6    4e-15   Brassica rapa
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase   76.6    5e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|ABQ81925.1|  aminotransferase 2                                    76.6    5e-15   Cucumis melo [Oriental melon]
gb|ACN36238.1|  unknown                                               75.5    6e-15   Zea mays [maize]
gb|ABF70331.1|  aminotransferase 1                                    76.3    6e-15   Cucumis sativus [cucumbers]
gb|AEX09300.1|  alanine glyoxylate aminotransferase                   75.9    6e-15   Peperomia parvifolia
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...  76.6    6e-15   
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...  74.7    6e-15   
gb|AEX09305.1|  alanine glyoxylate aminotransferase                   75.9    6e-15   Peperomia pseudoverruculosa
gb|KDP35982.1|  hypothetical protein JCGZ_08377                       76.3    7e-15   Jatropha curcas
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g           75.1    7e-15   
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...  76.3    7e-15   Sesamum indicum [beniseed]
gb|ABK96624.1|  unknown                                               76.3    7e-15   Populus trichocarpa x Populus deltoides
ref|XP_002313371.1|  aminotransferase 2 family protein                75.9    7e-15   
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.9    8e-15   Oryza brachyantha
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.9    8e-15   Setaria italica
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.9    8e-15   Populus euphratica
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349            74.3    8e-15   
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g           75.9    8e-15   Populus trichocarpa [western balsam poplar]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                75.9    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.9    8e-15   Solanum tuberosum [potatoes]
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase   75.9    8e-15   Sesamum indicum [beniseed]
gb|AEX09311.1|  alanine glyoxylate aminotransferase                   75.5    8e-15   Peperomia andina
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase              75.9    9e-15   
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890        75.9    9e-15   Amborella trichopoda
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...  76.3    9e-15   Camelina sativa [gold-of-pleasure]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                   75.1    9e-15   Peperomia peruviana
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase   75.9    1e-14   Populus euphratica
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                   75.9    1e-14   Triticum urartu
dbj|BAJ90006.1|  predicted protein                                    75.9    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...  75.5    1e-14   Glycine max [soybeans]
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                  72.4    1e-14   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389            75.1    1e-14   
emb|CAN84001.1|  hypothetical protein VITISV_007680                   75.5    1e-14   Vitis vinifera
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase              75.5    1e-14   Medicago truncatula
ref|NP_001148339.1|  LOC100281949                                     75.5    1e-14   Zea mays [maize]
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase   75.5    1e-14   Vitis vinifera
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                  75.5    1e-14   Glycine max [soybeans]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.5    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...  75.5    1e-14   Camelina sativa [gold-of-pleasure]
emb|CBI24214.3|  unnamed protein product                              74.7    2e-14   Vitis vinifera
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg           75.1    2e-14   Capsella rubella
gb|ABR26184.1|  serine-glyoxylate aminotransferase                    72.4    2e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001062170.1|  Os08g0502700                                     74.7    2e-14   
gb|AAQ56192.1|  aminotransferase 1                                    74.7    2e-14   Cucumis melo [Oriental melon]
gb|AEX09260.1|  alanine glyoxylate aminotransferase                   73.6    2e-14   Peperomia aff. ovatopeltata JN-2011
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946            72.0    3e-14   
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase   74.3    4e-14   Elaeis guineensis
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...  74.3    4e-14   Cicer arietinum [garbanzo]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g           73.9    4e-14   Phaseolus vulgaris [French bean]
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                  73.9    4e-14   Phaseolus vulgaris [French bean]
gb|AFK40703.1|  unknown                                               73.9    4e-14   Medicago truncatula
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                73.2    6e-14   Citrus sinensis [apfelsine]
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase              72.8    6e-14   
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg           73.6    6e-14   Citrus clementina [clementine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...  73.2    8e-14   Citrus sinensis [apfelsine]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                73.2    9e-14   Citrus sinensis [apfelsine]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase   72.4    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase              72.0    2e-13   Medicago truncatula
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...  72.0    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                  71.6    3e-13   Glycine max [soybeans]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase              69.3    1e-12   
ref|XP_001755667.1|  predicted protein                                67.0    1e-11   
ref|XP_001783551.1|  predicted protein                                67.0    1e-11   
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066           65.5    5e-11   Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964           64.3    1e-10   
ref|WP_040969922.1|  serine--glyoxylate aminotransferase              64.3    1e-10   Mesorhizobium sp. ORS 3324
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...  64.3    1e-10   Mesorhizobium
gb|AID30749.1|  serine--glyoxylate aminotransferase                   62.4    2e-10   Mesorhizobium huakuii 7653R
ref|WP_032930697.1|  serine--glyoxylate aminotransferase              63.2    4e-10   Mesorhizobium
ref|WP_019858769.1|  serine--glyoxylate aminotransferase              63.2    4e-10   Mesorhizobium loti
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                    62.8    4e-10   Hyphomicrobium nitrativorans NL23
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279           62.8    4e-10   Selaginella moellendorffii
ref|WP_031597721.1|  serine--glyoxylate aminotransferase              62.8    4e-10   Ferrovum
ref|WP_041319044.1|  serine--glyoxylate aminotransferase              62.8    4e-10   Hyphomicrobium nitrativorans
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375           62.8    5e-10   Selaginella moellendorffii
ref|WP_018238561.1|  serine--glyoxylate aminotransferase              62.4    6e-10   Ensifer sp. BR816
ref|XP_005648727.1|  serine glyoxylate aminotransferase               62.4    6e-10   Coccomyxa subellipsoidea C-169
ref|WP_026227793.1|  serine--glyoxylate aminotransferase              62.4    6e-10   Hoeflea sp. 108
ref|WP_010910076.1|  serine--glyoxylate aminotransferase              62.4    6e-10   Mesorhizobium japonicum
ref|WP_018329867.1|  serine--glyoxylate aminotransferase              62.0    7e-10   Rhizobium giardinii
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...  62.0    8e-10   Mesorhizobium
ref|WP_042643125.1|  serine--glyoxylate aminotransferase              62.0    9e-10   Mesorhizobium sp. ORS 3359
ref|WP_023698325.1|  serine--glyoxylate aminotransferase              62.0    9e-10   Mesorhizobium sp. LSJC265A00
ref|WP_023685219.1|  serine--glyoxylate aminotransferase              62.0    9e-10   Mesorhizobium sp. LSJC277A00
ref|WP_023827347.1|  serine--glyoxylate aminotransferase              62.0    9e-10   Mesorhizobium sp. L103C131B0
ref|WP_023805485.1|  serine--glyoxylate aminotransferase              61.6    1e-09   Mesorhizobium sp. L2C089B000
ref|WP_028755163.1|  serine--glyoxylate aminotransferase              61.6    1e-09   Rhizobium leucaenae
ref|WP_034858116.1|  serine--glyoxylate aminotransferase              61.6    1e-09   Ensifer sojae
ref|WP_023714322.1|  serine--glyoxylate aminotransferase              61.6    1e-09   Mesorhizobium sp. LSHC422A00
ref|WP_026616975.1|  serine--glyoxylate aminotransferase              61.6    1e-09   Sinorhizobium/Ensifer group
ref|WP_037399704.1|  serine--glyoxylate aminotransferase              60.5    1e-09   Sinorhizobium fredii
ref|WP_037437034.1|  serine--glyoxylate aminotransferase              60.1    1e-09   
ref|WP_037460312.1|  serine--glyoxylate aminotransferase              60.1    2e-09   Sinorhizobium fredii
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...  61.2    2e-09   Methylocystaceae
ref|WP_037429341.1|  serine--glyoxylate aminotransferase              60.1    2e-09   Sinorhizobium fredii
ref|WP_027044922.1|  serine--glyoxylate aminotransferase              61.2    2e-09   Mesorhizobium sp. URHC0008
ref|WP_036293367.1|  serine--glyoxylate aminotransferase              61.2    2e-09   Methylosinus
ref|WP_040981991.1|  serine--glyoxylate aminotransferase              61.2    2e-09   Mesorhizobium plurifarium
ref|WP_018267457.1|  serine--glyoxylate aminotransferase              61.2    2e-09   Methylosinus sp. LW4
ref|WP_014955398.1|  serine--glyoxylate aminotransferase              60.8    2e-09   alpha proteobacterium HIMB59
ref|WP_037447404.1|  serine--glyoxylate aminotransferase              60.1    2e-09   Sinorhizobium fredii
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_023822176.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. L2C054A000
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_037384071.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Sinorhizobium americanum
ref|WP_027146511.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. WSM3626
ref|WP_023700366.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. LSJC264A00
ref|WP_015317366.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium australicum
ref|XP_001763095.1|  predicted protein                                60.8    2e-09   
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_023670792.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. LSJC285A00
ref|WP_013217108.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Hyphomicrobium denitrificans
ref|WP_023833857.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. L103C105A0
ref|WP_013894918.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium opportunistum
ref|WP_023779196.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. LNHC221B00
ref|WP_023763335.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium sp. LNHC232B00
ref|WP_041011880.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium plurifarium
ref|WP_041007618.1|  serine--glyoxylate aminotransferase              60.8    2e-09   Mesorhizobium plurifarium
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    2e-09   Mesorhizobium
ref|WP_023829410.1|  serine--glyoxylate aminotransferase              60.5    2e-09   Mesorhizobium sp. L103C120A0
ref|WP_041003840.1|  serine--glyoxylate aminotransferase              60.5    3e-09   Mesorhizobium sp. SOD10
ref|WP_037416404.1|  serine--glyoxylate aminotransferase              60.5    3e-09   Sinorhizobium sp. CCBAU 05631
ref|WP_014329402.1|  serine--glyoxylate aminotransferase              60.5    3e-09   Sinorhizobium fredii
ref|WP_027051273.1|  serine--glyoxylate aminotransferase              60.5    3e-09   Mesorhizobium erdmanii
ref|WP_040961132.1|  serine--glyoxylate aminotransferase              60.5    3e-09   Sinorhizobium fredii
ref|WP_023741624.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Mesorhizobium sp. LNJC395A00
ref|WP_014762956.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Sinorhizobium fredii
ref|WP_042673896.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Methylobacterium sp. B34
ref|WP_037283573.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Rubellimicrobium mesophilum
ref|WP_020092657.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Methylobacterium
ref|WP_007559580.1|  serine--glyoxylate aminotransferase              60.1    4e-09   Methylobacterium
ref|WP_026622911.1|  serine--glyoxylate aminotransferase              59.7    5e-09   Ensifer sp. WSM1721
ref|WP_027061369.1|  serine--glyoxylate aminotransferase              59.7    5e-09   Mesorhizobium loti
ref|WP_037131645.1|  serine--glyoxylate aminotransferase              59.7    6e-09   Rhizobium sp. CF097
ref|WP_006203221.1|  serine--glyoxylate aminotransferase              59.7    6e-09   Mesorhizobium amorphae
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...  59.7    6e-09   Methylobacterium
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...  59.7    6e-09   Mesorhizobium
ref|WP_023782620.1|  serine--glyoxylate aminotransferase              59.7    6e-09   Mesorhizobium sp. LNHC220B00
ref|WP_035937801.1|  serine--glyoxylate aminotransferase              59.7    7e-09   Caballeronia glathei
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...  59.3    7e-09   Hyphomicrobium methylovorum
ref|WP_003613273.1|  serine--glyoxylate aminotransferase              59.3    7e-09   Methylosinus
ref|WP_020188076.1|  hypothetical protein                             59.3    9e-09   Methylopila sp. 73B
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...  58.9    9e-09   Methylobacterium
ref|WP_043355705.1|  serine--glyoxylate aminotransferase              58.9    9e-09   Methylobacterium
ref|WP_015599474.1|  serine--glyoxylate aminotransferase              58.9    9e-09   Hyphomicrobium denitrificans
ref|WP_027029542.1|  serine--glyoxylate aminotransferase              58.9    1e-08   Mesorhizobium loti
gb|AIQ91949.1|  Aminotransferase class V                              58.9    1e-08   Methylobacterium oryzae CBMB20
ref|WP_035525480.1|  serine--glyoxylate aminotransferase              58.9    1e-08   Paraburkholderia sacchari
ref|WP_023818017.1|  serine--glyoxylate aminotransferase              58.9    1e-08   Mesorhizobium sp. L2C066B000
ref|WP_023690293.1|  serine--glyoxylate aminotransferase              58.9    1e-08   Mesorhizobium sp. LSJC269B00
ref|WP_036284904.1|  serine--glyoxylate aminotransferase              58.9    1e-08   Methylocystis sp. ATCC 49242
ref|WP_012405153.1|  serine--glyoxylate aminotransferase              58.5    1e-08   Paraburkholderia phymatum
ref|WP_003535479.1|  serine--glyoxylate aminotransferase              58.5    1e-08   Sinorhizobium meliloti
ref|WP_026362994.1|  serine--glyoxylate aminotransferase              58.5    2e-08   Methylopila sp. M107
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...  58.5    2e-08   
ref|WP_010687105.1|  Aminotransferase class V                         58.2    2e-08   
ref|WP_017485211.1|  serine--glyoxylate aminotransferase              58.2    2e-08   
ref|WP_028367172.1|  serine--glyoxylate aminotransferase              58.2    2e-08   
emb|CAD13310.1|  serine-glyoxylate aminotransferase                   57.8    2e-08   
ref|WP_003597639.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_012253362.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_012453656.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_015950680.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_018405893.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_026175686.1|  serine--glyoxylate aminotransferase              57.8    2e-08   
ref|WP_014890662.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_041930245.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_029648781.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_042306504.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_012709136.1|  serine--glyoxylate aminotransferase              57.4    3e-08   
ref|WP_026597137.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_035994918.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|WP_007585769.1|  serine--glyoxylate aminotransferase              57.8    3e-08   
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980            57.8    3e-08   
gb|ABM96214.1|  serine-glyoxylate aminotransferase                    57.4    3e-08   
ref|WP_038511699.1|  serine--glyoxylate aminotransferase              57.4    4e-08   
ref|WP_011630756.1|  serine--glyoxylate aminotransferase              57.4    4e-08   
gb|KIZ03753.1|  serine--glyoxylate transaminase                       57.4    4e-08   
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...  57.4    4e-08   
ref|WP_038515723.1|  serine--glyoxylate aminotransferase              57.4    4e-08   
ref|WP_007742731.1|  serine--glyoxylate aminotransferase              57.4    4e-08   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase              57.0    4e-08   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                   57.4    4e-08   
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                      57.4    4e-08   
ref|WP_016921634.1|  serine--glyoxylate aminotransferase              57.4    4e-08   
ref|WP_027172630.1|  serine--glyoxylate aminotransferase              57.0    4e-08   
ref|WP_018410273.1|  serine--glyoxylate aminotransferase              57.0    4e-08   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                      57.0    5e-08   
ref|WP_026608295.1|  serine--glyoxylate aminotransferase              57.0    5e-08   
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                   56.6    5e-08   
ref|XP_001702106.1|  serine glyoxylate aminotransferase               57.0    6e-08   
ref|XP_001702107.1|  serine glyoxylate aminotransferase               57.0    6e-08   
gb|AAW29978.1|  serine:glyoxylate aminotransferase                    54.3    7e-08   
ref|WP_027168976.1|  serine--glyoxylate aminotransferase              56.6    7e-08   
ref|WP_026610206.1|  serine--glyoxylate aminotransferase              56.6    7e-08   
ref|WP_036260471.1|  serine--glyoxylate aminotransferase              56.6    8e-08   
ref|WP_028212654.1|  serine--glyoxylate aminotransferase              56.6    8e-08   
ref|WP_008058631.1|  serine--glyoxylate aminotransferase              56.2    9e-08   
ref|WP_036271184.1|  serine--glyoxylate aminotransferase              56.2    9e-08   
ref|WP_012590731.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
ref|WP_043363897.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
ref|WP_029644281.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
ref|WP_027999163.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
ref|WP_040580464.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
ref|WP_028223486.1|  serine--glyoxylate aminotransferase              55.8    1e-07   
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                  55.8    1e-07   
ref|WP_020085137.1|  serine--glyoxylate aminotransferase              55.5    2e-07   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase              55.5    2e-07   
ref|WP_017840623.1|  serine--glyoxylate aminotransferase              55.5    2e-07   
ref|WP_010960683.1|  serine--glyoxylate aminotransferase              55.5    2e-07   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase              55.1    2e-07   
ref|WP_014149643.1|  serine--glyoxylate aminotransferase              55.1    2e-07   
ref|WP_022947294.1|  serine--glyoxylate aminotransferase              55.1    2e-07   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase              55.1    2e-07   
ref|WP_023666824.1|  serine--glyoxylate aminotransferase              55.1    2e-07   
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase               54.3    4e-07   
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614            54.7    4e-07   
ref|WP_026223456.1|  serine--glyoxylate aminotransferase              54.3    4e-07   
ref|WP_015933415.1|  serine--glyoxylate aminotransferase              54.3    5e-07   
ref|WP_020592928.1|  hypothetical protein                             53.9    5e-07   
ref|WP_028097617.1|  serine--glyoxylate aminotransferase              53.9    5e-07   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase              53.9    5e-07   
ref|WP_029167381.1|  hypothetical protein                             52.0    6e-07   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase              53.9    6e-07   
ref|WP_012336184.1|  serine--glyoxylate aminotransferase              53.9    7e-07   
ref|WP_026190999.1|  serine--glyoxylate aminotransferase              53.9    7e-07   
ref|WP_019867322.1|  serine--glyoxylate aminotransferase              53.9    7e-07   
ref|XP_005709273.1|  serine--glyoxylate transaminase                  53.9    7e-07   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase              53.5    9e-07   
ref|WP_040618186.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_031434945.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
gb|EAP76585.1|  probable serine-glyoxylate aminotransferase           53.1    1e-06   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_013819317.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase              53.1    1e-06   
ref|WP_026850920.1|  serine--glyoxylate aminotransferase              52.8    2e-06   
ref|WP_036253086.1|  serine--glyoxylate aminotransferase              52.8    2e-06   
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...  52.8    2e-06   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase              52.8    2e-06   
ref|WP_027156802.1|  serine--glyoxylate aminotransferase              52.8    2e-06   
ref|WP_024519698.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase              52.4    2e-06   
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...  52.4    2e-06   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase              52.0    3e-06   
ref|WP_029313264.1|  serine--glyoxylate aminotransferase              52.0    3e-06   
ref|WP_020058450.1|  hypothetical protein                             52.0    3e-06   
ref|WP_025610703.1|  hypothetical protein                             49.7    3e-06   
ref|WP_024298006.1|  serine--glyoxylate aminotransferase              51.6    3e-06   
ref|WP_008133757.1|  hypothetical protein                             49.3    4e-06   
ref|WP_038380825.1|  serine--glyoxylate aminotransferase              49.3    4e-06   
ref|WP_005860686.1|  serine--glyoxylate aminotransferase              51.6    5e-06   
ref|WP_043355494.1|  serine--glyoxylate aminotransferase              51.2    5e-06   
ref|WP_044591882.1|  serine--glyoxylate aminotransferase              51.2    5e-06   
ref|WP_044541799.1|  serine--glyoxylate aminotransferase              51.2    5e-06   
ref|WP_012592368.1|  serine--glyoxylate aminotransferase              51.2    5e-06   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase              51.2    5e-06   
ref|WP_012179154.1|  serine--glyoxylate aminotransferase              50.8    6e-06   
ref|WP_008971186.1|  serine--glyoxylate aminotransferase              50.8    7e-06   
ref|WP_028164906.1|  serine--glyoxylate aminotransferase              50.8    7e-06   
ref|WP_021342150.1|  hypothetical protein                             48.1    7e-06   
ref|WP_027582443.1|  serine--glyoxylate aminotransferase              50.8    7e-06   
ref|WP_035724242.1|  serine--glyoxylate aminotransferase              50.4    1e-05   
ref|WP_025312373.1|  serine--glyoxylate aminotransferase              50.4    1e-05   
ref|WP_027528516.1|  serine--glyoxylate aminotransferase              50.4    1e-05   
ref|WP_043513639.1|  serine--glyoxylate aminotransferase              50.1    1e-05   
ref|WP_016841706.1|  hypothetical protein                             49.7    1e-05   
ref|WP_012045640.1|  serine--glyoxylate aminotransferase              50.1    2e-05   
ref|WP_036043885.1|  serine--glyoxylate aminotransferase              50.1    2e-05   
ref|WP_031437003.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_027564739.1|  MULTISPECIES: serine--glyoxylate aminotransf...  49.7    2e-05   
ref|WP_029079958.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_006890572.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_035632551.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_038386888.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_028337735.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_018272711.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_023263325.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_037245168.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_037268413.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_009817966.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_008280158.1|  serine--glyoxylate aminotransferase              49.7    2e-05   
ref|WP_021080443.1|  alanine-glyoxylate transaminase/serine-glyox...  49.7    2e-05   
ref|WP_018916328.1|  serine--glyoxylate aminotransferase              49.3    2e-05   
ref|WP_017611825.1|  hypothetical protein                             49.3    2e-05   
ref|WP_028347268.1|  serine--glyoxylate aminotransferase              49.3    2e-05   
ref|WP_028818976.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA         49.3    3e-05   
ref|WP_023473045.1|  Soluble hydrogenase 42 kDa subunit               49.3    3e-05   
ref|WP_029582576.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_036029019.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_036007465.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_028137632.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_027575745.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_027555031.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_025037568.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
gb|EJZ31342.1|  hypothetical protein BCCGELA001_25349                 49.3    3e-05   
ref|WP_024582729.1|  MULTISPECIES: serine--glyoxylate aminotransf...  49.3    3e-05   
ref|WP_035663872.1|  serine--glyoxylate aminotransferase              49.3    3e-05   
ref|WP_027545028.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_044456571.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_042112271.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_014493792.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_027519072.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_028149694.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_028156593.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_039152510.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_037380858.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_014989411.1|  serine--glyoxylate aminotransferase              48.9    3e-05   
ref|WP_039396834.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_018424060.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_043236046.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_041960533.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_007423690.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_035187593.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
dbj|BAJ80763.1|  serine--glyoxylate transaminase                      48.9    4e-05   
ref|WP_011942193.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_029454537.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_012355898.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_041664680.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_043283947.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_025581545.1|  serine--glyoxylate aminotransferase              48.9    4e-05   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_027531978.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_018314065.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_010814096.1|  MULTISPECIES: serine--glyoxylate aminotransf...  48.5    4e-05   
ref|WP_028820590.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_043145903.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_027102693.1|  serine--glyoxylate aminotransferase              48.5    4e-05   
ref|WP_018007582.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_036812108.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_042883991.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_013952800.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
emb|CDS49539.1|  Serine--glyoxylate aminotransferase                  48.5    5e-05   
ref|WP_011455723.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_012028894.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_039016289.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_035816226.1|  serine--glyoxylate aminotransferase              48.5    5e-05   
ref|WP_029524545.1|  serine--glyoxylate aminotransferase              48.5    6e-05   
ref|WP_014762541.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
ref|WP_038966989.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
emb|CEG09072.1|  Soluble hydrogenase 42 kDa subunit                   48.1    6e-05   
ref|WP_026622392.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
ref|WP_029964417.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
emb|CEG08573.1|  Soluble hydrogenase 42 kDa subunit                   48.1    6e-05   
ref|WP_002716390.1|  hypothetical protein                             48.1    6e-05   
ref|WP_011088780.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
gb|KJC34381.1|  serine--glyoxylate aminotransferase                   48.1    6e-05   
ref|WP_010239996.1|  serine--glyoxylate aminotransferase              48.1    6e-05   
ref|WP_015665549.1|  serine-glyoxylate aminotransferase               48.1    6e-05   
gb|KJC50868.1|  serine--glyoxylate aminotransferase                   48.1    7e-05   
ref|WP_006156375.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_011902445.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_018238011.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_015888023.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_040962653.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_037471319.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_026312024.1|  serine--glyoxylate aminotransferase              48.1    7e-05   
ref|WP_016417666.1|  serine--glyoxylate aminotransferase              48.1    8e-05   
ref|WP_006344742.1|  serine--glyoxylate aminotransferase              47.8    8e-05   
ref|WP_037401694.1|  serine--glyoxylate aminotransferase              47.8    8e-05   
ref|WP_009338915.1|  serine--glyoxylate aminotransferase (SgaT)       45.4    8e-05   
ref|WP_009340194.1|  serine--glyoxylate aminotransferase (SgaT)       45.4    8e-05   
ref|WP_036171023.1|  serine--glyoxylate aminotransferase              47.8    8e-05   
ref|WP_009518946.1|  MULTISPECIES: serine--glyoxylate aminotransf...  47.8    9e-05   
ref|WP_042299583.1|  serine--glyoxylate aminotransferase              47.8    9e-05   
ref|WP_017772868.1|  serine--glyoxylate aminotransferase              47.8    9e-05   



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  222  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  261



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  131  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  170



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  275  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  314



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  354  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  393



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVKR WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVKR WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  258  IDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  297



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  259  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  298



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  273  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  312



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  160  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  199



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  300



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIVKRAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  265  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  304



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  258  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  297



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  310



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  356



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  301



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVK AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  318  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  357



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  309



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID +EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  154  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  193



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score = 74.3 bits (181),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  84   IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNE  123



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKR+N SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNE  356



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVK AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  377  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  416



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  206  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  245



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+VKRAW+RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINE  356



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  MDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  244  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  283



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  310  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  349



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAW+RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIVK AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  353  IDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  392



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  178  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  217



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score = 75.1 bits (183),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  227  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  266



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  318  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  357



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIVK AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  318  IDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  357



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score = 74.3 bits (181),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  178  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  217



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAW+RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNE  356



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV++AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+S+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  INSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID +EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIV+RAW RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAW+RYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score = 75.1 bits (183),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKV GKVFRIGHLGN NE
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNE  300



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDSSEIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAW+RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  40   IDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNE  79



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  319  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  358



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ N+
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  356



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID +EIV+RAWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  319  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  358



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ N+
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  356



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAW+RYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SEIV+RAW+RYN SLG GLNK+AGKVFRIGHLGN NE
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNE  356



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVKRAWKRYN SLG GLNKVAGKVFRIGHLG+ N+
Sbjct  290  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLND  329



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID SE+V+RAW+RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNE  356



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  68   IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  107



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIVK AWKRYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  318  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNE  357



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVF IGHLGN NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNE  356



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKR N SLG GLNKVAGKVFRIGHLGN NE
Sbjct  282  IDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNE  321



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+ AWKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  75   IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  114



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+++V+R WKRYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  318  IDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNE  357



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIV RAWK+YN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINE  356



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLG  NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNE  356



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKRYN SLG GLNKVAGKVFRIGHLG  NE
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNE  356



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID +EIV+RAWKR+N SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  IDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIV+RAW+RYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score = 72.8 bits (177),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID+ EIV RAWKRYN SLG GLNKVAGKVFRIGH+GN NE
Sbjct  266  IDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNE  305



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIV+RAW+RYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIV+RAW+RYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SSEIV+RAW+RYN SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+S+++VKRAW RYN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  317  INSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIV RAWKRYN SLG GLNKVAGKVFRIGH+G+ NE
Sbjct  317  IDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNE  356



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+SS++VKRAW RYN SLG GLNKVAGKVFRIGHLGN N+
Sbjct  317  INSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLND  356



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+EIV+RAWKR N SLG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  IDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNE  356



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS EIV RAWKR N SLG GLNKVAGKVFRIGH+G+ NE
Sbjct  259  IDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNE  298



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+S++IVK A+K+YN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  318  INSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNE  357



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+S++IVK A+K+YN SLG GLNKVAGKVFRIGHLGN NE
Sbjct  318  INSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNE  357



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            I+S ++VK AWK+YN SLG GLNKVAGKVFRIGHLG  NE
Sbjct  317  INSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNE  356



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ++S ++VK AWK+YN SLG GLNKVAGKVFRIGHLG  NE
Sbjct  317  LNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNE  356



>ref|WP_040969922.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3324]
 emb|CDX12804.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3324]
Length=396

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+++VKRA++ Y  SLG GLNKVAGKVFRIGHLG  NE
Sbjct  311  IDSADVVKRAYRAYQTSLGGGLNKVAGKVFRIGHLGWLNE  350



>ref|WP_024925735.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 ref|XP_005974896.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pantholops 
hodgsonii]
Length=396

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+VKRA+ +Y  SLG GLNKVAGKVFRIGHLG  NE
Sbjct  311  IDSAEVVKRAYHKYQTSLGVGLNKVAGKVFRIGHLGWLNE  350



>gb|AID30749.1| serine--glyoxylate aminotransferase [Mesorhizobium huakuii 7653R]
Length=249

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS++IVKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  164  IDSADIVKRAYRTYQTSLGGGLNKVMGKVFRIGHLGWLNE  203



>ref|WP_032930697.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS++IVKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSADIVKRAYRTYQTSLGGGLNKVMGKVFRIGHLGWLNE  350



>ref|WP_019858769.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS++IVKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSADIVKRAYRTYQTSLGGGLNKVMGKVFRIGHLGWLNE  350



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+ +VK A+ RYN SLG GLNKVAGKVFRIGHLG  +E
Sbjct  315  IDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDE  354



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ++S+++V+ AW++YN S+G GLNKVAGKVFRIGHLG  NE
Sbjct  317  LNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNE  356



>ref|WP_031597721.1| serine--glyoxylate aminotransferase [Ferrovum myxofaciens]
Length=398

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  DSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +++E+++RA++RYN +LG GL+KVAGKVFRIGHLG+ NE
Sbjct  313  NAAEVIERAYRRYNLALGAGLSKVAGKVFRIGHLGDLNE  351



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+ +VK A+ RYN SLG GLNKVAGKVFRIGHLG  +E
Sbjct  312  IDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDE  351



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ++S+++V+ AW++YN S+G GLNKVAGKVFRIGHLG  NE
Sbjct  317  LNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNE  356



>ref|WP_018238561.1| serine--glyoxylate aminotransferase [Ensifer sp. BR816]
Length=396

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID +E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  IDGAEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|XP_005648727.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24183.1| serine glyoxylate aminotransferase [Coccomyxa subellipsoidea 
C-169]
Length=434

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS +IVK A+ RYN SLG GL++VAGKVFRIGHLGN +E
Sbjct  350  VDSGKIVKEAYSRYNLSLGVGLSEVAGKVFRIGHLGNNDE  389



>ref|WP_026227793.1| serine--glyoxylate aminotransferase [Hoeflea sp. 108]
Length=396

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+E+V+RA+  Y  SLG GLNKVAGKVFRIGHLG  NE
Sbjct  311  IDSAEVVRRAYHGYQTSLGVGLNKVAGKVFRIGHLGWVNE  350



>ref|WP_010910076.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
 dbj|BAB48723.1| probable serine-glyoxylate aminotransferase [Mesorhizobium loti 
MAFF303099]
Length=396

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS +IVKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDIVKRAYRTYQTSLGGGLNKVMGKVFRIGHLGWLNE  350



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score = 62.0 bits (149),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D +E++K A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  VDGAEVIKHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_023746858.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESY32439.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC391B00]
 gb|ESY41674.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC384A00]
Length=396

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWVNE  350



>ref|WP_042643125.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
 emb|CDX37204.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
Length=396

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS+ +VKRA+  Y  SLG GLNKVAGKVFRIGHLG  NE
Sbjct  311  IDSANVVKRAYGAYQTSLGGGLNKVAGKVFRIGHLGWLNE  350



>ref|WP_023698325.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC265A00]
 gb|ESX07643.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC265A00]
Length=396

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023685219.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC277A00]
 gb|ESW64168.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC277A00]
Length=396

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023827347.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C131B0]
 gb|ESZ54884.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C131B0]
Length=396

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023805485.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C089B000]
 gb|ESZ07011.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C089B000]
Length=396

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_028755163.1| serine--glyoxylate aminotransferase [Rhizobium leucaenae]
Length=396

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID  E++K A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  IDGVEVIKHAYRAYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_034858116.1| serine--glyoxylate aminotransferase [Ensifer sojae]
Length=396

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D +E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  VDGAEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_023714322.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC422A00]
 gb|ESX62065.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC422A00]
Length=396

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_026616975.1| serine--glyoxylate aminotransferase [Ensifer sp. TW10]
Length=396

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D +E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  VDGAEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_037399704.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=272

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  187  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  226



>ref|WP_037437034.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=257

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  172  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  211



>ref|WP_037460312.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=264

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  179  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  218



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  DSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            D++++++ A+KRYN +LG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  DAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355



>ref|WP_037429341.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=263

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  178  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  217



>ref|WP_027044922.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. URHC0008]
Length=396

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS +IVKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDIVKRAYQTYRTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  DSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            D++++++ A+KRYN +LG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  DAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355



>ref|WP_040981991.1| serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
 emb|CDX29609.1| Serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
Length=396

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYRAYKTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  118  DSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            D++++++ A+KRYN +LG GLNKVAGKVFRIGHLG+ NE
Sbjct  317  DAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNE  355



>ref|WP_014955398.1| serine--glyoxylate aminotransferase [alpha proteobacterium HIMB59]
 gb|AFS49567.1| Aminotransferase class-V [alpha proteobacterium HIMB59]
Length=386

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXN  5
            IDS++IVK A+ +YN S G GLNKVAGK+FRIGHLG+ N
Sbjct  311  IDSTDIVKTAYNKYNTSFGGGLNKVAGKLFRIGHLGDLN  349



>ref|WP_037447404.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=273

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  188  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  227



>ref|WP_023706127.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESX16174.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC255A00]
 gb|ESX29669.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC440B00]
 gb|ESX35407.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC432A00]
 gb|ESX41619.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC440A00]
 gb|ESX75964.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC414A00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQNYQTSLGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023822176.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C054A000]
 gb|ESZ43442.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C054A000]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023739129.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESY10416.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC398B00]
 gb|ESY36166.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC386A00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023731220.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESX90411.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC405B00]
 gb|ESX92698.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC403B00]
 gb|ESY04707.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC399B00]
 gb|ESY23846.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC394B00]
 gb|ESZ33387.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C067A000]
 gb|ESZ52162.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C565B0]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023712721.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESX43397.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC426A00]
 gb|ESX47763.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC424B00]
 gb|ESX65812.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC416B00]
 gb|ESY49453.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC380A00]
 gb|ESZ72648.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C119B0]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_037384071.1| serine--glyoxylate aminotransferase [Ensifer americanum]
 gb|KEC78847.1| serine-glyoxylate aminotransferase [Sinorhizobium americanum 
CCGM7]
Length=395

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  IDGVEVIRHAYQAYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_027146511.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM3626]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQAYQTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_023700366.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC264A00]
 gb|ESX25747.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC264A00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_015317366.1| serine--glyoxylate aminotransferase [Mesorhizobium australicum]
 gb|AGB45946.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Mesorhizobium australicum WSM2073]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQAYQTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS++++K AWK+YN SLG GL +V GKVFRIGHLG  NE
Sbjct  318  LDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNE  357



>ref|WP_023753463.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESY57670.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC374B00]
 gb|ESY60370.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC372A00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023670792.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC285A00]
 gb|ESW79540.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC285A00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS+ + K A+ RYN SLG GLNKVAGKVFRIGHLG+ +E
Sbjct  313  VDSNAVTKTAYYRYNTSLGLGLNKVAGKVFRIGHLGSLDE  352



>ref|WP_023833857.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C105A0]
 gb|ESZ76926.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C105A0]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_013894918.1| serine--glyoxylate aminotransferase [Mesorhizobium opportunistum]
 gb|AEH88234.1| aminotransferase class V [Mesorhizobium opportunistum WSM2075]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQTYRTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_023779196.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC221B00]
 gb|ESY77993.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC221B00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQTYRTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_023763335.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC232B00]
 gb|ESY70799.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNHC232B00]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQTYRTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_041011880.1| serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
 emb|CDX26162.1| Serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQAYKTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_041007618.1| serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
 emb|CDX59212.1| Serine--glyoxylate aminotransferase [Mesorhizobium plurifarium]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQAYKTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_023690974.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESX05556.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC268A00]
 gb|ESX83696.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC412B00]
 gb|ESZ16765.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C085B000]
Length=396

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_023829410.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
 gb|ESZ58200.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
Length=396

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +DS ++VKRA+++Y  +LG GLNKV GKVFRIGHLG  NE
Sbjct  311  VDSGDVVKRAYQKYQTALGGGLNKVIGKVFRIGHLGWLNE  350



>ref|WP_041003840.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. SOD10]
 emb|CDX44182.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. SOD10]
Length=396

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYQAYRTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_037416404.1| serine--glyoxylate aminotransferase [Sinorhizobium sp. CCBAU 
05631]
Length=396

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            ID  E+++ A++ YN SLG GL KVAGKVFRIGHLG+ NE
Sbjct  311  IDGVEVIRHAYQTYNTSLGSGLGKVAGKVFRIGHLGSLNE  350



>ref|WP_014329402.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
 emb|CCE96968.1| serine-glyoxylate aminotransferase-related [Sinorhizobium fredii 
HH103]
Length=396

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



>ref|WP_027051273.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            IDS ++VKRA++ Y  SLG GLNKV GKVFRIGHLG  NE
Sbjct  311  IDSGDVVKRAYRGYQTSLGGGLNKVFGKVFRIGHLGWLNE  350



>ref|WP_040961132.1| serine--glyoxylate aminotransferase [Sinorhizobium fredii]
Length=396

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  IDSSEIVKRAWKRYNXSLGXGLNKVAGKVFRIGHLGNXNE  2
            +D  E+++ A++ YN SLG GL+KVAGKVFRIGHLG+ NE
Sbjct  311  VDGVEVIRHAYRTYNTSLGSGLSKVAGKVFRIGHLGSLNE  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560883852360