BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004O23

Length=119
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002528432.1|  heat shock protein, putative                     49.7    2e-05   Ricinus communis
gb|KJB16980.1|  hypothetical protein B456_002G258500                  47.0    2e-04   Gossypium raimondii
gb|KJB16979.1|  hypothetical protein B456_002G258500                  47.0    2e-04   Gossypium raimondii
dbj|BAD02273.1|  heat shock protein 70                                43.9    3e-04   Nicotiana benthamiana
emb|CBI29517.3|  unnamed protein product                              45.4    3e-04   Vitis vinifera
gb|ABK94007.1|  unknown                                               43.5    4e-04   Populus trichocarpa [western balsam poplar]
gb|ACJ11741.1|  heat shock protein 70                                 46.2    4e-04   Gossypium hirsutum [American cotton]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...  45.8    4e-04   Tarenaya hassleriana [spider flower]
gb|ABK55692.1|  heat shock protein 70 isoform-1                       43.1    5e-04   Cucumis sativus [cucumbers]
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...  45.4    7e-04   Phoenix dactylifera
ref|XP_002312090.1|  heat shock protein 70 cognate                    45.4    7e-04   Populus trichocarpa [western balsam poplar]
gb|ACA23466.1|  heat shock protein 70                                 43.5    7e-04   Arachis diogoi
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2   45.4    7e-04   Vitis vinifera
gb|AFK37867.1|  unknown                                               42.7    8e-04   Lotus japonicus
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...  45.1    9e-04   Solanum lycopersicum
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2   45.1    9e-04   
gb|KDP44981.1|  hypothetical protein JCGZ_01481                       45.1    9e-04   Jatropha curcas
emb|CCA29121.1|  heat shock protein 70 isoform 2                      45.1    9e-04   Solanum lycopersicum
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2   45.1    0.001   Vitis vinifera
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...  45.1    0.001   Nicotiana sylvestris
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...  45.1    0.001   Nicotiana sylvestris



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            +KDEKISSKL PDDK KIEDAIEQAIQ W+
Sbjct  559  VKDEKISSKLSPDDKKKIEDAIEQAIQ-WL  587



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            +KDEKI SKL PDDK KIEDAIE+AIQ W+
Sbjct  524  VKDEKIGSKLSPDDKKKIEDAIEEAIQ-WL  552



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            +KDEKI SKL PDDK KIEDAIE+AIQ W+
Sbjct  559  VKDEKIGSKLSPDDKKKIEDAIEEAIQ-WL  587



>dbj|BAD02273.1| heat shock protein 70 [Nicotiana benthamiana]
Length=108

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI SKL PDDK KIEDAI+QAI  W+
Sbjct  19   IKDEKIGSKLSPDDKKKIEDAIDQAIS-WL  47



>emb|CBI29517.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWMGTXL  16
            +KDEKIS+K  P DK KIEDA+E AIQ   G  L
Sbjct  171  VKDEKISTKFPPADKKKIEDAVEHAIQWLDGNQL  204



>gb|ABK94007.1| unknown [Populus trichocarpa]
Length=125

 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 1/32 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWMGT  22
            +KDEKISSKL  DDK KIEDAI+QAIQ W+ +
Sbjct  36   VKDEKISSKLAADDKKKIEDAIDQAIQ-WLDS  66



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            +KDEKI SKL PDDK +IEDAIE+AIQ W+
Sbjct  559  VKDEKIGSKLSPDDKKRIEDAIEEAIQ-WL  587



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            I+DEKI SKL P+DK KIEDAIEQAIQ W+
Sbjct  559  IRDEKIGSKLKPEDKKKIEDAIEQAIQ-WL  587



>gb|ABK55692.1| heat shock protein 70 isoform-1 [Cucumis sativus]
Length=117

 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            ++DEK SSKL P DK KIEDAIEQA+Q W+
Sbjct  51   VRDEKFSSKLDPADKKKIEDAIEQAVQ-WL  79



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWMGTXL  16
            IKD+KISSKL  DDK KIEDAIEQAIQ   G  L
Sbjct  559  IKDDKISSKLAADDKKKIEDAIEQAIQWLEGNQL  592



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 1/32 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWMGT  22
            +KDEKISSKL  DDK KIEDAI+QAIQ W+ T
Sbjct  559  VKDEKISSKLGADDKKKIEDAIDQAIQ-WLDT  589



>gb|ACA23466.1| heat shock protein 70 [Arachis diogoi]
Length=172

 Score = 43.5 bits (101),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKD+KISSKL P DK KI+DAIEQAIQ W+
Sbjct  86   IKDDKISSKLSPADKTKIDDAIEQAIQ-WL  114



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI +KL P+DK KIEDAIEQAIQ W+
Sbjct  559  IKDEKIGAKLPPEDKKKIEDAIEQAIQ-WL  587



>gb|AFK37867.1| unknown [Lotus japonicus]
Length=126

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI  KL P DK KIEDAIEQAIQ W+
Sbjct  36   IKDEKIGGKLDPADKKKIEDAIEQAIQ-WL  64



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI+SKL  DD+ KIEDAIEQAIQ W+
Sbjct  559  IKDEKIASKLSADDRTKIEDAIEQAIQ-WL  587



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI+SKL  DD+ KIEDAIEQAIQ W+
Sbjct  559  IKDEKIASKLSADDRTKIEDAIEQAIQ-WL  587



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKISSKL  DDK KIEDAI+QAIQ W+
Sbjct  559  IKDEKISSKLATDDKKKIEDAIDQAIQ-WL  587



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI+SKL  DD+ KIEDAIEQAIQ W+
Sbjct  559  IKDEKIASKLSADDRTKIEDAIEQAIQ-WL  587



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            +KDEKIS+KL P DK KIEDA+EQAIQ W+
Sbjct  559  VKDEKISAKLPPADKKKIEDAVEQAIQ-WL  587



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI SKL PDDK KIEDAI+QAI  W+
Sbjct  559  IKDEKIGSKLSPDDKKKIEDAIDQAIS-WL  587



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = -3

Query  117  IKDEKISSKLXPDDKXKIEDAIEQAIQGWM  28
            IKDEKI SKL PDDK KIEDAI+QAI  W+
Sbjct  559  IKDEKIGSKLSPDDKKKIEDAIDQAIS-WL  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565821549150