BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004O13

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                72.0    3e-12   Gossypium arboreum [tree cotton]
gb|KJB19538.1|  hypothetical protein B456_003G108500                  72.0    3e-12   Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase              69.3    2e-11   
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like           68.2    8e-11   Vitis vinifera
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like         67.0    2e-10   Tarenaya hassleriana [spider flower]
emb|CDP11183.1|  unnamed protein product                              67.0    2e-10   Coffea canephora [robusta coffee]
emb|CBI14896.3|  unnamed protein product                              65.1    2e-10   Vitis vinifera
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                67.0    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1              67.0    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like           67.0    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like           66.6    2e-10   Nicotiana sylvestris
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120        66.6    3e-10   Amborella trichopoda
emb|CBI17300.3|  unnamed protein product                              64.3    3e-10   Vitis vinifera
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                66.2    3e-10   Vitis vinifera
dbj|BAA03710.1|  cytokinin binding protein CBP57                      66.2    3e-10   Nicotiana sylvestris
gb|KJB37873.1|  hypothetical protein B456_006G223900                  66.2    3e-10   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                66.2    3e-10   Gossypium arboreum [tree cotton]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                       66.2    3e-10   Jatropha curcas
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like           66.2    3e-10   Sesamum indicum [beniseed]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                66.2    4e-10   
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like           65.9    4e-10   Sesamum indicum [beniseed]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase              65.9    5e-10   Chlorella variabilis
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                   65.5    5e-10   Eucalyptus grandis [rose gum]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                65.5    5e-10   Eucalyptus grandis [rose gum]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1              65.5    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like           65.5    6e-10   Phoenix dactylifera
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like           65.1    7e-10   Nicotiana tomentosiformis
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                   65.1    8e-10   Nicotiana tabacum [American tobacco]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                64.7    9e-10   Sesamum indicum [beniseed]
ref|NP_001289538.1|  adenosylhomocysteinase                           64.7    1e-09   Nicotiana sylvestris
gb|KJB72027.1|  hypothetical protein B456_011G154000                  64.3    1e-09   Gossypium raimondii
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1              64.7    1e-09   Tarenaya hassleriana [spider flower]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg              64.7    1e-09   Erythranthe guttata [common monkey flower]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                 64.3    1e-09   Populus tomentosa [Chinese white poplar]
emb|CDP15078.1|  unnamed protein product                              64.3    1e-09   Coffea canephora [robusta coffee]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...  64.3    1e-09   Mesembryanthemum crystallinum
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like           64.3    1e-09   
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516           64.3    1e-09   Arabidopsis lyrata subsp. lyrata
gb|KJB72026.1|  hypothetical protein B456_011G154000                  63.5    1e-09   Gossypium raimondii
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                     64.3    1e-09   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                   64.3    1e-09   Nicotiana tabacum [American tobacco]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                     64.3    1e-09   Nicotiana suaveolens
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg              64.3    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like           64.3    2e-09   Cucumis melo [Oriental melon]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                 64.3    2e-09   Ricinus communis
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  64.3    2e-09   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like           64.3    2e-09   Cucumis sativus [cucumbers]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                 64.3    2e-09   Populus tomentosa [Chinese white poplar]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...  63.9    2e-09   Petroselinum crispum
gb|ABK24229.1|  unknown                                               63.9    2e-09   Picea sitchensis
gb|ABK25129.1|  unknown                                               63.9    2e-09   Picea sitchensis
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                     63.9    2e-09   Gentiana triflora
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...  63.9    2e-09   Phalaenopsis sp.
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|KHG17040.1|  Adenosylhomocysteinase                                63.9    2e-09   Gossypium arboreum [tree cotton]
gb|KJB72024.1|  hypothetical protein B456_011G154000                  63.9    2e-09   Gossypium raimondii
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                      62.0    2e-09   Petroselinum crispum
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like           63.9    2e-09   Populus euphratica
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A            63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                   63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|KJB28098.1|  hypothetical protein B456_005G027700                  63.9    2e-09   Gossypium raimondii
gb|KJB72029.1|  hypothetical protein B456_011G154000                  63.9    2e-09   Gossypium raimondii
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like              63.9    2e-09   Solanum tuberosum [potatoes]
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                63.9    2e-09   Nelumbo nucifera [Indian lotus]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                    63.9    2e-09   Gossypium hirsutum [American cotton]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                 63.9    2e-09   Populus tomentosa [Chinese white poplar]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          63.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          63.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                    63.9    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant          63.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg           63.5    2e-09   Capsella rubella
ref|NP_193130.1|  adenosylhomocysteinase 1                            63.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                   63.5    2e-09   Cucumis sativus [cucumbers]
emb|CAH69227.1|  putative adenosylhomocysteinase                      62.0    2e-09   Nicotiana glauca [glaucous tobacco]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like           63.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001031628.1|  adenosylhomocysteinase 1                         63.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like           63.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    2e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                 63.5    3e-09   Populus tomentosa [Chinese white poplar]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg              63.5    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...  63.5    3e-09   
dbj|BAF01736.1|  adenosylhomocysteinase                               60.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...  63.5    3e-09   Medicago sativa [alfalfa]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                63.2    3e-09   Solanum lycopersicum
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886           63.2    3e-09   Selaginella moellendorffii
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like           63.2    3e-09   Phoenix dactylifera
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                    63.2    3e-09   Petunia x hybrida [garden petunia]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1              63.2    3e-09   Cucumis melo [Oriental melon]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like           63.2    3e-09   
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like           63.2    3e-09   Elaeis guineensis
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like           63.2    3e-09   Elaeis guineensis
gb|ABR17322.1|  unknown                                               63.2    3e-09   Picea sitchensis
gb|ABR16547.1|  unknown                                               63.2    4e-09   Picea sitchensis
gb|ACN40278.1|  unknown                                               63.2    4e-09   Picea sitchensis
gb|ABR16138.1|  unknown                                               63.2    4e-09   Picea sitchensis
gb|AAM62888.1|  adenosylhomocysteinase                                63.2    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)          62.8    4e-09   
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                63.2    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like           62.8    4e-09   Pyrus x bretschneideri [bai li]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...  62.8    5e-09   Catharanthus roseus [chatas]
gb|KJB72025.1|  hypothetical protein B456_011G154000                  61.2    5e-09   Gossypium raimondii
gb|AFV46215.1|  hypothetical protein                                  61.6    5e-09   Scutellaria baicalensis [Baikal skullcap]
ref|XP_003601687.1|  Adenosylhomocysteinase                           62.8    5e-09   Medicago truncatula
ref|NP_001031627.1|  adenosylhomocysteinase 1                         62.4    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2              62.8    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like         62.8    5e-09   Camelina sativa [gold-of-pleasure]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                   62.8    5e-09   Populus tomentosa [Chinese white poplar]
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site  62.8    5e-09   Ostreococcus tauri
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                   62.8    5e-09   Populus tomentosa [Chinese white poplar]
gb|ABR16573.1|  unknown                                               62.8    5e-09   Picea sitchensis
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                  62.8    5e-09   Linum usitatissimum
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                   62.8    5e-09   Populus tomentosa [Chinese white poplar]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like           62.8    6e-09   Glycine max [soybeans]
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                62.4    6e-09   Malus domestica [apple tree]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1     62.4    6e-09   Prunus mume [ume]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...  62.4    6e-09   Camelina sativa [gold-of-pleasure]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like           62.4    6e-09   Cicer arietinum [garbanzo]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    6e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                  62.4    7e-09   Arabis alpina [alpine rockcress]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                62.4    7e-09   Populus euphratica
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                   62.4    7e-09   Populus tomentosa [Chinese white poplar]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                  62.4    7e-09   Pinus pinaster [cluster pine]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                62.4    7e-09   Fragaria vesca subsp. vesca
ref|XP_006373090.1|  adenosylhomocysteinase family protein            62.4    8e-09   Populus trichocarpa [western balsam poplar]
dbj|BAH57232.1|  AT4G13940                                            60.8    8e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                 62.0    8e-09   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                62.0    8e-09   Phoenix dactylifera
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                   62.0    9e-09   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                 62.0    9e-09   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein            62.0    9e-09   Populus trichocarpa [western balsam poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                      62.0    1e-08   Trifolium pratense [peavine clover]
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...  60.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003629610.1|  Adenosylhomocysteinase                           61.6    1e-08   Medicago truncatula
ref|WP_026633760.1|  S-adenosyl-L-homocysteine hydrolase              61.6    1e-08   Dyella
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein             61.6    1e-08   Capsicum annuum
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg           62.0    1e-08   
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                  61.6    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg           61.6    1e-08   Prunus persica
gb|ABR16616.1|  unknown                                               61.2    1e-08   Picea sitchensis
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                61.6    1e-08   Pyrus x bretschneideri [bai li]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein             61.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed           61.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KHN44476.1|  Adenosylhomocysteinase                                60.1    2e-08   Glycine soja [wild soybean]
ref|WP_007277276.1|  S-adenosyl-L-homocysteine hydrolase              61.2    2e-08   Lentisphaera araneosa
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                  61.2    2e-08   Arabis alpina [alpine rockcress]
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                     61.2    2e-08   Chlamydomonas sp. ICE-L
gb|KJB72028.1|  hypothetical protein B456_011G154000                  61.2    2e-08   Gossypium raimondii
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...  60.8    2e-08   Lupinus luteus
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...  60.8    2e-08   Lupinus luteus
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1              60.8    2e-08   Brassica rapa
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                   60.8    2e-08   Populus tomentosa [Chinese white poplar]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like           60.8    2e-08   Solanum tuberosum [potatoes]
emb|CDY01177.1|  BnaA04g06420D                                        60.8    2e-08   
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like           60.8    2e-08   Solanum lycopersicum
ref|XP_009623649.1|  PREDICTED: adenosylhomocysteinase-like           57.8    2e-08   Nicotiana tomentosiformis
emb|CDY50423.1|  BnaCnng19320D                                        60.8    2e-08   Brassica napus [oilseed rape]
emb|CDY47309.1|  BnaAnng08830D                                        60.8    2e-08   Brassica napus [oilseed rape]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like           60.8    2e-08   Setaria italica
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                   60.8    2e-08   Phaseolus vulgaris [French bean]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like           60.8    3e-08   Glycine max [soybeans]
ref|WP_026611089.1|  S-adenosyl-L-homocysteine hydrolase              60.5    3e-08   Methylocaldum szegediense
ref|WP_026640729.1|  S-adenosyl-L-homocysteine hydrolase              60.5    3e-08   Bordetella petrii
gb|AEI54335.1|  adenosylhomocysteinase                                60.5    3e-08   Glycine max [soybeans]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                   60.5    3e-08   Populus tomentosa [Chinese white poplar]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g           60.5    3e-08   Phaseolus vulgaris [French bean]
emb|CCQ38381.1|  adenosyl-homocysteine hydrolase                      56.2    3e-08   Schiedea laui
gb|AGT16642.1|  Adenosylhomocysteinase                                60.5    3e-08   Saccharum hybrid cultivar R570
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like           60.5    3e-08   Setaria italica
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                  57.8    3e-08   Arabis alpina [alpine rockcress]
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...  60.5    3e-08   
emb|CDX77483.1|  BnaA07g06210D                                        60.5    3e-08   
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                60.5    3e-08   Malus domestica [apple tree]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                   59.7    3e-08   
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                  60.5    3e-08   Arabis alpina [alpine rockcress]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like           60.5    3e-08   Oryza brachyantha
gb|ACN34730.1|  unknown                                               60.1    3e-08   Zea mays [maize]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg           60.5    4e-08   
ref|NP_001148534.1|  adenosylhomocysteinase                           60.1    4e-08   
ref|WP_028454764.1|  S-adenosyl-L-homocysteine hydrolase              60.1    4e-08   Chitinilyticum litopenaei
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g           60.1    4e-08   Phaseolus vulgaris [French bean]
ref|WP_028453563.1|  S-adenosyl-L-homocysteine hydrolase              60.1    4e-08   Chitinilyticum aquatile
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                60.1    4e-08   Chlamydomonas reinhardtii
ref|NP_001265954.1|  adenosylhomocysteinase-like                      60.1    4e-08   Cicer arietinum [garbanzo]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2      60.1    5e-08   
ref|WP_020676549.1|  hypothetical protein                             59.7    5e-08   Geopsychrobacter electrodiphilus
gb|AAM19782.1|  AT3g23810/MYM9_15                                     59.7    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                           59.7    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189023.1|  adenosylhomocysteinase 2                            59.7    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein           59.7    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234012.1|  adenosylhomocysteinase                           59.7    5e-08   
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602            59.7    5e-08   Volvox carteri f. nagariensis
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                     59.7    5e-08   Gentiana triflora
ref|WP_028450258.1|  S-adenosyl-L-homocysteine hydrolase              59.7    5e-08   Chitinibacter tainanensis
ref|WP_038034910.1|  S-adenosyl-L-homocysteine hydrolase              59.3    6e-08   Thermopetrobacter sp. TC1
gb|KHN12344.1|  Adenosylhomocysteinase                                59.3    6e-08   Glycine soja [wild soybean]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2              59.7    6e-08   Brassica rapa
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2     59.7    6e-08   
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2              59.3    6e-08   Brassica rapa
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                   59.3    7e-08   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KIZ05177.1|  adenosylhomocysteinase                                60.1    7e-08   Monoraphidium neglectum
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like         59.3    7e-08   Brassica rapa
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg           59.3    7e-08   Eutrema salsugineum [saltwater cress]
ref|WP_038551746.1|  S-adenosyl-L-homocysteine hydrolase              59.3    7e-08   Synechococcus sp. KORDI-52
gb|AHF62545.1|  adenosylhomocysteinase                                59.3    7e-08   Synechococcus sp. WH 8109
ref|XP_010097949.1|  hypothetical protein L484_026840                 59.3    8e-08   Morus notabilis
ref|WP_007099547.1|  S-adenosyl-L-homocysteine hydrolase              59.3    8e-08   Synechococcus sp. RS9916
ref|NP_001067845.2|  Os11g0455500                                     59.3    9e-08   
ref|WP_018969169.1|  S-adenosyl-L-homocysteine hydrolase              58.9    9e-08   Rubritalea marina
emb|CCQ38404.1|  adenosyl-homocysteine hydrolase                      55.1    9e-08   Schiedea trinervis
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase              58.9    9e-08   Streptomyces sulphureus
dbj|GAN45334.1|  S-adenosyl-L-homocysteine hydrolase                  58.9    1e-07   
ref|WP_025282736.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  58.5    1e-07   Ectothiorhodospira haloalkaliphila
ref|WP_028072773.1|  hypothetical protein                             55.8    1e-07   
ref|XP_001419579.1|  predicted protein                                58.5    1e-07   Ostreococcus lucimarinus CCE9901
gb|EPS72602.1|  adenosylhomocysteinase                                58.9    1e-07   Genlisea aurea
gb|AGT02540.1|  adenosylhomocysteinase                                58.5    1e-07   Herpetomonas muscarum
ref|XP_001755906.1|  predicted protein                                58.5    1e-07   
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                58.5    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001755929.1|  predicted protein                                58.5    1e-07   
ref|XP_001755926.1|  predicted protein                                58.5    1e-07   
ref|WP_019466297.1|  S-adenosyl-L-homocysteine hydrolase              58.5    2e-07   Dyella japonica
gb|AFK46472.1|  unknown                                               57.4    2e-07   Lotus japonicus
ref|WP_003166281.1|  S-adenosyl-L-homocysteine hydrolase              58.2    2e-07   Brevundimonas
gb|AAL09400.1|AF307335_1  cytokinin binding protein                   58.2    2e-07   
ref|WP_028061676.1|  hypothetical protein                             58.2    2e-07   
ref|XP_829023.1|  S-adenosylhomocysteine hydrolase                    58.2    2e-07   
ref|WP_006853905.1|  S-adenosyl-L-homocysteine hydrolase              58.2    2e-07   
ref|XP_003057172.1|  adenosylhomocysteinase                           58.2    2e-07   
pdb|3H9U|A  Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) Fro...  58.2    2e-07   
gb|ETN79200.1|  S-adenosyl-L-homocysteine hydrolase, NAD binding ...  57.4    2e-07   
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                      58.2    2e-07   
emb|CCC95537.1|  unnamed protein product                              57.8    2e-07   
emb|CCD17213.1|  unnamed protein product                              57.8    2e-07   
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase              58.2    2e-07   
gb|EMT01272.1|  Adenosylhomocysteinase                                57.8    2e-07   
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase              57.8    2e-07   
emb|CCC95534.1|  hypothetical protein, unlikely                       55.1    2e-07   
ref|WP_026373585.1|  S-adenosyl-L-homocysteine hydrolase              57.8    2e-07   
ref|WP_035741920.1|  S-adenosyl-L-homocysteine hydrolase              57.8    2e-07   
ref|XP_001950124.1|  PREDICTED: adenosylhomocysteinase                57.8    2e-07   
ref|WP_013164653.1|  S-adenosyl-L-homocysteine hydrolase              57.8    3e-07   
gb|AHG90399.1|  Adenosylhomocysteinase                                57.8    3e-07   
ref|XP_005708566.1|  adenosylhomocysteinase                           57.8    3e-07   
ref|WP_009103322.1|  adenosylhomocysteinase                           57.4    3e-07   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2           57.4    3e-07   
ref|WP_012376657.1|  S-adenosyl-L-homocysteine hydrolase              57.4    3e-07   
ref|WP_028081726.1|  S-adenosyl-L-homocysteine hydrolase              57.4    3e-07   
emb|CDY67319.1|  BnaA03g57570D                                        55.1    3e-07   
gb|ABJ15733.1|  S-adenosylhomocysteine hydrolase                      53.1    3e-07   
gb|EHJ64517.1|  S-adenosyl-L-homocysteine hydrolase                   57.4    3e-07   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                   57.4    3e-07   
ref|WP_011629999.1|  S-adenosyl-L-homocysteine hydrolase              57.4    3e-07   
ref|WP_024891489.1|  S-adenosyl-L-homocysteine hydrolase              57.4    3e-07   
ref|WP_008213996.1|  S-adenosyl-L-homocysteine hydrolase              57.4    4e-07   
ref|WP_012251588.1|  S-adenosyl-L-homocysteine hydrolase              57.4    4e-07   
ref|WP_011126997.1|  S-adenosyl-L-homocysteine hydrolase              57.4    4e-07   
ref|WP_016472770.1|  MULTISPECIES: adenosylhomocysteinase             57.4    4e-07   
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                  57.0    4e-07   
emb|CDY53211.1|  BnaC03g74050D                                        57.0    4e-07   
ref|XP_002505983.1|  adenosylhomocysteinase                           57.4    4e-07   
ref|WP_008689651.1|  adenosylhomocysteinase                           57.0    4e-07   
ref|WP_011363138.1|  S-adenosyl-L-homocysteine hydrolase              57.0    4e-07   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase              57.4    4e-07   
ref|WP_037452032.1|  adenosylhomocysteinase                           57.0    4e-07   
ref|WP_038031735.1|  adenosylhomocysteinase                           57.0    4e-07   
ref|WP_035709236.1|  S-adenosyl-L-homocysteine hydrolase              57.0    4e-07   
ref|WP_006042541.1|  S-adenosyl-L-homocysteine hydrolase              57.0    4e-07   
ref|WP_025136214.1|  S-adenosyl-L-homocysteine hydrolase              57.0    5e-07   
ref|WP_013169144.1|  S-adenosyl-L-homocysteine hydrolase              57.0    5e-07   
ref|WP_036944508.1|  hypothetical protein                             57.0    5e-07   
ref|WP_030837066.1|  adenosylhomocysteinase                           56.6    5e-07   
ref|WP_013506879.1|  S-adenosyl-L-homocysteine hydrolase              56.6    5e-07   
ref|WP_027006534.1|  hypothetical protein                             56.6    6e-07   
gb|EMS57067.1|  Adenosylhomocysteinase                                56.6    6e-07   
ref|WP_039706318.1|  hypothetical protein                             56.6    6e-07   
ref|WP_029350387.1|  S-adenosyl-L-homocysteine hydrolase              56.6    6e-07   
ref|WP_026869144.1|  adenosylhomocysteinase                           56.6    6e-07   
ref|WP_019356875.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  56.6    6e-07   
gb|EJW83243.1|  adenosylhomocysteinase                                56.2    7e-07   
ref|WP_011618095.1|  S-adenosyl-L-homocysteine hydrolase              56.6    7e-07   
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase              56.6    7e-07   
ref|WP_009788439.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_002684089.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_027490068.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_027484548.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_015448722.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_027493191.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_007509390.1|  S-adenosyl-L-homocysteine hydrolase              56.2    7e-07   
ref|WP_040972841.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_011358988.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_018633571.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_038210615.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_043474120.1|  adenosylhomocysteinase                           56.2    8e-07   
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_010932403.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_015281066.1|  adenosylhomocysteinase                           56.2    8e-07   
ref|WP_044425347.1|  adenosylhomocysteinase                           56.2    8e-07   
ref|WP_038127942.1|  S-adenosyl-L-homocysteine hydrolase              56.2    8e-07   
ref|WP_027739704.1|  adenosylhomocysteinase                           56.2    8e-07   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                    56.2    9e-07   
ref|WP_011236869.1|  S-adenosyl-L-homocysteine hydrolase              56.2    9e-07   
ref|WP_014623708.1|  S-adenosyl-L-homocysteine hydrolase              56.2    9e-07   
ref|WP_013312829.1|  S-adenosyl-L-homocysteine hydrolase              56.2    9e-07   
ref|WP_037954273.1|  adenosylhomocysteinase                           56.2    9e-07   
ref|WP_029416908.1|  S-adenosyl-L-homocysteine hydrolase              56.2    9e-07   
ref|WP_014401841.1|  S-adenosyl-L-homocysteine hydrolase              56.2    9e-07   
ref|WP_030543976.1|  adenosylhomocysteinase                           56.2    9e-07   
ref|XP_009017287.1|  hypothetical protein HELRODRAFT_185575           55.8    1e-06   
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_035055758.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|XP_011301145.1|  PREDICTED: adenosylhomocysteinase                55.8    1e-06   
dbj|GAE20305.1|  adenosylhomocysteinase                               55.5    1e-06   
dbj|GAE21599.1|  adenosylhomocysteinase                               55.5    1e-06   
ref|WP_035832963.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_033963836.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_037840413.1|  hypothetical protein                             52.4    1e-06   
ref|WP_028354408.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
gb|ENN71962.1|  hypothetical protein YQE_11396                        55.5    1e-06   
gb|AEE63466.1|  unknown                                               55.8    1e-06   
ref|WP_014177043.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_042796036.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_038542665.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_011932103.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_008674504.1|  adenosylhomocysteinase                           55.8    1e-06   
ref|WP_010402859.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_015035281.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_003167495.1|  adenosylhomocysteinase                           55.8    1e-06   
gb|ADE53810.1|  adenosylhomocysteinase                                55.8    1e-06   
ref|WP_041744815.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_040853396.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_010420190.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_038614995.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_028953362.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_020151942.1|  S-adenosyl-L-homocysteine hydrolase              55.8    1e-06   
ref|WP_007101016.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|WP_041702437.1|  adenosylhomocysteinase                           55.5    1e-06   
ref|WP_012501941.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|WP_044107885.1|  adenosylhomocysteinase                           55.5    1e-06   
gb|ACF45853.1|  adenosylhomocysteinase                                55.5    1e-06   
ref|WP_036277747.1|  adenosylhomocysteinase                           55.5    1e-06   
ref|WP_036273174.1|  adenosylhomocysteinase                           55.5    1e-06   
ref|WP_033157853.1|  adenosylhomocysteinase                           55.5    1e-06   
ref|WP_026147028.1|  adenosylhomocysteinase                           55.5    1e-06   
ref|XP_001901095.1|  Adenosylhomocysteinase                           55.5    1e-06   
ref|WP_037478717.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|WP_011133252.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|WP_043769255.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|WP_019114092.1|  hypothetical protein                             54.3    1e-06   
ref|WP_013817471.1|  S-adenosyl-L-homocysteine hydrolase              55.5    1e-06   
ref|XP_011139465.1|  PREDICTED: adenosylhomocysteinase                55.5    2e-06   
ref|WP_036635601.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
gb|EMT11613.1|  Adenosylhomocysteinase                                54.7    2e-06   
ref|WP_013036993.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_007192127.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_008433716.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_027325990.1|  adenosylhomocysteinase                           55.5    2e-06   
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_041130509.1|  adenosylhomocysteinase                           55.5    2e-06   
ref|WP_028092784.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_020590636.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_021009961.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
ref|WP_043694211.1|  S-adenosyl-L-homocysteine hydrolase              55.5    2e-06   
emb|CDQ02171.1|  Protein Bm13840                                      55.1    2e-06   
ref|WP_017509613.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_022395904.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase             55.1    2e-06   
gb|EFO23637.2|  adenosylhomocysteinase                                55.1    2e-06   
ref|WP_012475038.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_030891029.1|  adenosylhomocysteinase                           55.1    2e-06   
gb|EKF28415.1|  S-adenosylhomocysteine hydrolase, putative            55.1    2e-06   
ref|NP_001153324.1|  S-adenosylhomocysteine hydrolase                 55.1    2e-06   
ref|WP_015772108.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|XP_003140433.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_014952665.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
gb|KHN72133.1|  Adenosylhomocysteinase                                55.1    2e-06   
ref|WP_024305137.1|  adenosylhomocysteinase                           54.7    2e-06   
gb|ERL86190.1|  hypothetical protein D910_03603                       52.8    2e-06   
ref|WP_030365247.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|WP_025386275.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|WP_041127736.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|WP_015753611.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_027763965.1|  adenosylhomocysteinase                           55.1    2e-06   
ref|XP_002174695.1|  adenosylhomocysteinase                           54.7    2e-06   
ref|WP_010140568.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
ref|WP_002775930.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_006973217.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_041295426.1|  S-adenosyl-L-homocysteine hydrolase              55.1    2e-06   
emb|CCW61177.1|  unnamed protein product                              54.7    2e-06   
gb|EMS57266.1|  Adenosylhomocysteinase                                55.1    2e-06   
ref|WP_043226737.1|  adenosylhomocysteinase                           52.4    2e-06   
dbj|BAH72323.1|  ACYPI003908                                          53.9    2e-06   
ref|WP_043642204.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|XP_809153.1|  S-adenosylhomocysteine hydrolase                    54.7    2e-06   
ref|WP_007041769.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_014245567.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_015947272.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  54.7    2e-06   
ref|WP_010662080.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_043590771.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_020252885.1|  hypothetical protein                             54.7    2e-06   
ref|WP_037801336.1|  adenosylhomocysteinase                           52.4    2e-06   
ref|WP_017951137.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_008165660.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_006391892.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_006389783.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...  54.7    2e-06   
ref|WP_030322019.1|  adenosylhomocysteinase                           54.7    2e-06   
ref|WP_012466558.1|  S-adenosyl-L-homocysteine hydrolase              54.7    2e-06   
ref|WP_007184713.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_010959508.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_031394782.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_038064175.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_027468612.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_037530116.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
gb|EGZ40840.1|  Adenosylhomocysteinase                                55.1    3e-06   
gb|AGT02658.1|  adenosylhomocysteinase                                54.7    3e-06   
ref|WP_031439895.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_010185446.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|XP_008552504.1|  PREDICTED: adenosylhomocysteinase                54.7    3e-06   
ref|WP_044241961.1|  adenosylhomocysteinase                           54.7    3e-06   
ref|WP_031016033.1|  adenosylhomocysteinase                           52.0    3e-06   
ref|WP_030694622.1|  adenosylhomocysteinase                           51.6    3e-06   
ref|WP_022655001.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_011582886.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_034425692.1|  adenosylhomocysteinase                           54.7    3e-06   
gb|KFB41122.1|  S-adenosyl-L-homocysteine hydrolase                   54.3    3e-06   
ref|WP_020087971.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_011129517.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_017365992.1|  S-adenosyl-L-homocysteine hydrolase              54.7    3e-06   
ref|WP_037400614.1|  hypothetical protein                             52.0    3e-06   
ref|XP_816022.1|  S-adenosylhomocysteine hydrolase                    54.3    3e-06   
ref|WP_033266625.1|  adenosylhomocysteinase                           54.7    3e-06   
ref|WP_019957549.1|  S-adenosyl-L-homocysteine hydrolase              54.3    3e-06   
ref|WP_011686968.1|  S-adenosyl-L-homocysteine hydrolase              54.3    3e-06   
ref|XP_002640240.1|  Hypothetical protein CBG12756                    54.3    3e-06   
ref|WP_011934524.1|  S-adenosyl-L-homocysteine hydrolase              54.3    3e-06   
ref|WP_004000737.1|  putative Adenosylhomocysteinase                  54.3    3e-06   
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase              54.3    3e-06   
ref|WP_024758596.1|  adenosylhomocysteinase                           54.3    3e-06   
ref|WP_002975666.1|  adenosylhomocysteinase                           54.3    3e-06   
ref|WP_018623436.1|  S-adenosyl-L-homocysteine hydrolase              54.3    3e-06   



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+PDQAAYISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+PDQAAYISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P+QAAYISVPVEGPYKPP YRY
Sbjct  453  GKLGAKLTKLTPEQAAYISVPVEGPYKPPRYRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLSP+QAAYISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  485



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGAKLTKLSTDQADYISVPIEGPYKPPHYRY  485



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>emb|CBI14896.3| unnamed protein product [Vitis vinifera]
Length=255

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLSP+QAAYISVPVEGPYKP +YRY
Sbjct  223  GKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  255



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P+QAAYISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P+QAAYISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKLSPDQA YI+VP+EGPYKPP YRY
Sbjct  453  GKLGAHLTKLSPDQAEYINVPIEGPYKPPQYRY  485



>emb|CBI17300.3| unnamed protein product [Vitis vinifera]
Length=244

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKPP+YRY
Sbjct  212  GKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  244



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  485



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKPP+YRY
Sbjct  418  GKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTPAQAEYISVPIEGPYKPPHYRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_005843353.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
 gb|EFN51251.1| S-adenosyl-L-homocysteine hydrolase [Chlorella variabilis]
Length=483

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKL+PDQA YI+VP+EGPYKPP+YRY
Sbjct  452  KLGAKLTKLTPDQATYINVPIEGPYKPPHYRY  483



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVPVEGPYKPP+YRY
Sbjct  435  GKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  467



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP++GPYKPP+YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPIDGPYKPPHYRY  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVP EGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTPSQAEYISVPTEGPYKPPHYRY  485



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPV+GPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPV+GPYKPP+YRY
Sbjct  447  GKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPPHYRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  391  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  423



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ YISVP+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYISVPIEGPYKPPHYRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+PVEGPYKPP+YRY
Sbjct  515  GKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYRY  547



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+  QAAYI+VPVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTSGQAAYINVPVEGPYKPPHYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLSP QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSPAQADYISVPVEGPYKPAHYRY  485



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ YIS+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYISIPIEGPYKPPHYRY  485



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  313  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  345



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ YIS+PVEGPYKPP+YRY
Sbjct  542  GKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  574



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYISVPVEGPYKPLHYRY  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  195  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  454  KLGAKLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  424  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVPVEGPYKP +YRY
Sbjct  452  GKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  484



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QAAYISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTSEQAAYISVPVEGPYKPAHYRY  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  453  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YI+VPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  232  GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  264



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQAEYISVPVEGPYKPVHYRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  408  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  440



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQAEYISVPIEGPYKPAHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +Q+ YIS+PVEGPYKPP+YRY
Sbjct  453  GKLGAKLTKLTKEQSDYISIPVEGPYKPPHYRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>dbj|BAF01736.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=96

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  64   GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  96



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLS DQAAYI+VPVEGPYKP +YRY
Sbjct  454  KLGAKLTKLSADQAAYINVPVEGPYKPAHYRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YI+VPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YI+VPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS DQA YI+VPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YIS+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YIS+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VPVEGPYKP +YRY
Sbjct  454  KLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ  Y+S+P+EGPYKPP+YRY
Sbjct  453  GKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY  485



>ref|XP_003081254.1| SAHH_PETCR Adenosylhomocysteinase (ISS) [Ostreococcus tauri]
Length=421

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GK+GAKLTKLS +QAAYI+VPVEGPYKP  YRY
Sbjct  389  GKIGAKLTKLSTEQAAYINVPVEGPYKPAAYRY  421



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YRY
Sbjct  233  GKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  265



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ YIS+PVEGPYKPP+YRY
Sbjct  270  GKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  302



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  332  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  364



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP NYRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP NYRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>emb|CEF99088.1| S-adenosyl-L-homocysteine hydrolase, conserved site [Ostreococcus 
tauri]
Length=486

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GK+GAKLTKLS +QAAYI+VPVEGPYKP  YRY
Sbjct  454  GKIGAKLTKLSTEQAAYINVPVEGPYKPAAYRY  486



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VP+EGPYKP +YRY
Sbjct  454  KLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP  YRY
Sbjct  529  GKLGARLTKLSKDQADYISVPVEGPYKPAQYRY  561



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP NYRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSEDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ YIS+P++GPYKPP+YRY
Sbjct  453  GKLGARLTKLTKDQSDYISIPIQGPYKPPHYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA LTKLSP+QAAYI+VPVEGPYKP +YRY
Sbjct  454  KLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS +QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKEQADYISVPIEGPYKPAHYRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  259  GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  291



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISVPVEGPYKP +YR+
Sbjct  453  GKLGARLTKLSKDQADYISVPVEGPYKPAHYRH  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+P QA YI+VP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTPSQAEYINVPIEGPYKPAHYRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+L KLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLAKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+VP+EGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINVPIEGPYKPAQYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP NYRY
Sbjct  259  GKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  291



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>ref|WP_026633760.1| S-adenosyl-L-homocysteine hydrolase [Dyella japonica]
Length=477

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            ++G KLTKL+PDQAAYI VPVEGPYKP +YRY
Sbjct  446  QIGVKLTKLTPDQAAYIGVPVEGPYKPDHYRY  477



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ YIS+P+EGPYKP +YRY
Sbjct  556  GKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  588



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+L KLS DQ+ Y+S+P+EGPYKPP+YRY
Sbjct  435  GKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGA+LTKLSPDQA YI+VPV+GPYKP +YRY
Sbjct  419  KLGARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS  QA YISVPVEGPYKP +YRY
Sbjct  418  GKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGA+LTKLS DQA YISVPVEGPYKP +YRY
Sbjct  259  GQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  291



>ref|WP_007277276.1| S-adenosyl-L-homocysteine hydrolase [Lentisphaera araneosa]
 gb|EDM28974.1| S-adenosyl-L-homocysteine hydrolase [Lentisphaera araneosa HTCC2155]
Length=474

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLT LS +QA YISVPVEGPYKP +YRY
Sbjct  442  GKLGAKLTTLSQEQADYISVPVEGPYKPEHYRY  474



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ YIS+P+EGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  485



>gb|ADQ00183.1| S-adenosyl homocysteine hydrolase [Chlamydomonas sp. ICE-L]
Length=487

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLG KLTKLSP+QAAYI+VP+ GPYKP NYRY
Sbjct  456  KLGCKLTKLSPEQAAYINVPIGGPYKPANYRY  487



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYR  223
            GKLGA LTKL+ DQA YISVP+EGPYKPP+YR
Sbjct  453  GKLGANLTKLTKDQADYISVPIEGPYKPPHYR  484



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  454  KLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  457  KLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  488



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LT+LS DQA YI+VPVEGPYKP  YRY
Sbjct  453  GKLGARLTELSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LG KLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LG KLTKLS DQA YISVPVEGPYKP +YRY
Sbjct  453  GQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009623649.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
 ref|XP_009623651.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=110

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKL+P+QAAYI VP EGPYKPP+Y Y
Sbjct  79   KLGAKLTKLTPEQAAYIRVPTEGPYKPPHYMY  110



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+P+EGPYKP +YRY
Sbjct  454  GKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  486



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS  QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGARLTKLSKSQADYISVPIEGPYKPAHYRY  485



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISV VEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLT+LS  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>ref|WP_026611089.1| S-adenosyl-L-homocysteine hydrolase [Methylocaldum szegediense]
Length=472

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            K+GA+LTKL+P+QAAYI VPVEGPYKP +YRY
Sbjct  441  KIGAQLTKLTPEQAAYIGVPVEGPYKPDHYRY  472



>ref|WP_026640729.1| S-adenosyl-L-homocysteine hydrolase [Bordetella petrii]
Length=472

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLT+L P+QA+YI+VPVEGPYKP +YRY
Sbjct  441  KLGAKLTELRPEQASYINVPVEGPYKPEHYRY  472



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLT+LS  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YI+ PVEGPYKP  YRY
Sbjct  453  GKLGARLTKLSKDQADYINAPVEGPYKPAQYRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQA YISV VEGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>emb|CCQ38381.1| adenosyl-homocysteine hydrolase, partial [Schiedea laui]
 emb|CCQ38382.1| adenosyl-homocysteine hydrolase, partial [Schiedea pentandra]
 emb|CCQ38383.1| adenosyl-homocysteine hydrolase, partial [Schiedea jacobii]
 emb|CCQ38384.1| adenosyl-homocysteine hydrolase, partial [Schiedea kaalae]
 emb|CCQ38385.1| adenosyl-homocysteine hydrolase, partial [Schiedea kauaiensis]
 emb|CCQ38386.1| adenosyl-homocysteine hydrolase, partial [Schiedea perlmanii]
 emb|CCQ38387.1| adenosyl-homocysteine hydrolase, partial [Schiedea nuttallii]
 emb|CCQ38388.1| adenosyl-homocysteine hydrolase, partial [Schiedea stellarioides]
 emb|CCQ38389.1| adenosyl-homocysteine hydrolase, partial [Schiedea spergulina]
 emb|CCQ38390.1| adenosyl-homocysteine hydrolase, partial [Schiedea kealiae]
 emb|CCQ38391.1| adenosyl-homocysteine hydrolase, partial [Schiedea mannii]
 emb|CCQ38392.1| adenosyl-homocysteine hydrolase, partial [Schiedea adamantis]
 emb|CCQ38393.1| adenosyl-homocysteine hydrolase, partial [Schiedea menziesii]
 emb|CCQ38394.1| adenosyl-homocysteine hydrolase, partial [Schiedea hookeri]
 emb|CCQ38395.1| adenosyl-homocysteine hydrolase, partial [Schiedea sarmentosa]
 emb|CCQ38396.1| adenosyl-homocysteine hydrolase, partial [Schiedea lydgatei]
 emb|CCQ38397.1| adenosyl-homocysteine hydrolase, partial [Schiedea haleakalensis]
 emb|CCQ38398.1| adenosyl-homocysteine hydrolase, partial [Schiedea ligustrina]
 emb|CCQ38399.1| adenosyl-homocysteine hydrolase, partial [Schiedea salicaria]
 emb|CCQ38400.1| adenosyl-homocysteine hydrolase, partial [Schiedea globosa]
 emb|CCQ38401.1| adenosyl-homocysteine hydrolase, partial [Schiedea apokremnos]
 emb|CCQ38402.1| adenosyl-homocysteine hydrolase, partial [Schiedea helleri]
 emb|CCQ38403.1| adenosyl-homocysteine hydrolase, partial [Schiedea membranacea]
 emb|CCQ38405.1| adenosyl-homocysteine hydrolase, partial [Schiedea obovata]
 emb|CCQ38406.1| adenosyl-homocysteine hydrolase, partial [Schiedea viscosa]
 emb|CCQ38407.1| adenosyl-homocysteine hydrolase, partial [Schiedea verticillata]
Length=50

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  18   GKLGAKLTKLTKDQSDYLSIPVEGPYKPVHYRY  50



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+  QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKLS  Q+ YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLSKSQSDYISVPIEGPYKPAHYRY  485



>gb|KFK36282.1| hypothetical protein AALP_AA4G102500 [Arabis alpina]
Length=154

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ YIS+P+EGPYKP ++RY
Sbjct  122  GKLGARLTKLSKDQSDYISIPIEGPYKPAHHRY  154



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+  QA YIS+P+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKSQADYISIPIEGPYKPAHYRY  485



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  428  GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  460



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKP  YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPAAYRY  485



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLT LS DQA YI+VPVEGPYKP NYRY
Sbjct  295  GKLGAKLTVLSKDQADYINVPVEGPYKPLNYRY  327



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+  QA YISVPVEGPYKP +YRY
Sbjct  453  GKLGARLTKLTKSQADYISVPVEGPYKPAHYRY  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+  QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP +YRY
Sbjct  475  GKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  507



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+  QA YISVP+EGPYKP +YRY
Sbjct  453  GKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|WP_028454764.1| S-adenosyl-L-homocysteine hydrolase [Chitinilyticum litopenaei]
Length=472

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            K+GAKLT L+P+QAAYI VPVEGPYKP +YRY
Sbjct  441  KIGAKLTVLTPEQAAYIGVPVEGPYKPAHYRY  472



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            G+LGAKLTKL+ +QA YISVPVEGPYKP +YRY
Sbjct  453  GQLGAKLTKLTKEQADYISVPVEGPYKPVHYRY  485



>ref|WP_028453563.1| S-adenosyl-L-homocysteine hydrolase [Chitinilyticum aquatile]
Length=466

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            K+GAKLT L+P+QAAYI VPVEGPYKP +YRY
Sbjct  435  KIGAKLTVLTPEQAAYIGVPVEGPYKPAHYRY  466



>ref|XP_001693339.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
 gb|EDP03365.1| S-Adenosyl homocysteine hydrolase [Chlamydomonas reinhardtii]
Length=483

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLG KLTKLS DQAAYI+VPV+GPYKP +YRY
Sbjct  452  KLGVKLTKLSADQAAYINVPVDGPYKPAHYRY  483



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKLS  QA YISVPVEGPYKP +YRY
Sbjct  454  KLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKLS DQ+ Y+S+P+EGPYKP +YRY
Sbjct  453  GKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|WP_020676549.1| hypothetical protein [Geopsychrobacter electrodiphilus]
Length=476

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLT L+P+Q+AYI +P+EGPYKP +YRY
Sbjct  445  KLGAKLTTLTPEQSAYIDIPIEGPYKPDHYRY  476



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  453  GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  453  GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  453  GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGA+LTKL+ DQ+ Y+S+PVEGPYKP +YRY
Sbjct  453  GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GK GAKLTKL+ DQA YI VPVEGPYKP +YRY
Sbjct  453  GKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY  485



>ref|XP_002950429.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
 gb|EFJ48630.1| hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis]
Length=483

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLT+LSP+QA YI+VPV+GPYKP +YRY
Sbjct  452  KLGAKLTRLSPEQATYINVPVDGPYKPLHYRY  483



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  318  GKLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            GKLGAKLTKL+ +QA YISVPVEGPYKP  YRY
Sbjct  453  GKLGAKLTKLTKEQADYISVPVEGPYKPLAYRY  485



>ref|WP_028450258.1| S-adenosyl-L-homocysteine hydrolase [Chitinibacter tainanensis]
Length=466

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            K+GAKLT LSP+QAAYI VPV+GPYKP +YRY
Sbjct  435  KIGAKLTVLSPEQAAYIGVPVDGPYKPAHYRY  466



>ref|WP_038034910.1| S-adenosyl-L-homocysteine hydrolase [Thermopetrobacter sp. TC1]
Length=466

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  315  KLGAKLTKLSPDQAAYISVPVEGPYKPPNYRY  220
            KLGAKLTKL+P+QA YI VPVEGPYKP  YRY
Sbjct  435  KLGAKLTKLTPEQAEYIGVPVEGPYKPDWYRY  466



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552963472315