BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004K23

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                85.5    6e-17   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                84.0    2e-16   Nicotiana tomentosiformis
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  80.1    6e-16   
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  79.0    1e-15   Solanum tuberosum [potatoes]
gb|AGC65583.1|  fatty aldehyde dehydrogenase                          82.0    1e-15   Simmondsia chinensis [goatnut]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein   80.9    3e-15   Medicago truncatula
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein   80.1    7e-15   Medicago truncatula
gb|KJB59283.1|  hypothetical protein B456_009G247000                  77.8    8e-15   Gossypium raimondii
ref|XP_006370381.1|  hypothetical protein POPTR_0001s421502g          74.7    1e-14   
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...  79.0    2e-14   
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1             79.0    2e-14   Gossypium arboreum [tree cotton]
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    2e-14   
gb|KJB59281.1|  hypothetical protein B456_009G247000                  78.2    2e-14   Gossypium raimondii
gb|KDO80590.1|  hypothetical protein CISIN_1g011107mg                 76.6    2e-14   Citrus sinensis [apfelsine]
ref|XP_006370382.1|  hypothetical protein POPTR_0001s421502g          74.7    2e-14   
gb|KJB59280.1|  hypothetical protein B456_009G247000                  78.6    2e-14   Gossypium raimondii
gb|KDO80588.1|  hypothetical protein CISIN_1g011107mg                 76.6    3e-14   Citrus sinensis [apfelsine]
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.8    3e-14   Cicer arietinum [garbanzo]
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.6    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.6    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    3e-14   Fragaria vesca subsp. vesca
gb|AFK46379.1|  unknown                                               76.3    3e-14   Medicago truncatula
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  78.2    3e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ85852.1|  unknown                                               78.2    3e-14   Medicago truncatula
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.8    4e-14   Populus euphratica
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.8    4e-14   Populus euphratica
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g           77.4    5e-14   Phaseolus vulgaris [French bean]
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.4    6e-14   Fragaria vesca subsp. vesca
gb|KDO80586.1|  hypothetical protein CISIN_1g011107mg                 76.6    7e-14   Citrus sinensis [apfelsine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.0    7e-14   Citrus sinensis [apfelsine]
gb|KDO80587.1|  hypothetical protein CISIN_1g011107mg                 76.6    8e-14   Citrus sinensis [apfelsine]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                 77.0    8e-14   Citrus sinensis [apfelsine]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  77.0    8e-14   
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg           77.0    8e-14   Citrus clementina [clementine]
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1             77.0    8e-14   Glycine soja [wild soybean]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1        76.6    1e-13   
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...  76.6    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  76.6    1e-13   Populus euphratica
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1             76.3    1e-13   
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2             76.3    2e-13   
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg              76.3    2e-13   Erythranthe guttata [common monkey flower]
gb|ABK24239.1|  unknown                                               76.3    2e-13   Picea sitchensis
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein   75.5    2e-13   Medicago truncatula
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1        75.5    2e-13   
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    3e-13   Eucalyptus grandis [rose gum]
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  75.5    3e-13   Eucalyptus grandis [rose gum]
gb|KHN21716.1|  Aldehyde dehydrogenase family 3 member H1             74.7    4e-13   Glycine soja [wild soybean]
ref|XP_010444974.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    4e-13   Camelina sativa [gold-of-pleasure]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                   74.7    4e-13   Eucalyptus grandis [rose gum]
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.7    5e-13   Eucalyptus grandis [rose gum]
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.7    5e-13   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                 74.3    5e-13   
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.7    5e-13   Tarenaya hassleriana [spider flower]
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                   74.7    6e-13   Eucalyptus grandis [rose gum]
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.3    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  74.3    7e-13   Pyrus x bretschneideri [bai li]
ref|XP_010437648.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.9    8e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006847205.1|  hypothetical protein AMTR_s00017p00253390        73.2    9e-13   
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    1e-12   
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    1e-12   Prunus mume [ume]
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    2e-12   Malus domestica [apple tree]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    2e-12   
ref|XP_010444975.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    2e-12   
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.2    2e-12   Phoenix dactylifera
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  73.6    2e-12   Populus euphratica
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg           73.2    2e-12   Prunus persica
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg           72.8    2e-12   
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    2e-12   Cucumis sativus [cucumbers]
ref|XP_010437649.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009350139.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    2e-12   
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  72.8    2e-12   
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    3e-12   Populus euphratica
gb|KGN54555.1|  hypothetical protein Csa_4G361890                     72.0    3e-12   Cucumis sativus [cucumbers]
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g           72.8    3e-12   Populus trichocarpa [western balsam poplar]
gb|KGN54554.1|  hypothetical protein Csa_4G361880                     72.4    3e-12   Cucumis sativus [cucumbers]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.8    3e-12   Prunus mume [ume]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.4    3e-12   Cucumis melo [Oriental melon]
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.4    3e-12   
gb|EYU23873.1|  hypothetical protein MIMGU_mgv1a005640mg              72.0    3e-12   Erythranthe guttata [common monkey flower]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  72.0    4e-12   
ref|XP_002869163.1|  ALDH3I1                                          70.1    5e-12   Arabidopsis lyrata subsp. lyrata
gb|KJB29202.1|  hypothetical protein B456_005G089100                  71.6    6e-12   Gossypium raimondii
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.9    6e-12   Vitis vinifera
emb|CBI21614.3|  unnamed protein product                              70.9    6e-12   Vitis vinifera
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1             71.6    6e-12   Gossypium arboreum [tree cotton]
emb|CAN73659.1|  hypothetical protein VITISV_044129                   70.5    6e-12   Vitis vinifera
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1             71.6    6e-12   Gossypium arboreum [tree cotton]
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg              71.2    7e-12   Erythranthe guttata [common monkey flower]
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  71.2    8e-12   Glycine max [soybeans]
gb|KJB29203.1|  hypothetical protein B456_005G089100                  71.2    8e-12   Gossypium raimondii
emb|CAB36701.1|  putative aldehyde dehydrogenase                      70.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31773.1|  hypothetical protein MIMGU_mgv1a018415mg              69.3    1e-11   Erythranthe guttata [common monkey flower]
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1             71.2    1e-11   Glycine soja [wild soybean]
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g           70.9    1e-11   Phaseolus vulgaris [French bean]
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004515933.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.2    1e-11   
ref|XP_002893982.1|  ALDH3H1                                          70.5    1e-11   
emb|CAC84903.1|  aldehyde dehydrogenase                               70.5    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.5    2e-11   
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                          70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDP32847.1|  hypothetical protein JCGZ_12139                       69.7    2e-11   Jatropha curcas
ref|XP_004515930.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.6    2e-11   
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.1    2e-11   Brassica rapa
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                 69.3    2e-11   Citrus sinensis [apfelsine]
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.1    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  70.1    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg           69.3    3e-11   Citrus clementina [clementine]
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.7    3e-11   Camelina sativa [gold-of-pleasure]
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                 68.9    3e-11   Citrus sinensis [apfelsine]
ref|XP_002888606.1|  ALDH3H1                                          69.7    3e-11   
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470        68.2    4e-11   
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   Fragaria vesca subsp. vesca
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   
ref|XP_004515932.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  67.4    4e-11   
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   Glycine max [soybeans]
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg           69.3    4e-11   Capsella rubella
ref|XP_004515931.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  67.4    4e-11   
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   Elaeis guineensis
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  69.3    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.4    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.4    5e-11   
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg           69.3    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    5e-11   Glycine max [soybeans]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    5e-11   Cicer arietinum [garbanzo]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.9    5e-11   
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.6    6e-11   Tarenaya hassleriana [spider flower]
gb|AAM61211.1|  aldehyde dehydrogenase, putative                      68.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                          68.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.6    7e-11   Glycine max [soybeans]
gb|AFK40162.1|  unknown                                               65.5    7e-11   Lotus japonicus
ref|NP_001077676.1|  aldehyde dehydrogenase 3H1                       68.2    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.6    8e-11   Tarenaya hassleriana [spider flower]
gb|ABR16899.1|  unknown                                               68.6    9e-11   Picea sitchensis
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.2    9e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17901.1|  Aldehyde dehydrogenase family 3 member I1, chloro...  67.4    1e-10   Gossypium arboreum [tree cotton]
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like           67.8    1e-10   Sesamum indicum [beniseed]
ref|XP_004514084.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  65.1    1e-10   
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.2    1e-10   Cicer arietinum [garbanzo]
gb|ABR25386.1|  aldehyde dehydrogenase dimeric nadp preferring        64.3    1e-10   Oryza sativa Indica Group [Indian rice]
gb|KJB75341.1|  hypothetical protein B456_012G037500                  67.8    1e-10   Gossypium raimondii
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  68.2    1e-10   Cicer arietinum [garbanzo]
gb|KJB75337.1|  hypothetical protein B456_012G037500                  67.4    1e-10   Gossypium raimondii
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                67.8    1e-10   Sesamum indicum [beniseed]
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  67.4    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_006662790.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  67.0    2e-10   
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  64.3    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g           67.8    2e-10   Phaseolus vulgaris [French bean]
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1             63.5    2e-10   Triticum urartu
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg           67.4    2e-10   Capsella rubella
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1             63.5    2e-10   
dbj|BAK01937.1|  predicted protein                                    63.2    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB75338.1|  hypothetical protein B456_012G037500                  67.0    3e-10   Gossypium raimondii
gb|KJB75340.1|  hypothetical protein B456_012G037500                  67.0    3e-10   Gossypium raimondii
emb|CDY36336.1|  BnaC08g05150D                                        67.0    3e-10   Brassica napus [oilseed rape]
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg           67.0    3e-10   Eutrema salsugineum [saltwater cress]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  66.6    3e-10   Brassica rapa
emb|CDY36018.1|  BnaA08g04430D                                        66.6    3e-10   Brassica napus [oilseed rape]
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  66.6    3e-10   Oryza brachyantha
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397           66.6    3e-10   
gb|AAX96338.1|  aldehyde dehydrogenase, putative                      64.7    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065921.1|  Os11g0186200                                     64.3    4e-10   
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  61.6    4e-10   Nelumbo nucifera [Indian lotus]
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                  66.6    4e-10   Arabis alpina [alpine rockcress]
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2             62.8    5e-10   
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3             62.8    5e-10   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1             62.8    5e-10   
gb|EAZ19830.1|  hypothetical protein OsJ_35414                        65.9    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82454.1|  hypothetical protein OsI_37671                        65.9    6e-10   Oryza sativa Indica Group [Indian rice]
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein   65.9    6e-10   Medicago truncatula
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1        65.9    6e-10   
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  65.9    7e-10   
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                  65.5    7e-10   
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...  62.4    7e-10   Craterostigma plantagineum
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed      65.5    8e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CAE51203.1|  putative aldehyde dehydrogenase                      65.5    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001168661.1|  hypothetical protein                             65.1    1e-09   Zea mays [maize]
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  65.1    1e-09   Cicer arietinum [garbanzo]
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  65.1    1e-09   Cucumis melo [Oriental melon]
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146           64.7    1e-09   
gb|ACF85700.1|  unknown                                               64.7    1e-09   Zea mays [maize]
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring       64.7    1e-09   Zea mays [maize]
gb|KJB75339.1|  hypothetical protein B456_012G037500                  64.7    2e-09   Gossypium raimondii
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  64.3    2e-09   Cucumis melo [Oriental melon]
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200             63.9    3e-09   Arabis alpina [alpine rockcress]
emb|CDX69039.1|  BnaC01g04140D                                        62.0    5e-09   
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring  62.4    8e-09   
gb|AID60136.1|  aldehyde dehydrogenase 3                              62.0    1e-08   Brassica napus [oilseed rape]
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.0    1e-08   
emb|CDX75414.1|  BnaA01g02880D                                        62.0    1e-08   
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  62.0    1e-08   
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647           62.0    1e-08   
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300           62.0    1e-08   
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...  62.0    1e-08   Brassica rapa
gb|EPS67421.1|  aldehyde dehydrogenase                                59.7    2e-08   Genlisea aurea
emb|CDY14975.1|  BnaA10g08810D                                        57.8    2e-08   Brassica napus [oilseed rape]
gb|AAF31414.1|AF201891_1  aldehyde dehydrogenase                      57.4    2e-08   Gossypium hirsutum [American cotton]
gb|AAF31413.1|AF201890_1  aldehyde dehydrogenase                      57.4    2e-08   Gossypium herbaceum [Arabian cotton]
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  60.8    3e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT24757.1|  Aldehyde dehydrogenase family 3 member H1             60.1    4e-08   
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  60.5    4e-08   Vitis vinifera
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  60.5    4e-08   Vitis vinifera
emb|CBI19000.3|  unnamed protein product                              60.5    5e-08   Vitis vinifera
gb|KJB64493.1|  hypothetical protein B456_010G051500                  60.1    6e-08   Gossypium raimondii
gb|AAF31416.1|AF201893_1  aldehyde dehydrogenase                      56.2    6e-08   Gossypium hirsutum [American cotton]
gb|KJB64495.1|  hypothetical protein B456_010G051500                  59.7    7e-08   Gossypium raimondii
gb|EMS67813.1|  Aldehyde dehydrogenase family 3 member H1             58.5    1e-07   Triticum urartu
ref|XP_001780129.1|  variable substrate                               56.6    2e-07   
ref|XP_010093107.1|  Aldehyde dehydrogenase family 3 member I1        58.2    3e-07   
gb|AAF31412.1|AF201889_1  aldehyde dehydrogenase                      54.3    3e-07   Gossypioides kirkii
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.4    3e-07   Setaria italica
ref|XP_009060246.1|  hypothetical protein LOTGIDRAFT_229102           57.8    4e-07   Lottia gigantea
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.8    4e-07   
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  57.4    4e-07   Brachypodium distachyon [annual false brome]
gb|KHN25245.1|  Aldehyde dehydrogenase family 3 member F1             57.0    4e-07   Glycine soja [wild soybean]
gb|AFW56225.1|  hypothetical protein ZEAMMB73_146423                  57.0    5e-07   
emb|CDY66167.1|  BnaCnng49760D                                        54.7    5e-07   Brassica napus [oilseed rape]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring  57.0    7e-07   Zea mays [maize]
gb|ACL53721.1|  unknown                                               56.6    7e-07   Zea mays [maize]
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.1    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001757163.1|  variable substrate                               56.6    9e-07   
ref|XP_003539064.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  56.6    9e-07   Glycine max [soybeans]
gb|KHN21904.1|  Aldehyde dehydrogenase family 3 member F1             55.8    1e-06   Glycine soja [wild soybean]
ref|WP_021267505.1|  aldehyde dehydrogenase (NAD) family protein      55.5    2e-06   Bacteriovorax sp. BAL6_X
ref|WP_012163534.1|  aldehyde dehydrogenase                           55.1    2e-06   Acaryochloris marina
ref|WP_010474036.1|  aldehyde dehydrogenase                           55.1    3e-06   Acaryochloris sp. CCMEE 5410
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  55.1    3e-06   Cicer arietinum [garbanzo]
ref|XP_008878747.1|  hypothetical protein H310_13140                  55.1    3e-06   Aphanomyces invadans
gb|EKF37873.1|  aldehyde dehydrogenase family, putative               54.7    3e-06   Trypanosoma cruzi marinkellei
ref|WP_015160249.1|  NAD-dependent aldehyde dehydrogenase             54.7    4e-06   Chamaesiphon minutus
ref|XP_004173349.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  51.6    6e-06   
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  53.9    7e-06   Nicotiana sylvestris
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  53.9    7e-06   Cucumis melo [Oriental melon]
ref|XP_007150367.1|  hypothetical protein PHAVU_005G147600g           53.1    1e-05   Phaseolus vulgaris [French bean]
gb|EYU46263.1|  hypothetical protein MIMGU_mgv1a0057251mg             52.8    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840        52.8    1e-05   Sorghum bicolor [broomcorn]
ref|WP_025977505.1|  aldehyde dehydrogenase                           52.8    2e-05   
gb|KFM72617.1|  Aldehyde dehydrogenase, dimeric NADP-preferring       52.8    2e-05   Stegodyphus mimosarum
ref|XP_004338470.1|  aldehyde dehydrogenase                           49.7    2e-05   Acanthamoeba castellanii str. Neff
gb|KIE11140.1|  aldehyde dehydrogenase                                52.4    2e-05   Tolypothrix bouteillei VB521301
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  52.4    2e-05   Nelumbo nucifera [Indian lotus]
ref|WP_015149862.1|  NAD-dependent aldehyde dehydrogenase             52.4    2e-05   Oscillatoria acuminata
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g           52.4    2e-05   Phaseolus vulgaris [French bean]
emb|CDS09687.1|  hypothetical protein LRAMOSA02364                    52.4    2e-05   Lichtheimia ramosa
gb|KEH30216.1|  NAD-dependent aldehyde dehydrogenase family protein   52.0    2e-05   Medicago truncatula
gb|AFK41010.1|  unknown                                               51.2    3e-05   Lotus japonicus
ref|WP_008182868.1|  aldehyde dehydrogenase                           52.0    3e-05   Moorea producens
ref|WP_039329311.1|  aldehyde dehydrogenase                           52.0    3e-05   Myroides sp. A21
ref|WP_006263421.1|  aldehyde dehydrogenase                           52.0    3e-05   Myroides
ref|WP_006259127.1|  aldehyde dehydrogenase                           52.0    3e-05   Myroides
ref|WP_034840010.1|  aldehyde dehydrogenase [                         52.0    3e-05   
ref|WP_015359816.1|  NAD-dependent aldehyde dehydrogenase AlkH [      52.0    3e-05   Thermoclostridium stercorarium
ref|WP_015181603.1|  NAD-dependent aldehyde dehydrogenase             51.6    4e-05   Microcoleus sp. PCC 7113
ref|XP_003543533.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  51.6    4e-05   Glycine max [soybeans]
ref|WP_038986781.1|  aldehyde dehydrogenase                           51.6    4e-05   Myroides marinus
ref|XP_001764841.1|  variable substrate                               51.6    4e-05   
ref|WP_026859166.1|  aldehyde dehydrogenase                           51.2    4e-05   Jeotgalicoccus psychrophilus
ref|WP_025125538.1|  aldehyde dehydrogenase                           51.2    5e-05   Myroides odoratimimus
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...  51.2    5e-05   
gb|KHN73866.1|  Fatty aldehyde dehydrogenase                          51.2    5e-05   Toxocara canis
ref|WP_036682101.1|  aldehyde dehydrogenase                           51.2    5e-05   Paenibacillus
gb|KHN33348.1|  Aldehyde dehydrogenase family 3 member F1             51.2    5e-05   Glycine soja [wild soybean]
ref|XP_003547154.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  51.2    5e-05   
ref|WP_038573737.1|  aldehyde dehydrogenase                           51.2    5e-05   Paenibacillus odorifer
ref|WP_021277988.1|  aldehyde dehydrogenase (NAD) family protein      51.2    6e-05   Bacteriovorax sp. DB6_IX
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.8    6e-05   
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.8    6e-05   
gb|KGN54173.1|  hypothetical protein Csa_4G291370                     50.8    6e-05   Cucumis sativus [cucumbers]
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1        50.8    7e-05   Morus notabilis
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.8    7e-05   Elaeis guineensis
ref|WP_041890888.1|  aldehyde dehydrogenase                           50.8    7e-05   Myroides profundi
ref|WP_036667375.1|  aldehyde dehydrogenase                           49.7    8e-05   
ref|WP_016866084.1|  aldehyde dehydrogenase                           50.4    8e-05   Fischerella muscicola
ref|XP_010034106.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.4    9e-05   
gb|KCW51186.1|  hypothetical protein EUGRSUZ_J00772                   50.4    9e-05   Eucalyptus grandis [rose gum]
emb|CEP63575.1|  LALA0S08e05732g1_1                                   50.4    9e-05   
ref|WP_016862719.1|  aldehyde dehydrogenase                           50.4    1e-04   
ref|XP_008631478.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.4    1e-04   
gb|EPH12072.1|  aldehyde dehydrogenase (NAD+)                         49.3    1e-04   
ref|XP_004977223.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.4    1e-04   
gb|KHN30135.1|  Aldehyde dehydrogenase family 3 member F1             50.4    1e-04   
ref|WP_044449982.1|  aldehyde dehydrogenase                           50.1    1e-04   
gb|ABK96187.1|  unknown                                               47.8    1e-04   
gb|EPY05561.1|  aldehyde dehydrogenase                                48.9    1e-04   
ref|XP_005104004.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.1    1e-04   
ref|WP_017310244.1|  aldehyde dehydrogenase                           50.1    1e-04   
gb|KFO58781.1|  Aldehyde dehydrogenase family 3 member B1             50.1    1e-04   
ref|WP_036620630.1|  aldehyde dehydrogenase                           48.9    1e-04   
ref|WP_009457992.1|  aldehyde dehydrogenase                           50.1    1e-04   
ref|WP_026722884.1|  aldehyde dehydrogenase                           50.1    1e-04   
ref|WP_016871050.1|  aldehyde dehydrogenase                           50.1    1e-04   
ref|XP_010536078.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.1    1e-04   
ref|XP_010555061.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.1    1e-04   
ref|WP_021275954.1|  aldehyde dehydrogenase (NAD) family protein      50.1    1e-04   
ref|XP_006345274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  50.1    1e-04   
ref|XP_010317521.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  49.7    1e-04   
gb|EMS57171.1|  Aldehyde dehydrogenase family 3 member F1             50.1    1e-04   
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  49.7    2e-04   
ref|WP_006261022.1|  aldehyde dehydrogenase                           49.7    2e-04   
ref|WP_017316439.1|  aldehyde dehydrogenase                           49.7    2e-04   
emb|CDH60024.1|  fatty aldehyde dehydrogenase                         49.7    2e-04   
ref|XP_008939306.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    2e-04   
ref|XP_008917828.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  49.7    2e-04   
ref|XP_004343114.1|  aldehyde dehydrogenase type III-PG               49.7    2e-04   
gb|KJE97385.1|  aldehyde dehydrogenase type III-PG                    49.7    2e-04   
gb|AFW59012.1|  hypothetical protein ZEAMMB73_052021                  48.9    2e-04   
gb|KFW77386.1|  Aldehyde dehydrogenase family 3 member B1             49.3    2e-04   
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449            49.3    2e-04   
gb|KEH39462.1|  NAD-dependent aldehyde dehydrogenase family protein   49.3    2e-04   
ref|WP_014394998.1|  aldehyde dehydrogenase                           49.3    2e-04   
ref|XP_009307681.1|  putative aldehyde dehydrogenase family           49.3    2e-04   
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g           49.3    2e-04   
ref|XP_011167295.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  49.3    2e-04   
ref|XP_011167296.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  49.3    2e-04   
ref|XP_011167294.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  49.3    2e-04   
dbj|BAD25530.1|  putative aldehyde dehydrogenase                      49.3    2e-04   
ref|XP_011167293.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  49.3    2e-04   
ref|XP_011167291.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  49.3    2e-04   
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  49.3    2e-04   
ref|WP_009633558.1|  NAD-dependent aldehyde dehydrogenase             49.3    2e-04   
ref|XP_007015039.1|  Aldehyde dehydrogenase family 3 member F1        49.3    2e-04   
ref|XP_002490175.1|  Putative fatty aldehyde dehydrogenase            49.3    2e-04   
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1        49.3    2e-04   
ref|WP_041252942.1|  aldehyde dehydrogenase                           48.9    2e-04   
gb|ACU07241.1|  Aldehyde dehydrogenase                                48.9    2e-04   
ref|NP_001047578.1|  Os02g0647900                                     49.3    2e-04   
ref|WP_010997816.1|  aldehyde dehydrogenase                           48.9    3e-04   
emb|CCA36974.1|  hypothetical protein PP7435_Chr1-0836                49.3    3e-04   
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.9    3e-04   
ref|WP_035809846.1|  aldehyde dehydrogenase                           48.9    3e-04   
ref|WP_034706724.1|  aldehyde dehydrogenase                           48.9    3e-04   
ref|WP_022445454.1|  aldehyde dehydrogenase                           48.9    3e-04   
ref|WP_033167551.1|  aldehyde dehydrogenase                           48.9    3e-04   
gb|EMT24433.1|  Aldehyde dehydrogenase family 3 member F1             48.9    3e-04   
ref|WP_024620559.1|  aldehyde dehydrogenase [                         48.9    3e-04   
ref|WP_002979083.1|  aldehyde dehydrogenase                           48.9    3e-04   
ref|WP_043390385.1|  aldehyde dehydrogenase                           48.5    3e-04   
gb|KFA94133.1|  aldehyde dehydrogenase                                48.5    3e-04   
ref|WP_009326028.1|  aldehyde dehydrogenase                           48.5    3e-04   
ref|WP_026865879.1|  aldehyde dehydrogenase                           48.5    3e-04   
ref|XP_011006203.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.5    4e-04   
gb|EAZ31491.1|  hypothetical protein OsJ_15627                        48.5    4e-04   
ref|XP_011167292.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...  48.5    4e-04   
ref|XP_011006204.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.5    4e-04   
gb|AFW59014.1|  hypothetical protein ZEAMMB73_052021                  48.5    4e-04   
ref|XP_005529116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.5    4e-04   
ref|XP_009891468.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.1    4e-04   
ref|NP_001151141.1|  aldehyde dehydrogenase 3B1                       48.5    4e-04   
ref|WP_019849546.1|  aldehyde dehydrogenase                           48.5    4e-04   
ref|WP_014792747.1|  aldehyde dehydrogenase                           48.5    4e-04   
ref|XP_010034275.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.5    4e-04   
ref|XP_006647606.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.5    4e-04   
ref|XP_005426531.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.1    5e-04   
ref|XP_002448250.1|  hypothetical protein SORBIDRAFT_06g023975        47.8    5e-04   
gb|ELU17311.1|  hypothetical protein CAPTEDRAFT_149199                48.1    5e-04   
ref|XP_010031796.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  48.1    5e-04   
gb|ACR38486.1|  unknown                                               48.1    5e-04   
ref|WP_040994789.1|  aldehyde dehydrogenase                           48.1    5e-04   
gb|EEC73696.1|  hypothetical protein OsI_08280                        48.1    5e-04   
ref|WP_009544631.1|  MULTISPECIES: aldehyde dehydrogenase             48.1    5e-04   
gb|ACB52028.1|  aldehyde dehydrogenase                                48.1    5e-04   
ref|WP_005610487.1|  aldehyde dehydrogenase                           48.1    5e-04   
emb|CCO26936.1|  hypothetical protein BN14_00968                      48.1    5e-04   
gb|KCW51189.1|  hypothetical protein EUGRSUZ_J00776                   48.1    5e-04   
ref|XP_009095388.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.8    6e-04   
ref|WP_042267623.1|  aldehyde dehydrogenase                           47.8    6e-04   
ref|WP_039877801.1|  aldehyde dehydrogenase                           47.8    6e-04   
ref|XP_006684602.1|  aldehyde dehydrogenase                           48.1    6e-04   
ref|XP_009081631.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.0    6e-04   
ref|WP_022223713.1|  aldehyde dehydrogenase                           47.8    6e-04   
ref|WP_027701845.1|  aldehyde dehydrogenase [                         47.8    6e-04   
ref|WP_006456928.1|  aldehyde dehydrogenase                           47.0    6e-04   
ref|WP_032120616.1|  aldehyde dehydrogenase                           47.8    6e-04   
ref|WP_017711233.1|  hypothetical protein                             47.8    7e-04   
ref|WP_006956119.1|  aldehyde dehydrogenase                           47.8    7e-04   
ref|WP_041466826.1|  aldehyde dehydrogenase                           47.8    7e-04   
ref|WP_028537487.1|  aldehyde dehydrogenase                           47.8    7e-04   
gb|AAF31415.1|AF201892_1  aldehyde dehydrogenase                      44.7    7e-04   
ref|WP_036625831.1|  aldehyde dehydrogenase                           47.8    7e-04   
gb|KCW87152.1|  hypothetical protein EUGRSUZ_B03680                   47.8    7e-04   
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.8    7e-04   
ref|NP_001053442.1|  Os04g0540600                                     47.8    7e-04   
ref|XP_001523629.1|  conserved hypothetical protein                   47.8    7e-04   
gb|ABB29005.1|  aldehyde dehydrogenase                                47.8    7e-04   
ref|XP_001770374.1|  variable substrate                               47.8    7e-04   
ref|WP_036644529.1|  aldehyde dehydrogenase                           47.8    7e-04   
gb|EOS54615.1|  hypothetical protein C812_03390                       47.8    7e-04   
gb|EES74089.1|  aldehyde dehydrogenase (NAD) family protein           47.8    8e-04   
ref|WP_044356636.1|  aldehyde dehydrogenase                           46.2    8e-04   
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.8    8e-04   
ref|WP_027377443.1|  aldehyde dehydrogenase                           47.4    8e-04   
gb|KJB85852.1|  aldehyde dehydrogenase                                46.2    8e-04   
gb|EPS59682.1|  aldehyde dehydrogenase                                47.4    8e-04   
ref|XP_010045013.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    8e-04   
ref|XP_009411491.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    8e-04   
ref|WP_042192713.1|  aldehyde dehydrogenase                           47.4    9e-04   
ref|WP_006011635.1|  aldehyde dehydrogenase                           46.2    9e-04   
ref|XP_010045016.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    9e-04   
ref|WP_038470963.1|  aldehyde dehydrogenase                           47.4    9e-04   
ref|WP_044480861.1|  aldehyde dehydrogenase                           47.4    0.001   
ref|WP_038597756.1|  aldehyde dehydrogenase                           47.4    0.001   
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...  47.4    0.001   
ref|WP_016522165.1|  hypothetical protein                             47.4    0.001   
ref|WP_028596714.1|  aldehyde dehydrogenase                           47.4    0.001   
ref|WP_041235482.1|  aldehyde dehydrogenase                           47.4    0.001   
ref|WP_015157396.1|  aldehyde dehydrogenase                           47.4    0.001   
ref|XP_005243459.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    0.001   
ref|WP_021255569.1|  aldehyde dehydrogenase                           45.8    0.001   
emb|CDO95924.1|  unnamed protein product                              47.4    0.001   
ref|XP_005438433.1|  PREDICTED: aldehyde dehydrogenase family 3 m...  47.4    0.001   
ref|XP_001642608.1|  hypothetical protein Kpol_297p11                 47.4    0.001   



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score = 85.5 bits (210),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+A  T P GGVGESG GSYHG+FSFEAFSH  AV +RSFG D  ARYPP
Sbjct  391  GGLLINDTTLHLATSTLPFGGVGESGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K   L+AL++ N++ +IRA
Sbjct  451  YTPEKVRFLKALLNGNILGLIRA  473


 Score = 28.5 bits (62),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   E+E V N SAGG
Sbjct  370  AAYLFTGNKKLEEEFVRNISAGG  392



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score = 84.0 bits (206),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+A  T P GGVGESG GSYHG+FSFEAFSH  AV +RSFG D  ARYPP
Sbjct  391  GGLLINDTTLHIATSTLPFGGVGESGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K   L+AL++ +++ +IRA
Sbjct  451  YTPEKVRFLKALLNGDILGLIRA  473


 Score = 28.1 bits (61),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      E+E V N SAGG
Sbjct  370  AAYLFTGDKKLEEEFVRNISAGG  392



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score = 80.1 bits (196),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT L VA+ T P GGVGESG GS HGKFSF+ FSH  AV +RSF  D  ARYPP
Sbjct  388  GGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSFDTFSHKKAVLRRSFAGDVPARYPP  447

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  KA  L+AL++ ++I +IRA
Sbjct  448  YTAGKARFLKALLNGDIIGLIRA  470


 Score = 30.4 bits (67),  Expect(2) = 6e-16, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF S+   E+E V N SAGG
Sbjct  367  AAYLFTSNKKLEEEFVMNISAGG  389



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score = 79.0 bits (193),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT L VA+ T P GGVGESG GS HGKFSF++FSH  AV +RSF  D  ARYPP
Sbjct  388  GGLLINDTTLQVALSTLPFGGVGESGMGSCHGKFSFDSFSHKKAVLRRSFAGDVPARYPP  447

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  KA  L+AL++ +++ +IRA
Sbjct  448  YTTGKARFLKALLNGDILGLIRA  470


 Score = 30.4 bits (67),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF S+   E+E V N SAGG
Sbjct  367  AAYLFTSNKKLEEEFVMNISAGG  389



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +IND+ALH+AVHT P GGV ESG GSYHGKFSF+ FSH  AV  RSF  D  ARYPP
Sbjct  396  GGLVINDSALHLAVHTLPFGGVAESGMGSYHGKFSFDVFSHKKAVLYRSFMGDAAARYPP  455

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+S +++ II+A
Sbjct  456  YTQGKLRLLKALLSGSILGIIKA  478



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++ALM    + IIRA
Sbjct  461  YTSTKTRLMKALMGGGFLAIIRA  483



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGLVINDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++ALM    + IIRA
Sbjct  461  YTSTKTRLMKALMGGGFLAIIRA  483



>gb|KJB59283.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=283

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R  +     G  ++NDTA+H+A+H+ P GGVGESG GSYHGKFSF+AFSH  AV  R F 
Sbjct  185  RKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFA  244

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D   RYPPYT  K  LL+AL+S +++ IIRA
Sbjct  245  GDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  276



>ref|XP_006370381.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66950.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
Length=99

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LHV V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  13   GGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDASVRYPP  72

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L+RA+M+  +  II A
Sbjct  73   YTPEKQKLIRAVMNGGIFDIILA  95



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/83 (61%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +IND A+H+A+HT P GGVGESGTGSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGVVINDIAMHLAIHTLPFGGVGESGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++A M+ N   I+RA
Sbjct  461  YTRGKLRLMKAFMTSNFWTILRA  483



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R  +     G  ++NDTA+H+A+H+ P GGVGESG GSYHGKFSF+AFSH  AV  R F 
Sbjct  395  RKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFA  454

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D   RYPPYT  K  LL+AL+S +++ IIRA
Sbjct  455  GDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  486



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score = 78.2 bits (191),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  439  GGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPP  498

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   ++ I+RA
Sbjct  499  YTATKMRLLKALVGGGILNIVRA  521


 Score = 27.3 bits (59),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAY+F ++ N +++ V N SAGG
Sbjct  418  AAYIFTNNKNLKEKFVMNVSAGG  440



>gb|KJB59281.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
 gb|KJB59282.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=402

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R  +     G  ++NDTA+H+A+H+ P GGVGESG GSYHGKFSF+AFSH  AV  R F 
Sbjct  304  RKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFA  363

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D   RYPPYT  K  LL+AL+S +++ IIRA
Sbjct  364  GDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  395



>gb|KDO80590.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=282

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  193  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  252

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  253  YTKGKLRLLKVLISGSLLGIIRA  275



>ref|XP_006370382.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 ref|XP_006370383.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66951.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66952.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
Length=126

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LHV V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  40   GGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDASVRYPP  99

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L+RA+M+  +  II A
Sbjct  100  YTPEKQKLIRAVMNGGIFDIILA  122



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R  +     G  ++NDTA+H+A+H+ P GGVGESG GSYHGKFSF+AFSH  AV  R F 
Sbjct  395  RKFVETVSAGGLVVNDTAVHLAIHSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFA  454

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D   RYPPYT  K  LL+AL+S +++ IIRA
Sbjct  455  GDAFLRYPPYTPGKLTLLQALLSGSIVGIIRA  486



>gb|KDO80588.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
 gb|KDO80589.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=321

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  232  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  291

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  292  YTKGKLRLLKVLISGSLLGIIRA  314



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score = 77.8 bits (190),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGVVINDTTMHLAVHTLPFGGVGESGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   ++ I+RA
Sbjct  461  YTATKMRLLKALVGGGILNIVRA  483


 Score = 26.9 bits (58),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAY+F ++ N +++ V N SAGG
Sbjct  380  AAYIFTNNKNLKEKFVMNVSAGG  402



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V T P GGVGESG G YHGKFSFEAFSH  AV  RSF  D   RYPP
Sbjct  460  GGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPP  519

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT KK  LL+ALMS ++  II
Sbjct  520  YTSKKLNLLKALMSGSIFRII  540



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V T P GGVGESG G YHGKFSFEAFSH  AV  RSF  D   RYPP
Sbjct  461  GGMLINDTILHLTVSTLPFGGVGESGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPP  520

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT KK  LL+ALMS ++  II
Sbjct  521  YTSKKLNLLKALMSGSIFRII  541



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+AV T P GGVGESG G+YHGKFSFEAFSH  AV  R F  D   RYPP
Sbjct  400  GGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPP  459

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+  +L+ IIRA
Sbjct  460  YTKGKLTLMKALVGGSLLGIIRA  482



>gb|AFK46379.1| unknown [Medicago truncatula]
Length=280

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +I+DT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  193  GGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDAFIRYPP  252

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++ALM    + IIRA
Sbjct  253  YTSTKTRLMKALMGGGFLAIIRA  275



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +IND+A+H+AVHT P GGV ESG G+YHGKFSFEAFSH  AV  RSF  D   RYPP
Sbjct  390  GGLVINDSAIHLAVHTLPFGGVEESGMGAYHGKFSFEAFSHKKAVLYRSFIGDASVRYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+  +++ I++A
Sbjct  450  YTHGKMKLLKALIGGSILGILQA  472



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +I+DT +H+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGLVIDDTTIHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++ALM    + IIRA
Sbjct  461  YTSTKTRLMKALMGGGFLAIIRA  483



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH+AVH+ P GGVGESG GSYHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  401  GGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIR  52
            YT  K  L++AL++ NL  I+R
Sbjct  461  YTLGKLRLMKALITGNLWTILR  482



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH+AVH+ P GGVGESG GSYHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  401  GGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIR  52
            YT  K  L++AL++ NL  I+R
Sbjct  461  YTLGKLRLMKALITGNLWTILR  482



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT LH+ V T P GGVGESG G+YHGKFSF+AF+H  AV  RSF  D  ARYPP
Sbjct  403  GGLLVNDTTLHLLVDTLPFGGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSARYPP  462

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL++  ++ IIRA
Sbjct  463  YTDTKQRLMKALVAGTVLGIIRA  485



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+AV T P GGVGESG G+YHGKFSFEAFSH  AV  R F  D   RYPP
Sbjct  397  GGLLINDTTLHLAVPTLPFGGVGESGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+  +L+ IIRA
Sbjct  457  YTKGKLTLMKALVGGSLLGIIRA  479



>gb|KDO80586.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=397

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  308  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  367

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  368  YTKGKLRLLKVLISGSLLGIIRA  390



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  404  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  464  YTKGKLRLLKVLISGSLLGIIRA  486



>gb|KDO80587.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=398

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  309  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  368

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  369  YTKGKLRLLKVLISGSLLGIIRA  391



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  398  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  458  YTKGKLRLLKVLISGSLLGIIRA  480



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+ V T P GGVGESG G+YHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  401  GGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+   ++ IIRA
Sbjct  461  YTDTKLRLMKALVGGRILGIIRA  483



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDTA+H+AVH+ P GGV ESG G+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  404  GGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L+S +L+ IIRA
Sbjct  464  YTKGKLRLLKVLISGSLLGIIRA  486



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+ V T P GGVGESG G+YHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  404  GGLLVNDTALHLVVDTLPFGGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+   ++ IIRA
Sbjct  464  YTDTKLRLMKALVGGRILGIIRA  486



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AV T P GGVGESG G+YHGKFSFEAFSH  AV  RSF  D   RYPP
Sbjct  410  GGVVVNDTTIHLAVVTLPFGGVGESGMGAYHGKFSFEAFSHKKAVVYRSFVADAAVRYPP  469

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+  +++ IIRA
Sbjct  470  YTKGKLSLLKALVGGSILGIIRA  492



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH+AVH+ P GGVGESG GSYHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  401  GGVVINDTTLHLAVHSVPFGGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIR  52
            YT  K  L++AL++ N+  I+R
Sbjct  461  YTLGKLRLMKALITGNVWTILR  482



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 50/79 (63%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  285  INDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPPYTXK  106
            IND A+H+A+HT P GGVGESGTGSYHGKFSF+AFSH  AV  RSF  D   RYPPYT  
Sbjct  405  INDIAMHLAIHTLPFGGVGESGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRG  464

Query  105  KAXLLRALMSXNLIFIIRA  49
            K  L++A M+ N   I+RA
Sbjct  465  KLRLMKAFMTSNFWNILRA  483



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+A HT P GGVG+SG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  402  GGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPP  461

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+AL+  +L+ IIRA
Sbjct  462  YTRRKLRLLQALLGGSLLSIIRA  484



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+A HT P GGVG+SG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  428  GGLVVNDTTVHLAEHTLPFGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPP  487

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+AL+  +L+ IIRA
Sbjct  488  YTRRKLRLLQALLGGSLLSIIRA  510



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH+A  + P GGVGESG GSYHGKFSF+AFSH  AV KR F  D   RYPP
Sbjct  390  GGMVINDTTLHLAEASLPFGGVGESGMGSYHGKFSFDAFSHKKAVLKRGFNGDVSVRYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++A++S N++ IIRA
Sbjct  450  YTNGKLNFVKAMLSGNILRIIRA  472



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 51/92 (55%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R V+     G  L+NDTALHV  H  P GGVGESG GSYHGKFSFEAFSH  AV  R F 
Sbjct  380  RQVVASVSAGGMLVNDTALHVTNHHLPFGGVGESGVGSYHGKFSFEAFSHKKAVLYRGFM  439

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D  ARYPPYT +K  ++R L+S + + ++ A
Sbjct  440  GDLMARYPPYTTRKQKIVRCLLSGDFLGLLYA  471



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score = 75.5 bits (184),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ VHT P GGVG+SG G+YHGKFSF+AF+H  AV  R F  D   RYPP
Sbjct  403  GGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPP  462

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL++ ++  ++RA
Sbjct  463  YTDTKQKLMKALVAGDVTGVVRA  485


 Score = 26.2 bits (56),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +    +++ V N SAGG
Sbjct  382  AAYLFTNDNKFKEQFVKNVSAGG  404



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score = 75.5 bits (184),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ VHT P GGVG+SG G+YHGKFSF+AF+H  AV  R F  D   RYPP
Sbjct  408  GGLLINDTVLHLVVHTLPFGGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPP  467

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL++ ++  ++RA
Sbjct  468  YTDTKQKLMKALVAGDVTGVVRA  490


 Score = 26.2 bits (56),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +    +++ V N SAGG
Sbjct  387  AAYLFTNDNKFKEQFVKNVSAGG  409



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  LH+ V T P GGVG+SG G+YHGKFSF+AFSH   +  RSF  D   RYPP
Sbjct  461  GGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPP  520

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+AL+S N+I II A
Sbjct  521  YTPEKQRLLKALISFNIIGIILA  543



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  LH+ V T P GGVG+SG G+YHGKFSF+AFSH   +  RSF  D   RYPP
Sbjct  456  GGMLINDAVLHLTVPTLPFGGVGDSGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPP  515

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+AL+S N+I II A
Sbjct  516  YTPEKQRLLKALISFNIIGIILA  538



>gb|KHN21716.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=411

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT LH+ V T P GGVGESG G+YHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  324  GGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPP  383

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+    + IIRA
Sbjct  384  YTDTKLRLMKALIGGRFLGIIRA  406



>ref|XP_010444974.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=116

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  25   GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  84

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  85   YTQKKKMVLKALLSSNIFAAIWA  107



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AVH  P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  392  GGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPP  451

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+  +++ I+RA
Sbjct  452  YTNGKLRLMKALLGGSILGILRA  474



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AVH  P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+  +++ I+RA
Sbjct  461  YTNGKLRLMKALLGGSILGILRA  483



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT LH+ V T P GGVGESG G+YHGKFSF+AF+H  AV  RSF  D   RYPP
Sbjct  404  GGLLVNDTVLHLVVDTLPFGGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+    + IIRA
Sbjct  464  YTDTKLRLMKALIGGRFLGIIRA  486



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score = 74.3 bits (181),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AVHT P GGVGESGTG+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  406  GGLVVNDTTVHLAVHTLPFGGVGESGTGAYHGKFSFDAFSHKKAVLYRSFTGDAAIRYPP  465

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+   +  II A
Sbjct  466  YTKGKLRLMKALIGGGIWSIISA  488


 Score = 25.8 bits (55),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +    +Q+ VT  SAGG
Sbjct  385  AAYLFTNKKKLKQQFVTCVSAGG  407



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  395  GGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFLGDASMRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL++ NL+ +++A   L
Sbjct  455  YSRGKLRLLKALVNSNLMDLLKAIFGL  481



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AVH  P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  427  GGLVVNDTTVHLAVHALPFGGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPP  486

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  L++AL+  +++ I+RA
Sbjct  487  YTNGKLRLMKALLGGSILGILRA  509



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  397  GGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+ALM   ++ IIRA
Sbjct  457  YTKGKLRILKALMGGGILSIIRA  479



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  402  GGLLINDTTVHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPP  461

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+ALM   ++ IIRA
Sbjct  462  YTKGKLRILKALMGGGILSIIRA  484



>ref|XP_010437648.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=145

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  54   GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  113

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  114  YTQKKKMVLKALLSSNIFAAIWA  136



>ref|XP_006847205.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
 gb|ERN08786.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
Length=416

 Score = 73.2 bits (178),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT LH+ + + P GGVG+SG G+YHGKFSF+ FSH  AV +RSFG D  ARYPP
Sbjct  327  GGLLVNDTCLHLTISSLPFGGVGDSGIGAYHGKFSFDIFSHKKAVLRRSFGGDLSARYPP  386

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT +K   L++L++ +++ I+
Sbjct  387  YTPRKQQFLKSLLALDILGIL  407


 Score = 26.2 bits (56),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF S    E++ V + SAGG
Sbjct  306  AAYLFTSDKKLEEKFVKSISAGG  328



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  324  GGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPP  383

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   ++ IIRA
Sbjct  384  YTKGKLRLLKALIGGGILSIIRA  406



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  402  GGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPP  461

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   ++ IIRA
Sbjct  462  YTKGKLRLLKALIGGGILSIIRA  484



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  397  GGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+ALM   ++ IIRA
Sbjct  457  YTKGKLRILKALMGGGILSIIRA  479



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  402  GGLVINDTTVHLAVPSVPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPP  461

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+ALM   ++ IIRA
Sbjct  462  YTKGKLRILKALMGGGILSIIRA  484



>ref|XP_010444975.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=256

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  165  GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  224

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  225  YTQKKKMVLKALLSSNIFAAIWA  247



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 51/87 (59%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  309  IXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGA  130
            I   G  LINDT LH+A    P GGVGESG GSYHGKFSFEAFSH  AV  R FG +  A
Sbjct  401  IVSAGGMLINDTVLHLANPYLPFGGVGESGFGSYHGKFSFEAFSHKKAVLSRGFGGETSA  460

Query  129  RYPPYTXKKAXLLRALMSXNLIFIIRA  49
            RYPPYT +K  LLR L++ ++I +  A
Sbjct  461  RYPPYTPQKQKLLRQLLNGSIIALFLA  487



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LHV V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  667  GGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDTSVRYPP  726

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L+RA+M+  +  II A
Sbjct  727  YTPEKQKLVRAVMNGGIFDIILA  749



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  404  GGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   ++ IIRA
Sbjct  464  YTKGKLRLLKALIGGGILSIIRA  486



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  RSF  D   RYPP
Sbjct  363  GGMLINDTVLHVSITGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPP  422

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+A++S ++  II A
Sbjct  423  YTPEKQRLLKAVISGDIFSIILA  445



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+TALH+ + T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  397  GGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+AL+   ++ +IRA
Sbjct  457  YTKGKLRILKALLGGGILALIRA  479



>ref|XP_010437649.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=308

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  217  GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  276

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  277  YTQKKKMVLKALLSSNIFAAIWA  299



>ref|XP_009350139.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=450

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  R FG D   RYPP
Sbjct  362  GGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPP  421

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT +K  L +A+++ N++ II
Sbjct  422  YTPEKQRLFKAVINRNILTII  442



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  375  GGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPP  434

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   L+AL+   ++ +IRA
Sbjct  435  YTDGKLRFLKALLGGGILELIRA  457



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LHV V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  464  GGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPP  523

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +   L+RA+M+  ++ II A
Sbjct  524  YTPENKKLMRAVMNGGILDIILA  546



>gb|KGN54555.1| hypothetical protein Csa_4G361890 [Cucumis sativus]
Length=395

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+TALH+ + T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  308  GGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPP  367

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+AL+   ++ +IRA
Sbjct  368  YTKGKLRILKALLGGGILALIRA  390



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LHV V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  399  GGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPP  458

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +   L+RA+M+  +  II A
Sbjct  459  YTPENKKLMRAVMNGGIFDIILA  481



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  397  GGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   L+AL+   ++ +IRA
Sbjct  457  YTDGKLRFLKALLGGGILELIRA  479



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  RSF  D   RYPP
Sbjct  461  GGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPP  520

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+A++S ++  II A
Sbjct  521  YTPEKQRLLKAVISGDIFSIILA  543



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  397  GGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   L+AL+   ++ +IRA
Sbjct  457  YTDGKLRFLKALLGGGILELIRA  479



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+AV T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  397  GGVVINDTTIHLAVSTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   L+AL+   ++ +IRA
Sbjct  457  YTDGKLRFLKALLGGGILELIRA  479



>gb|EYU23873.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=394

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            GA  IN+TALH      P GGVGESG GSYHGKFSF+AFSH  AV +R FG +  ARYPP
Sbjct  308  GAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPP  367

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y   K  LL+AL+  N+I I+RA
Sbjct  368  YAPWKLQLLKALVKGNIIEILRA  390



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGV ESG G YHGKFSF++FSH  +V  RSF  D   RYPP
Sbjct  454  GGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSFDSFSHRKSVLYRSFDADSTIRYPP  513

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT +K  LL+AL+S N++ II
Sbjct  514  YTPQKEKLLKALISGNIVQII  534



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score = 70.1 bits (170),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  458  GGMTINDTVLHVTVKDMPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  517

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  518  YTPKKKMVLKALISSNIFAAILA  540


 Score = 26.9 bits (58),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +S   +++ V N SAGG
Sbjct  437  AAYLFTNSAELQKQFVQNVSAGG  459



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  401  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LLRAL   +++ IIRA
Sbjct  461  YTRGKLGLLRALFDGSILGIIRA  483



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score = 70.9 bits (172),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V + P GGVGESG GSYHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  460  GGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPP  519

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L S N++ I+ A
Sbjct  520  YTPGKLKLLKTLTSGNIVSILLA  542


 Score = 26.2 bits (56),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   +++ V N SAGG
Sbjct  439  AAYLFSENKQLQKDFVNNISAGG  461



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score = 70.9 bits (172),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V + P GGVGESG GSYHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  459  GGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPP  518

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L S N++ I+ A
Sbjct  519  YTPGKLKLLKTLTSGNIVSILLA  541


 Score = 26.2 bits (56),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   +++ V N SAGG
Sbjct  438  AAYLFSENKQLQKDFVNNISAGG  460



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+ FSH  AV  RSF  D   RYPP
Sbjct  401  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+  +++ IIRA
Sbjct  461  YTNGKLRLLKALLGGSILGIIRA  483



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score = 70.5 bits (171),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V + P GGVGESG GSYHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  452  GGMLINDTILHLTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPP  511

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+ L S N++ I+ A
Sbjct  512  YTPGKLKLLKTLTSGNIVSILLA  534


 Score = 26.2 bits (56),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   +++ V N SAGG
Sbjct  431  AAYLFSENKQLQKDFVNNISAGG  453



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  401  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LLRAL   +++ IIRA
Sbjct  461  YTRGKLGLLRALFDGSILGIIRA  483



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            GA  IN+TALH      P GGVGESG GSYHGKFSF+AFSH  AV +R FG +  ARYPP
Sbjct  390  GAIAINETALHFMEVGLPFGGVGESGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y   K  LL+AL+  N+I I+RA
Sbjct  450  YAPWKLQLLKALVKGNIIEILRA  472



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKFSFEAFSH  AV  R F  D   RYPP
Sbjct  410  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPP  469

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+A++   +  I+RA
Sbjct  470  YTNTKMRLLKAIIGGGIHGIVRA  492



>gb|KJB29203.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=457

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  368  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPP  427

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LLRAL   +++ IIRA
Sbjct  428  YTRGKLGLLRALFDGSILGIIRA  450



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score = 70.9 bits (172),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  443  GGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  502

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  503  YTPKKKMVLKALLSSNIFAAILA  525


 Score = 25.4 bits (54),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF ++   E++ V + SAGG
Sbjct  422  AAYLFTNNKELEKQFVQDVSAGG  444



>gb|EYU31773.1| hypothetical protein MIMGU_mgv1a018415mg [Erythranthe guttata]
Length=386

 Score = 69.3 bits (168),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH+     P GGVGESGTGSYHG+FSF+AFSH  AV +R F  D  ARYPP
Sbjct  300  GGMVINDTNLHLVEPNLPFGGVGESGTGSYHGRFSFDAFSHKKAVLQRGFTGDIAARYPP  359

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y   K   L++L S NLI ++RA
Sbjct  360  YANWKIDFLKSLFSGNLIGVLRA  382


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +    ++E +T+ SAGG
Sbjct  279  AAYLFSNDKKLKEEFITSVSAGG  301



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKFSFEAFSH  AV  R F  D   RYPP
Sbjct  528  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPP  587

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+A++   +  I+RA
Sbjct  588  YTNTKMRLLKAIIGGGIHGIVRA  610



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  406  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFSFDAFSHKKAVLYRSFIGDASVRYPP  465

Query  117  YTXKKAXLLRA  85
            YT  K  LL+A
Sbjct  466  YTTTKQRLLKA  476



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDTALH+A    P GGVGESG G+YHGKFSF++FSH  AV  R FG +  ARYPP
Sbjct  404  GGMLINDTALHLANPHLPFGGVGESGIGAYHGKFSFDSFSHKKAVLSRGFGGEAPARYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ ++I ++ A
Sbjct  464  YTPQKQKILRGLINGSIIALLLA  486



>ref|XP_004515933.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X4 [Cicer arietinum]
 ref|XP_004515934.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X5 [Cicer arietinum]
Length=214

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT+LH+ V+T P GGVG+SG G+YHGKFSF AF+H  AV  R F  D   RYPP
Sbjct  127  GGLLINDTSLHLVVYTLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPP  186

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K   ++AL++ ++  I+ A
Sbjct  187  YTDRKQKCMKALVAGDVPGIVCA  209



>ref|XP_002893982.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70241.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  405  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPP  464

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +A   L
Sbjct  465  YSRGKLRLLKALVDSNIFDIFKALLGL  491



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score = 70.5 bits (171),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  460  GGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  519

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  520  YTPKKKMVLKALLSSNMFAAILA  542


 Score = 25.0 bits (53),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF ++   E++ V + SAGG
Sbjct  439  AAYLFTNNKELEKQFVQDVSAGG  461



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score = 69.3 bits (168),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVGESG G+YHGKFSF+AFSH  AV  R FG +  ARYPP
Sbjct  404  GGILVNDVALHLANPHLPFGGVGESGIGAYHGKFSFDAFSHKKAVLSRGFGGEAPARYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ ++I ++ A
Sbjct  464  YTPQKQRILRGLINGSIIALVLA  486


 Score = 26.2 bits (56),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 13/23 (57%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      E + V N SAGG
Sbjct  383  AAYLFTKDRKIEDQFVKNVSAGG  405



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AV + P GGVGESG G+YHGKFSF+AFSH  AV  R F  D   RYPP
Sbjct  407  GGLVVNDTTIHLAVPSLPFGGVGESGMGAYHGKFSFDAFSHKKAVVYRGFFGDASIRYPP  466

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+AL+S  +  IIRA
Sbjct  467  YTKGKLRILKALISGGISSIIRA  489



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score = 70.5 bits (171),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  460  GGITINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  519

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  520  YTPKKKMVLKALLSSNIFAAILA  542


 Score = 25.0 bits (53),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF ++   E++ V + SAGG
Sbjct  439  AAYLFTNNKELEKQFVQDVSAGG  461



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score = 69.7 bits (169),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDTA+H+AV T P GGVGESGTG+YHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  404  GGVVVNDTAVHLAVPTLPFGGVGESGTGAYHGKFSFDTFSHKKAVLYRGFAGDAPVRYPP  463

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  LL+ L+   +  IIRA
Sbjct  464  YSSGKIRLLKVLLGGGIWDIIRA  486


 Score = 25.4 bits (54),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF ++   +Q+ V + SAGG
Sbjct  383  AAYLFTNNKKLKQQFVISVSAGG  405



>ref|XP_004515930.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=270

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT+LH+ V+T P GGVG+SG G+YHGKFSF AF+H  AV  R F  D   RYPP
Sbjct  183  GGLLINDTSLHLVVYTLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPP  242

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K   ++AL++ ++  I+ A
Sbjct  243  YTDRKQKCMKALVAGDVPGIVCA  265



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+AV T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RYPP
Sbjct  395  GGIVVNDIAVHLAVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL++ N++ I R    L
Sbjct  455  YSTGKLRLLKALVNSNILEIFRVILGL  481



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score = 69.3 bits (168),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H  V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  418  GGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPP  477

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LLRAL + N+  ++ A
Sbjct  478  YTAEKQKLLRALFNGNIFGLLLA  500


 Score = 25.8 bits (55),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 14/26 (54%), Gaps = 0/26 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXAY  284
            AAY F      ++E V N SAGG  +
Sbjct  397  AAYFFSDDEQMKKEFVQNISAGGIVF  422



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  R FG D   RYPP
Sbjct  472  GGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPP  531

Query  117  YTXKKAXLLRALMSXNLIFII  55
            YT +K  L +A+++ +++ II
Sbjct  532  YTPEKQRLFKAVINRDILTII  552



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  458  GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  517

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  518  YTQKKKMVLKALLSSNIFAAIWA  540



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score = 69.3 bits (168),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H  V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  454  GGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPP  513

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LLRAL + N+  ++ A
Sbjct  514  YTAEKQKLLRALFNGNIFGLLLA  536


 Score = 25.4 bits (54),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 14/26 (54%), Gaps = 0/26 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXAY  284
            AAY F      ++E V N SAGG  +
Sbjct  433  AAYFFSDDEQMKKEFVQNISAGGIVF  458



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  456  GGISINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  515

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  516  YTPKKKMVLKALLSSNIFAAILA  538



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score = 68.9 bits (167),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H  V + P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  454  GGIVFNDTIVHTTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPP  513

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LLRAL + N+  ++ A
Sbjct  514  YTAEKQKLLRALFNGNIFGLLLA  536


 Score = 25.4 bits (54),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 14/26 (54%), Gaps = 0/26 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXAY  284
            AAY F      ++E V N SAGG  +
Sbjct  433  AAYFFSDDEQMKKEFVQNISAGGIVF  458



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  397  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +    L
Sbjct  457  YSRGKLRLLKALVDSNIFDIFKVLLGL  483



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score = 68.2 bits (165),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+A    P GGVG+SG G YHGKF F+ FSH  AV  R FG +  ARYPP
Sbjct  387  GGMLVNDTALHLANPYLPFGGVGDSGMGCYHGKFGFDCFSHKKAVLIRGFGGEANARYPP  446

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  447  YTTEKQKILRGLINGSFIALILA  469


 Score = 25.8 bits (55),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   ++E V N  AGG
Sbjct  366  AAYLFTKNKKLQEEFVANVPAGG  388



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHVAV   P GGVGESG GSYHGKFSF+ FSH  +V  RS   D   RYPP
Sbjct  459  GGMLINDTVLHVAVAGLPFGGVGESGMGSYHGKFSFDGFSHKKSVMYRSLSGDSTLRYPP  518

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L +A +S N+  II A
Sbjct  519  YTPEKEKLFKAALSGNIFRIILA  541



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  462  GGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPP  521

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L RA+++ ++  II A
Sbjct  522  YTPEKQRLFRAVINGDIFTIILA  544



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LHV++   P GGVGESG GSYHGKFSF+ FSH  AV  R F  D   RYPP
Sbjct  472  GGMLINDTVLHVSISGLPFGGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPP  531

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  L RA+++ ++  II A
Sbjct  532  YTPEKQRLFRAVINGDIFTIILA  554



>ref|XP_004515932.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=262

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT+LH+ V+T P GGVG+SG G+YHGKFSF AF+H  AV  R F  D   RYPP
Sbjct  183  GGLLINDTSLHLVVYTLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPP  242

Query  117  YTXKKAXLLRALMSXNL  67
            YT +K   ++AL++ ++
Sbjct  243  YTDRKQKCMKALVAGDV  259



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKF+FEAFSH  AV  R F  D   RYPP
Sbjct  401  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPP  460

Query  117  YTXKKAXLLRA  85
            YT  K  LL+A
Sbjct  461  YTNTKMRLLKA  471



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG GSYHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  397  GGIVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +    L
Sbjct  457  YSRGKLRLLKALVDSNIFDIFKVLLGL  483



>ref|XP_004515931.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=266

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT+LH+ V+T P GGVG+SG G+YHGKFSF AF+H  AV  R F  D   RYPP
Sbjct  183  GGLLINDTSLHLVVYTLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPP  242

Query  117  YTXKKAXLLRALMSXNL  67
            YT +K   ++AL++ ++
Sbjct  243  YTDRKQKCMKALVAGDV  259



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  398  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +    L
Sbjct  458  YSRGKLRLLKALVDSNIFNIFKVLLGL  484



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  399  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPP  458

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +    L
Sbjct  459  YSRGKLRLLKALVDSNIFNIFKVLLGL  485



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND ALH+A H  P GGVGESG GSYHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  405  GGMLINDIALHLANHYLPFGGVGESGFGSYHGKFSFDAFSHKKAVLSRGFFGEARARYPP  464

Query  117  YTXKKAXLLRALMSXNLI  64
            YT +K  L+R L++ ++I
Sbjct  465  YTPRKQKLVRQLLNGSII  482



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  458  GGISINDTVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  517

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  518  YTQKKKMVLKALLSSNIFAAIWA  540



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score = 62.4 bits (150),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT +H+   + P GGVGESG GSYHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  476  GGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPP  535

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LRA++  ++I  I A
Sbjct  536  YTPGKLRILRAILDGSIIGAILA  558


 Score = 31.2 bits (69),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF SS   E+E V N SAGG
Sbjct  455  AAYLFTSSKKLEKEFVENISAGG  477



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score = 62.4 bits (150),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT +H+   + P GGVGESG GSYHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  475  GGMLINDTVVHLTNPSLPFGGVGESGIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPP  534

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LRA++  ++I  I A
Sbjct  535  YTPGKLRILRAILDGSIIGAILA  557


 Score = 31.2 bits (69),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF SS   E+E V N SAGG
Sbjct  454  AAYLFTSSKKLEKEFVENISAGG  476



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV V   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  457  GGIGINDTVLHVTVKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFAGDSDLRYPP  516

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  517  YTPKKKMVLKALLSSNIFAAILA  539



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKF+FEAFSH  AV  R F  D   RYPP
Sbjct  336  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPP  395

Query  117  YTXKKAXLLRA  85
            YT  K  LL+A
Sbjct  396  YTNTKMRLLKA  406



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  398  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  I +    L
Sbjct  458  YSRGKLRLLKALVDSNIFNIFKVLLGL  484



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V T P GGVG+SG G+YHGKFSF+AF+H  AV  R F  D   RYPP
Sbjct  401  GGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL++ ++  I+RA
Sbjct  461  YTDTKQKCMKALVAGDVPGIVRA  483



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+ V T P GGVG+SG G+YHGKFSF+AF+H  AV  R F  D   RYPP
Sbjct  406  GGLLINDTVLHLVVCTLPFGGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPP  465

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL++ ++  I+RA
Sbjct  466  YTDTKQKCMKALVAGDVPGIVRA  488



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IND  LHV V   P GGVGESG G YHGKFSFE FSH   V  RSF  D   RYPP
Sbjct  354  GGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPP  413

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L AL+S NL   I A
Sbjct  414  YTPKKQKVLTALLSGNLFDAILA  436



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  397  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  + +    L
Sbjct  457  YSRGKLRLLKALVDSNIFDLFKVLLGL  483



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  397  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPP  456

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  + +    L
Sbjct  457  YSRGKLRLLKALVDSNIFDLFKVLLGL  483



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT LH+AVHT P GGVGESG G+YHGKF+FEAFSH  AV  R F  D   RYPP
Sbjct  410  GGLVVNDTTLHLAVHTLPFGGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPP  469

Query  117  YTXKKAXLLRA  85
            YT  K  LL+A
Sbjct  470  YTNTKMRLLKA  480



>gb|AFK40162.1| unknown [Lotus japonicus]
Length=141

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H+AVHT P GGVGESG G+YHGKF F+AFSH  +V  R F  D   RYPP
Sbjct  54   GGLVVNDTTVHLAVHTLPFGGVGESGLGAYHGKFPFDAFSHKKSVLYRGFFGDAAIRYPP  113

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+   +I +IRA
Sbjct  114  YTNTKMRLLKALIGGGIIGVIRA  136



>ref|NP_001077676.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32027.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=421

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+AFSH  AV  RS   D   RYPP
Sbjct  334  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPP  393

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  + +    L
Sbjct  394  YSRGKLRLLKALVDSNIFDLFKVLLGL  420



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IND  LHV V   P GGVGESG G YHGKFSFE FSH   V  RSF  D   RYPP
Sbjct  456  GGMGINDAVLHVTVDGLPFGGVGESGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPP  515

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L AL+S NL   I A
Sbjct  516  YTPKKQKVLTALLSGNLFDAILA  538



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            R V+     G  ++NDTALH+  H  P GGVGESG G+YHGKFSFE FSH  AV  R F 
Sbjct  459  RQVVASISAGGMVVNDTALHLVNHHLPFGGVGESGMGAYHGKFSFENFSHRKAVLYRGFM  518

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D  ARYPPYT +K  ++R L++ + + ++ A
Sbjct  519  GDLMARYPPYTRRKQKIVRCLLNGDFLGLLYA  550



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT L V     P GGVGESG GSYHGKFSF+AFSH  AV  R FG D   RYPP
Sbjct  395  GGMVINDTILQVTNPRLPFGGVGESGMGSYHGKFSFDAFSHKKAVLSRGFGGDVSMRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LR L++ N+I +  A
Sbjct  455  YTAHKQKILRGLITGNIIAVFLA  477



>gb|KHG17901.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
 gb|KHG21723.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
Length=366

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  277  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  336

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S  L+ I+ A
Sbjct  337  YTPGKKKQIKALLSGKLLNIMLA  359



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score = 67.8 bits (164),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+ ALH    T P GGVGESG GSYHGKFSF+AFSH  +V +R F  D  ARYPP
Sbjct  390  GGIAINEIALHALEPTLPFGGVGESGMGSYHGKFSFDAFSHKKSVLQRGFSGDPAARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   L+A++S ++I I+RA
Sbjct  450  YTPGKLKFLQAMLSGSIIRILRA  472


 Score = 25.0 bits (53),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXA  287
            AAYLF +    ++E + + SAGG A
Sbjct  369  AAYLFTNDKKLKEEFIRSVSAGGIA  393



>ref|XP_004514084.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=138

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -2

Query  300  LGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYP  121
            +G  LIND ALH+ V+  P GGVG+SG G+YHGKFSF AF+H  AV  R F  D   RYP
Sbjct  50   VGGLLINDIALHLVVYNLPFGGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYP  109

Query  120  PYTXKKAXLLRALMSXNLIFIIRA  49
            PYT +K   ++AL++ ++  I+ A
Sbjct  110  PYTDRKQKCMKALVAGDVPGIVCA  133



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGV ESG G YHGKF+F++FSH  +V  +SF  D   RYPP
Sbjct  446  GGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPP  505

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LLRA++  N+  II A
Sbjct  506  YTPQKEKLLRAILGGNIFDIILA  528



>gb|ABR25386.1| aldehyde dehydrogenase dimeric nadp preferring [Oryza sativa 
Indica Group]
Length=115

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SG GSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  24   GGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEATARYPP  83

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ +   +I A
Sbjct  84   YTIEKQKILRGLINGSFFALILA  106



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  399  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  458

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S  L+ I+ A
Sbjct  459  YTPGKKKQIKALLSGKLLNIMLA  481



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGV ESG G YHGKF+F++FSH  +V  +SF  D   RYPP
Sbjct  454  GGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPP  513

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LLRA++  N+  II A
Sbjct  514  YTPQKEKLLRAILGGNIFDIILA  536



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  354  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  413

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S  L+ I+ A
Sbjct  414  YTPGKKKQIKALLSGKLLNIMLA  436



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IND ALH A    P GGVGESG G+YHGKFSF+ FSH  AV +R FG D  ARYPP
Sbjct  390  GGITINDVALHFAEAGLPFGGVGESGMGAYHGKFSFDTFSHKKAVLQRGFGGDVAARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y   K   L+AL+  +++ ++RA
Sbjct  450  YAPWKLQFLKALLRGSILGVLRA  472



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  309  IXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGA  130
            I   G  ++ND A+H+A+HT P GGVGESG GSYHGKFSF+AFSH  AV  RS   D   
Sbjct  391  IVSAGGVVVNDIAVHLALHTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSLLGDASM  450

Query  129  RYPPYTXKKAXLLRALMSXN  70
            RYPPY+  K  LL+AL++ N
Sbjct  451  RYPPYSRWKLRLLKALVNRN  470



>ref|XP_006662790.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SG GSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  308  GGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPP  367

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  368  YTTEKQKILRGLINGSFIALILA  390



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score = 64.3 bits (155),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SGTGSYHGKF+F+ FSH  AV  R FG +  ARYPP
Sbjct  390  GGMLVNDVALHLANPHLPFGGVGDSGTGSYHGKFTFDCFSHKKAVLVRGFGGEANARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L+  +   +I A
Sbjct  450  YTPEKQRILRGLIKGSFFALILA  472


 Score = 27.3 bits (59),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   +QE + N S+GG
Sbjct  369  AAYLFSRNKKLQQEFIANVSSGG  391



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGV ESG G YHGKFSF++FSH   V  RSF  D   RYPP
Sbjct  479  GGMLINDAVIHVATRGLPFGGVEESGMGCYHGKFSFDSFSHRKPVLYRSFDGDSSIRYPP  538

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  LL+A+++ N++ I  A
Sbjct  539  YTPQKEKLLKAIITGNIVQIFLA  561



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score = 63.5 bits (153),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+     P GGVG+SGTGSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  359  GGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPP  418

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L+  +   +I A
Sbjct  419  YTAEKQRILRGLIKGSFFALILA  441


 Score = 28.1 bits (61),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      +Q+ V+N SAGG
Sbjct  338  AAYLFTKDKKLQQDFVSNVSAGG  360



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT LHV     P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  455  GGISINDTVLHVTQKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPP  514

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  515  YTTKKKMVLKALISSNIFAAILA  537



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score = 63.5 bits (153),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+     P GGVG+SGTGSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  426  GGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPP  485

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L+  +   +I A
Sbjct  486  YTAEKQRILRGLIKGSFFALILA  508


 Score = 28.1 bits (61),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      +Q+ V+N SAGG
Sbjct  405  AAYLFTKDKKLQQDFVSNVSAGG  427



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score = 63.2 bits (152),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+     P GGVG+SGTGSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  398  GGMLVNDVALHLTNPHLPFGGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L+  +   +I A
Sbjct  458  YTAEKQRILRGLIKGSFFALILA  480


 Score = 28.1 bits (61),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      +Q+ V+N SAGG
Sbjct  377  AAYLFTKDKKLQQDFVSNVSAGG  399



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  455  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  514

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S  L+ I+ A
Sbjct  515  YTPGKKKQIKALLSGKLLNIMLA  537



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  458  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  517

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S  L+ I+ A
Sbjct  518  YTPGKKKQIKALLSGKLLNIMLA  540



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+++ T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RYPP
Sbjct  395  GGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL++ NL+ + +    L
Sbjct  455  YSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+ T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RYPP
Sbjct  396  GGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFFGDSAIRYPP  455

Query  117  YTXKKAXLLRALMSXNLI  64
            Y+  K  LL+AL++ N++
Sbjct  456  YSRGKLRLLKALVNSNIV  473



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+++ T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RYPP
Sbjct  395  GGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL++ NL+ + +    L
Sbjct  455  YSRGKLRLLKALVNSNLVEVFKVLLGL  481



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+++ T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RYPP
Sbjct  395  GGIVVNDIAVHLSLPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL++ NL+ + +    L
Sbjct  455  YSRGKLRLLKALVNSNLVEVFKVLLGL  481



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SG GSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  390  GGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  450  YTTEKQKILRGLINGSFIALILA  472



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + V+     G  ++NDT LH    T P GGVG SG G+YHGKFSF+AFSH  AV  R F 
Sbjct  382  KKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSFDAFSHRKAVLYRGFW  441

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D  +RYPPYT  K   +R  +  N +  I+A
Sbjct  442  ADMASRYPPYTIAKQNFVRNFLQGNYLEAIKA  473



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score = 64.7 bits (156),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SG GSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  403  GGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEATARYPP  462

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ +   +I A
Sbjct  463  YTIEKQKILRGLINGSFFALILA  485


 Score = 26.2 bits (56),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      ++E V+N  AGG
Sbjct  382  AAYLFTKDKKLQEEFVSNVPAGG  404



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score = 64.3 bits (155),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+A    P GGVG+SG GSYHGKFSF+ F+H  AV  R FG +  ARYPP
Sbjct  391  GGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEATARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ +   +I A
Sbjct  451  YTIEKQKILRGLINGSFFALILA  473


 Score = 26.2 bits (56),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      ++E V+N  AGG
Sbjct  370  AAYLFTKDKKLQEEFVSNVPAGG  392



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score = 61.6 bits (148),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LINDT LH+   + P GGVGESG GSYHGKFSF+AFSH  A+  R F  D   RYPP
Sbjct  400  GGMLINDTVLHLTNPSLPFGGVGESGFGSYHGKFSFDAFSHKKAILYRPFIGDVTVRYPP  459

Query  117  YTXKKAXLLRALM  79
            YT +K  LL AL+
Sbjct  460  YTPRKIRLLDALL  472


 Score = 28.9 bits (63),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF SS   E+E V   SAGG
Sbjct  379  AAYLFTSSKKLEKEFVEKISAGG  401



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   +NDT LHV V   P GGVGESG G+YHGKFS++ FSH   V  RSF  D   RYPP
Sbjct  470  GGIGVNDTILHVTVKDLPFGGVGESGIGAYHGKFSYDTFSHKKGVLYRSFVGDSDIRYPP  529

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK  +L+AL+S N+   I A
Sbjct  530  YTTKKKTVLKALLSSNIFRAILA  552



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score = 62.8 bits (151),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L + V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  +   RYPP
Sbjct  453  GGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPP  512

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S ++  I+ A
Sbjct  513  YTPGKQKQMKALISGDVFNIMLA  535


 Score = 27.3 bits (59),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXA  287
            AAYLF      E++ V N SAGG A
Sbjct  432  AAYLFSDDEQIERKFVQNVSAGGIA  456



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score = 62.8 bits (151),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L + V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  +   RYPP
Sbjct  398  GGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S ++  I+ A
Sbjct  458  YTPGKQKQMKALISGDVFNIMLA  480


 Score = 27.3 bits (59),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXA  287
            AAYLF      E++ V N SAGG A
Sbjct  377  AAYLFSDDEQIERKFVQNVSAGGIA  401



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score = 62.8 bits (151),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L + V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  +   RYPP
Sbjct  458  GGIAINDTILQLTVPTLPFGGVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPP  517

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K   ++AL+S ++  I+ A
Sbjct  518  YTPGKQKQMKALISGDVFNIMLA  540


 Score = 27.3 bits (59),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXA  287
            AAYLF      E++ V N SAGG A
Sbjct  437  AAYLFSDDEQIERKFVQNVSAGGIA  461



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTA+H+     P GGVGESG G+YHG+FSFEAFSH  AV  R F  +  ARYPP
Sbjct  374  GGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPP  433

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +LR ++  NL  +I+A
Sbjct  434  YSPAKLKILRGVLKGNLGAMIKA  456



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTA+H+     P GGVGESG G+YHG+FSFEAFSH  AV  R F  +  ARYPP
Sbjct  374  GGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPP  433

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +LR ++  NL  +I+A
Sbjct  434  YSPAKLKILRGVLKGNLGAMIKA  456



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGVGESG G YHGKFSF++FSH  +V  ++F  D   RYPP
Sbjct  454  GGMLINDAVIHVATRGLPFGGVGESGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPP  513

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LRA+   N+  II A
Sbjct  514  YTPEKENILRAIFGGNIFQIILA  536



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  +HVA    P GGVGESG G YHGKFSF++FSH  +V  ++F  D   RYPP
Sbjct  461  GGMLINDAVIHVATRGLPFGGVGESGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPP  520

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LRA+   N+  II A
Sbjct  521  YTPEKENILRAIFGGNIFQIILA  543



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTA+H+     P GGVGESG G+YHG FSFEAFSH  AV  R F  +  ARYPP
Sbjct  389  GGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGSFSFEAFSHKKAVLVRGFACEAAARYPP  448

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +LR ++  NL  +I+A
Sbjct  449  YSMAKLKILRGVLKGNLGAMIQA  471



>gb|AFW65463.1| hypothetical protein ZEAMMB73_893012 [Zea mays]
Length=456

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+     P GGVG+SG G YHGKF F+ FSH   V  R FG +  ARYPP
Sbjct  365  GGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPP  424

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  425  YTTEKQKILRGLINGSFIALILA  447



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score = 62.4 bits (150),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IND ALH      P GGVGESG GSYHGKFSF+AFSH  +V KRSFG +  ARYPP
Sbjct  391  GGITINDIALHFLEPRLPFGGVGESGMGSYHGKFSFDAFSHKKSVLKRSFGGEVAARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y   K   + A++  ++  +++A
Sbjct  451  YAPWKLHFMEAILQGDIFGLLKA  473


 Score = 27.3 bits (59),  Expect(2) = 7e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF +     +E V+N SAGG
Sbjct  370  AAYLFTNDKKRTEEFVSNVSAGG  392



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTA+H+     P GGVGESG G+YHG+FSFEAFSH  AV  R F  +  ARYPP
Sbjct  394  GGMLVNDTAVHLTNQYLPFGGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPP  453

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +LR ++  NL  +I+A
Sbjct  454  YSPAKLKILRGVLKGNLGAMIKA  476



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+HT P GGVGESG G+YHGKFSF+A SH  AV  RS   D   RYPP
Sbjct  393  GGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDASSHKKAVLYRSLFGDSAVRYPP  452

Query  117  YTXKKAXLLRALMSXNLIFIIRAXXXL  37
            Y+  K  LL+AL+  N+  + +    L
Sbjct  453  YSRGKLRLLKALVDSNIFDLFKVLLGL  479



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT LH+A    P GGVG+SG G YHGKF F+ FSH   V  R FG +  ARYPP
Sbjct  387  GGMLVNDTVLHLANPYMPFGGVGDSGMGCYHGKFGFDCFSHKKGVLVRGFGGEANARYPP  446

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  447  YTTEKQKILRGLINGSFIALILA  469



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +IND+ LH    T P GGVG+SG G+YHGKFSF+AF+H  AV  R F  D   RYPP
Sbjct  401  GGLVINDSVLHFVACTLPFGGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT KK   ++AL++ ++  ++RA
Sbjct  461  YTDKKQKCMKALVAGDVPGLVRA  483



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+TALH+ + T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  397  GGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPP  456

Query  117  YTXKKAXLLRA  85
            YT  K  +L+A
Sbjct  457  YTKGKLRILKA  467



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + V+     G  ++NDT LH    T P GGVG SG G+YHGKFSF+AFSH  AV  R F 
Sbjct  382  KKVVSETSAGGMVVNDTVLHFVTETMPFGGVGHSGMGAYHGKFSFDAFSHRKAVLYRGFW  441

Query  144  XDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
             D  +RYPPYT  K   ++  +  N +  I+A
Sbjct  442  GDMASRYPPYTIAKQTFVKNFLQGNYLEAIKA  473



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+     P GGVG+SG G YHGKF F+ FSH   V  R FG +  ARYPP
Sbjct  387  GGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPP  446

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  447  YTTEKQKILRGLINGSFIALILA  469



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 43/83 (52%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDTALH+     P GGVG+SG G YHGKF F+ FSH   V  R FG +  ARYPP
Sbjct  387  GGMLVNDTALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPP  446

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  447  YTTEKQKILRGLINGSFIALILA  469



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT L V V T P GGVGESG GSYHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  455  GGMAINDTILQVTVPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPP  514

Query  117  YTXKKAXLLRALMS  76
            YT  K   ++AL+S
Sbjct  515  YTPGKKKQIKALLS  528



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+TALH+ + T P GGVGESG G+YHGKFSF+AFSH  AV  RSF  D   RYPP
Sbjct  401  GGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPP  460

Query  117  YTXKKAXLLRA  85
            YT  K  +L+A
Sbjct  461  YTKGKLRILKA  471



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND A+H+A+ T P GGVGESG GSYHGKFSF+AFSH  AV  +SF  D   RY P
Sbjct  396  GGIVVNDIAVHLALPTLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYKSFLGDSTVRYAP  455

Query  117  YTXKKAXLLRALMSXNLIFIIR  52
            Y+  K  LL+AL++ NL+ + +
Sbjct  456  YSRGKLRLLKALVNSNLLEVFK  477



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score = 62.0 bits (149),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  459  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  518

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  519  YTPEKKRVLKALLSSDIFGAILA  541


 Score = 24.6 bits (52),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 14/23 (61%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF  +   + + V N SAGG
Sbjct  438  AAYLFTDNKELQNQFVQNVSAGG  460



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+ND ALH+     P GGVG+SG G YHGKF F+ FSH   V  R FG +  ARYPP
Sbjct  390  GGMLVNDIALHLTNPYMPFGGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPP  449

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +LR L++ + I +I A
Sbjct  450  YTTEKQKILRGLINGSFIALILA  472



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  464  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  523

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  524  YTPEKKRVLKALLSSDIFGAILA  546



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  464  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  523

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  524  YTPEKKRVLKALLSSDIFGAILA  546



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  466  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  525

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  526  YTPEKKRVLKALLSSDIFGAILA  548



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  466  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  525

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  526  YTPEKKRVLKALLSSDIFGAILA  548



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND  LH    T P GGVGESG GSYHGKFSF+AFSH  A+  R F  D  ARYPP
Sbjct  391  GGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSFDAFSHHKAILTRPFWMDIMARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFII  55
            Y+  K   +R L+  + + +I
Sbjct  451  YSAHKKTFIRCLLEADFVGVI  471



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND  LH    T P GGVGESG GSYHGKFSF+AFSH  A+  R F  D  ARYPP
Sbjct  391  GGMVVNDCCLHFLTTTLPFGGVGESGMGSYHGKFSFDAFSHHKAILTRPFWMDIMARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFII  55
            Y+  K   +R L+  + + +I
Sbjct  451  YSAHKKTFIRCLLEADFVGVI  471



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   IN+T LHV +   P GGVGESG G+YHGKFS+E FSH   V  RSF  D   RYPP
Sbjct  465  GGMGINETVLHVTLKDLPFGGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPP  524

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT +K  +L+AL+S ++   I A
Sbjct  525  YTPEKKRVLKALLSSDIFGAILA  547



>gb|EPS67421.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=250

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            GA  IN+T LH    + P GGVGESG G+YHGKFSFEAFSH  AV +R    D  ARYPP
Sbjct  165  GAVCINETNLHFMEPSLPFGGVGESGMGAYHGKFSFEAFSHRKAVLERVLFGDVPARYPP  224

Query  117  YTXKKAXLLRALMSXNLI  64
            Y+ +K  LL+ L+   L+
Sbjct  225  YSRRKMDLLKNLLQGRLV  242



>emb|CDY14975.1| BnaA10g08810D [Brassica napus]
Length=98

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+ ++NDTA+H  + T P GGVGESG G     +SF+AFSH  +V  +SF  D   RYPP
Sbjct  15   GSIVVNDTAVHFTLPTLPFGGVGESGIG----SYSFDAFSHKKSVLFKSFLGDSAIRYPP  70

Query  117  YTXKKAXLLRALMSXNLI  64
            Y+ K   LL+AL++ NL+
Sbjct  71   YSRKMLRLLKALVNSNLV  88



>gb|AAF31414.1|AF201891_1 aldehyde dehydrogenase [Gossypium hirsutum]
Length=75

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  201  KFSFEAFSHXXAVXKRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
            KFSF+ FSH  AV  RSF  D   RYPPYT  K  LL+AL+  +++ IIRA
Sbjct  18   KFSFDTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIIRA  68



>gb|AAF31413.1|AF201890_1 aldehyde dehydrogenase [Gossypium herbaceum]
Length=76

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  201  KFSFEAFSHXXAVXKRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
            KFSF+ FSH  AV  RSF  D   RYPPYT  K  LL+AL+  +++ IIRA
Sbjct  19   KFSFDTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIIRA  69



>ref|XP_010673629.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            GA L NDT +  A  T P GGVGESG G YHGKF+F+AFSH   + KR    D   R+PP
Sbjct  387  GAVLFNDTIVQYAADTIPFGGVGESGFGRYHGKFTFDAFSHEKPIVKRDLFPDFWFRFPP  446

Query  117  YTXKKAXLLRALMSXNLIFII  55
            +T KK  LLRA  S N   I+
Sbjct  447  WTSKKLELLRAAFSYNYFLIV  467



>gb|EMT24757.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=334

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L NDT++H+     P GGVGESGTG+YHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  244  GGMLFNDTSIHLTNPYLPFGGVGESGTGAYHGKFSFDAFSHRKAVMNRGFAGEARARYPP  303

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +L+ ++   L  +I+A
Sbjct  304  YSAPKLKILKGVLEGKLGDMIQA  326



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH A  T P GGVGESG GSYHGKFS+EAFSH  +V  R F  D  ARYPP
Sbjct  429  GGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPP  488

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+ +K  LL+AL+S +++ +I A
Sbjct  489  YSDRKLKLLKALLSGSVVGVILA  511



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH A  T P GGVGESG GSYHGKFS+EAFSH  +V  R F  D  ARYPP
Sbjct  401  GGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+ +K  LL+AL+S +++ +I A
Sbjct  461  YSDRKLKLLKALLSGSVVGVILA  483



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT LH A  T P GGVGESG GSYHGKFS+EAFSH  +V  R F  D  ARYPP
Sbjct  463  GGLVINDTVLHFAEKTLPFGGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPP  522

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+ +K  LL+AL+S +++ +I A
Sbjct  523  YSDRKLKLLKALLSGSVVGVILA  545



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+ FSH  AV  RSF  D   RYPP
Sbjct  401  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPP  460

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+  +++ IIRA
Sbjct  461  YTDGKLGLLKALLGGSILGIIRA  483



>gb|AAF31416.1|AF201893_1 aldehyde dehydrogenase [Gossypium hirsutum]
Length=76

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  201  KFSFEAFSHXXAVXKRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
            KFSF+ FSH  AV  RSF  D   RYPPYT  K  LL+AL+  +++ I+RA
Sbjct  19   KFSFDTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILGIMRA  69



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  +INDT +H+A  T P GGVG+SG G+YHGKFSF+ FSH  AV  RSF  D   RYPP
Sbjct  353  GGLVINDTTVHLAEPTLPFGGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPP  412

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  LL+AL+  +++ IIRA
Sbjct  413  YTDGKLGLLKALLGGSILGIIRA  435



>gb|EMS67813.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=334

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L NDT++H+     P GGVGESGTGSYHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  244  GGMLFNDTSIHLTNPYLPFGGVGESGTGSYHGKFSFDAFSHRKAVMNRGFAGEARARYPP  303

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  +  +L+ ++   L  +I+A
Sbjct  304  YSAPRLKILKGVLEGKLGDMIQA  326



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score = 56.6 bits (135),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H      P GGVGESG GSYHGKFSF+AFSH  AV  R+   D  ARYPP
Sbjct  412  GGMVVNDTVMHFVNPGLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYRTSLGDFPARYPP  471

Query  117  YTXKKAXLLRALMSXNLI  64
            +T KK   LR ++  + I
Sbjct  472  FTTKKQNFLRCVLDGDYI  489


 Score = 25.0 bits (53),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAY+F ++   E+  V N S+GG
Sbjct  391  AAYVFTTNKAVEERMVKNVSSGG  413



>ref|XP_010093107.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
 gb|EXB53545.1| Aldehyde dehydrogenase family 3 member I1 [Morus notabilis]
Length=588

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  201  KFSFEAFSHXXAVXKRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
            KFSF+ FSH  +V  R F  D   RYPPYT +K  LL+AL+S  ++ II+A
Sbjct  533  KFSFDGFSHKKSVMYRGFEPDASVRYPPYTPQKQRLLKALLSGKILAIIQA  583



>gb|AAF31412.1|AF201889_1 aldehyde dehydrogenase [Gossypioides kirkii]
Length=76

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  201  KFSFEAFSHXXAVXKRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFIIRA  49
            KFSF+ FSH  AV   SF  D   RYPPYT  K  LL+AL+  +++ IIRA
Sbjct  19   KFSFDTFSHKKAVLYXSFAGDAPLRYPPYTNGKLRLLQALLGGSILGIIRA  69



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score = 57.4 bits (137),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT++H+     P GGVGESG GSYHG FSF+AF+H  AV  RSF  +  ARYPP
Sbjct  392  GGMVFNDTSIHLTNQHLPFGGVGESGVGSYHGTFSFDAFAHKKAVLDRSFLGEAKARYPP  451

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +L+ ++  N + +++A
Sbjct  452  YTPGKLKILKGVLKGNPLAMVQA  474


 Score = 23.1 bits (48),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 0/26 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGGXAY  284
            AAYLF      + +   N SAGG  +
Sbjct  371  AAYLFSKDSKLKHQFERNVSAGGMVF  396



>ref|XP_009060246.1| hypothetical protein LOTGIDRAFT_229102 [Lottia gigantea]
 gb|ESO89209.1| hypothetical protein LOTGIDRAFT_229102 [Lottia gigantea]
Length=503

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXD--XGARY  124
            G   +NDT LH  + T P GGVG SG G YHGKFSF+ FSH  +V KR  G +     RY
Sbjct  383  GGVCVNDTLLHAGIQTLPFGGVGHSGIGGYHGKFSFDVFSHKRSVLKRGLGMEFVNNIRY  442

Query  123  PPYTXKKAXLLRAL  82
            PPYT KK  +L  L
Sbjct  443  PPYTEKKMKILNLL  456



>ref|XP_003539464.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Glycine 
max]
Length=494

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R ++     G+  IND  L  AV T P GGVGESG G YHGKFSF+ FSH  A+ +R
Sbjct  384  TLQRRMISETSSGSVTINDAILQYAVDTVPFGGVGESGFGMYHGKFSFDTFSHQKAIVRR  443

Query  153  SFGXDXGARYPPYTXKKAXLL  91
            SF  D   RYPP+T  K  LL
Sbjct  444  SFLTDFWYRYPPWTLNKLQLL  464



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  L+NDT++H+     P GGVGESGTG+YHGKFSF+AFSH  AV  R F  +  ARYPP
Sbjct  389  GGMLLNDTSIHLTNPYLPFGGVGESGTGAYHGKFSFDAFSHKKAVLNRGFFGEAKARYPP  448

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            Y+  K  +++ ++   L  +I+A
Sbjct  449  YSEPKLKIMKGVLEGKLGDMIQA  471



>gb|KHN25245.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=396

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R ++     G+  IND  L  AV T P GGVGESG G YHGKFSF+ FSH  A+ +R
Sbjct  286  TLQRRMISETSSGSVTINDAILQYAVDTVPFGGVGESGFGMYHGKFSFDTFSHQKAIVRR  345

Query  153  SFGXDXGARYPPYTXKKAXLL  91
            SF  D   RYPP+T  K  LL
Sbjct  346  SFLTDFWYRYPPWTLNKLQLL  366



>gb|AFW56225.1| hypothetical protein ZEAMMB73_146423 [Zea mays]
Length=420

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H+     P GGVGESG G+YHG FSF+AFSH  AV  RSF  +  ARYPP
Sbjct  327  GGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPP  386

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LR +++ + +  ++A
Sbjct  387  YTPAKLAILRGVLNGSPLATVQA  409



>emb|CDY66167.1| BnaCnng49760D [Brassica napus]
Length=160

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+ ++NDTA+H  + T P GGVGESG GSYHGKFSF+AFSH  +V  +SF  D   RYPP
Sbjct  93   GSIVVNDTAVHFTLPTLPFGGVGESGIGSYHGKFSFDAFSHKKSVLFKSFLGDSAIRYPP  152

Query  117  YTXKK  103
            Y+ KK
Sbjct  153  YSRKK  157



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H+     P GGVGESG G+YHG FSF+AFSH  AV  RSF  +  ARYPP
Sbjct  398  GGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LR +++ + +  ++A
Sbjct  458  YTPAKLAILRGVLNGSPLATVQA  480



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  + NDT +H+     P GGVGESG G+YHG FSF+AFSH  AV  RSF  +  ARYPP
Sbjct  398  GGIMFNDTGIHLTNPNLPFGGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPP  457

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LR +++ + +  ++A
Sbjct  458  YTPAKLAILRGVLNGSPLATVQA  480



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score = 55.1 bits (131),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  LIND  L       P GGVGESG GSYHG+FSF+AFSH  AV  R F  +   RYPP
Sbjct  395  GGMLINDAILQFTNPHLPFGGVGESGMGSYHGRFSFDAFSHKKAVLSRGFYGEIPMRYPP  454

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            YT  K  +LR L++ N++ ++ A
Sbjct  455  YTPLKQKVLRGLIAGNILPLLHA  477


 Score = 23.9 bits (50),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 11/23 (48%), Positives = 13/23 (57%), Gaps = 0/23 (0%)
 Frame = -1

Query  361  AAYLFXSSXNXEQECVTNXSAGG  293
            AAYLF      E++ V   SAGG
Sbjct  374  AAYLFTKDHKLEKKFVKTVSAGG  396



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++ND  L   +   P GGVGESGTG+YHGK +F+AFSH  AV  ++ G D  ARYPP
Sbjct  391  GGIVMNDCVLQFIIPELPFGGVGESGTGAYHGKATFDAFSHRKAVLVKNMGGDVFARYPP  450

Query  117  YTXKKAXLLRALMSXNLIFIIRA  49
            +T +K  L++AL++  +I II A
Sbjct  451  FTVRKQSLIKALLTGTIIDIILA  473



>ref|XP_003539064.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R ++     G+  IND  L  A  T P GGVGESG G YHGKFSF+ FSH  A+ +R
Sbjct  384  TLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSFDTFSHQKAIVRR  443

Query  153  SFGXDXGARYPPYTXKKAXLL  91
            SF  D   RYPP+T  K  LL
Sbjct  444  SFLTDFWYRYPPWTLNKLQLL  464



>gb|KHN21904.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=446

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R ++     G+  IND  L  A  T P GGVGESG G YHGKFSF+ FSH  A+ +R
Sbjct  336  TLQRRMISETSSGSVTINDAVLQYAADTIPFGGVGESGFGMYHGKFSFDTFSHQKAIVRR  395

Query  153  SFGXDXGARYPPYTXKKAXLL  91
            SF  D   RYPP+T  K  LL
Sbjct  396  SFLTDFWYRYPPWTLNKLQLL  416



>ref|WP_021267505.1| aldehyde dehydrogenase (NAD) family protein [Bacteriovorax sp. 
BAL6_X]
 gb|EPZ50355.1| aldehyde dehydrogenase (NAD) family protein [Bacteriovorax sp. 
BAL6_X]
Length=454

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + V+     G  +INDT +H++    P GGVGESG G+YHG+FSF+ FSH  AV KRSF 
Sbjct  370  KKVIESISSGGMVINDTIVHLSNEKLPFGGVGESGMGAYHGEFSFKLFSHEKAVMKRSFC  429

Query  144  XDXGARYPPYTXKKAXLLRALMS  76
             +   RYPPY  KK  L+R +M+
Sbjct  430  LENDLRYPPYE-KKVSLVRKIMN  451



>ref|WP_012163534.1| aldehyde dehydrogenase [Acaryochloris marina]
 gb|ABW28106.1| aldehyde dehydrogenase family protein [Acaryochloris marina MBIC11017]
Length=462

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + VL     G   IN+T LHV V T P GGVG SG GSYHGK SF+ FSH  +V KR+F 
Sbjct  379  QQVLTSTSSGGACINETVLHVGVGTLPFGGVGPSGMGSYHGKASFDTFSHQKSVLKRAFW  438

Query  144  XDXGARYPPYTXKKAXLLRALMS  76
             D G RY PYT K    ++ +++
Sbjct  439  LDLGWRYAPYTVKGLNQVKRIVT  461



>ref|WP_010474036.1| aldehyde dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=462

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + VL     G   IN+T LHV V T P GGVG SG GSYHGK SF+ FSH  +V KR+F 
Sbjct  379  QQVLTSTSSGGACINETVLHVGVGTLPFGGVGPSGMGSYHGKASFDTFSHQKSVLKRAFW  438

Query  144  XDXGARYPPYTXKKAXLLRALMS  76
             D G RY PYT K    ++ +++
Sbjct  439  LDLGWRYAPYTVKGLNQVKRIVT  461



>ref|XP_004486968.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=494

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = -2

Query  339  AXTXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVX  160
            + T  R ++     G+ + ND  +  AV T P GGVGESG G YHGKFSF+ FSH  AV 
Sbjct  382  SKTLQRRMVSETSSGSIVFNDAIIQYAVDTLPFGGVGESGLGRYHGKFSFDTFSHHKAVA  441

Query  159  KRSFGXDXGARYPPYTXKKAXLLRALMSXNLIFI  58
            +RSF  D   R+PP+T +K  LL    + + I I
Sbjct  442  RRSFYTDFWFRFPPWTLEKFQLLEEAYNLDYIGI  475



>ref|XP_008878747.1| hypothetical protein H310_13140 [Aphanomyces invadans]
 gb|ETV92711.1| hypothetical protein H310_13140 [Aphanomyces invadans]
Length=510

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 0/106 (0%)
 Frame = -2

Query  321  SVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGX  142
            SV+     G   INDT L +     P GGVG SG G YHGK+SF+ FSH  AV ++SF  
Sbjct  392  SVVQRTSSGGVCINDTMLQIGNFNLPFGGVGASGMGRYHGKYSFDTFSHEKAVMRKSFWL  451

Query  141  DXGARYPPYTXKKAXLLRALMSXNLIFIIRAXXXL*IYVVYIWDPQ  4
            D   RYPP+T      +R +M+     ++R    + + +V +W  Q
Sbjct  452  DLPQRYPPFTSSAVKFVRLVMTPVPRSLLRLSWWVAVVLVLLWTAQ  497



>gb|EKF37873.1| aldehyde dehydrogenase family, putative [Trypanosoma cruzi marinkellei]
Length=510

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/72 (53%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXD--XGARY  124
            GA L+ND  LHVA  + P GGVG SG G+Y GKFSFE FSH  +V +R  G +     RY
Sbjct  396  GAVLVNDVVLHVAPSSLPFGGVGHSGMGAYRGKFSFETFSHKKSVMRRKMGLEFLNAPRY  455

Query  123  PPYTXKKAXLLR  88
            PPYT  K  + R
Sbjct  456  PPYTLDKFRVFR  467



>ref|WP_015160249.1| NAD-dependent aldehyde dehydrogenase [Chamaesiphon minutus]
 gb|AFY94107.1| NAD-dependent aldehyde dehydrogenase [Chamaesiphon minutus PCC 
6605]
Length=462

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G   INDT + V V+T P GGVGESG GSYHGK SF  FSH  ++ +R F  D G RY P
Sbjct  388  GGVCINDTVMQVGVNTLPFGGVGESGIGSYHGKASFNTFSHFKSILRREFWLDLGWRYAP  447

Query  117  YTXKKAXLLRALMS  76
            YT +K   L+ +++
Sbjct  448  YTAQKLKQLKGIVT  461



>ref|XP_004173349.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
sativus]
Length=143

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+   ND  +  AV T P GGVGESG G YHGKFSF+ FSH  A+ KRS   D   RYPP
Sbjct  54   GSLTFNDAIIQYAVDTLPFGGVGESGIGRYHGKFSFDTFSHEKAIVKRSLLIDFWFRYPP  113

Query  117  YTXKKAXLLRALMSXN  70
            +   K  LLR   + N
Sbjct  114  WNNHKLQLLRHAYNFN  129



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+ + NDT +  AV T P GGVG+SG G YHGKFSF+ FSH   V +RSF  D   RYPP
Sbjct  392  GSVVFNDTIIQYAVDTLPFGGVGQSGFGRYHGKFSFDTFSHEKTVARRSFLTDIWFRYPP  451

Query  117  YTXKKAXLLRALMSXNLIFII  55
            +  K   L R+    + + ++
Sbjct  452  WNNKSLQLFRSAYRYDYLSVV  472



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+   ND  +  AV T P GGVGESG G YHGKFSF+ FSH  AV KRSF  D   RYPP
Sbjct  392  GSLTFNDAIIQYAVDTLPFGGVGESGIGRYHGKFSFDTFSHEKAVVKRSFLIDFWFRYPP  451

Query  117  YTXKKAXLLRALMSXN  70
            +   K  LLR   + N
Sbjct  452  WNNHKLELLRHAYNFN  467



>ref|XP_007150367.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
 gb|ESW22361.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
Length=490

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  + +L     G+ + ND  L   V T P GGVGE G G YHGKFSF+AFSH  AV +R
Sbjct  384  TLHKRLLSETSSGSLVFNDAILQYVVDTLPFGGVGECGFGKYHGKFSFDAFSHHKAVARR  443

Query  153  SFGXDXGARYPPYTXKKAXLLRALMSXNL  67
            S+  D   R+PP+T  K  LL   +S NL
Sbjct  444  SYFTDFWYRFPPWTLNKLQLLE--VSYNL  470



>gb|EYU46263.1| hypothetical protein MIMGU_mgv1a0057251mg, partial [Erythranthe 
guttata]
Length=360

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+ L ND  L  A  + P GGVG SG G  HGKFSF+ FSH  A+ +RS+  D   RYPP
Sbjct  271  GSILFNDAMLQYAADSLPFGGVGGSGFGRCHGKFSFDEFSHEKAIMRRSYLLDFWFRYPP  330

Query  117  YTXKKAXLLRA  85
            +   K  LLR+
Sbjct  331  WNDNKLQLLRS  341



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRS-FGXDXGARYP  121
            G  + NDTA+H+     P GGVGESG G+YHG FSF+AF+H  AV  RS F  +  ARYP
Sbjct  393  GGMIFNDTAIHLTNPHLPFGGVGESGMGAYHGAFSFDAFTHRKAVLDRSSFLGEARARYP  452

Query  120  PYTXKKAXLLRALMSXNLIFIIRA  49
            PYT  K  +LR ++  N + ++ A
Sbjct  453  PYTPAKLGILRGVLKGNPLAMVLA  476



>ref|WP_025977505.1| aldehyde dehydrogenase [Brevundimonas naejangsanensis]
Length=476

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+  IND  + +A    P GGVG SG G+YHG++SFEAFSH  AV KR F  D   RYPP
Sbjct  404  GSATINDAVIFMANPNLPFGGVGASGMGAYHGRYSFEAFSHRRAVLKRGFALDASIRYPP  463

Query  117  YTXKKAXLLRAL  82
            +T  K  L R +
Sbjct  464  FTPGKLALFRRM  475



>gb|KFM72617.1| Aldehyde dehydrogenase, dimeric NADP-preferring, partial [Stegodyphus 
mimosarum]
Length=523

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 4/78 (5%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR---SFGXDXG-A  130
            G+  +NDT +H++V   P GGVG SG G+Y GK+SF+ FSH  +V +R   SFG   G A
Sbjct  404  GSMCVNDTMVHLSVDALPFGGVGMSGMGTYQGKYSFDTFSHKRSVLERSLSSFGEYMGKA  463

Query  129  RYPPYTXKKAXLLRALMS  76
            RYPPY   K  +L+  +S
Sbjct  464  RYPPYNNNKIKILKMFLS  481



>ref|XP_004338470.1| aldehyde dehydrogenase, partial [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16457.1| aldehyde dehydrogenase, partial [Acanthamoeba castellanii str. 
Neff]
Length=93

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G  ++NDT +H  VH+ P GGVG+SG G+YHG+ SF+ FSH  +V  ++   D   RYPP
Sbjct  21   GGAMVNDTIMHFTVHSLPFGGVGDSGIGAYHGQASFDVFSHHKSVLNKTTKFDLSVRYPP  80

Query  117  YTXKKAXLLRAL  82
            Y+  K   ++ L
Sbjct  81   YSDNKLSFIQML  92



>gb|KIE11140.1| aldehyde dehydrogenase, partial [Tolypothrix bouteillei VB521301]
Length=344

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + VL     G   INDT LHV V + P GGVG+SG G+YHGK SF+ FSH  +V +RSF 
Sbjct  263  KKVLQTTSSGGVCINDTVLHVGVSSLPFGGVGDSGMGNYHGKASFDTFSHYKSVLRRSFW  322

Query  144  XDXGARYPPYTXKKAXLLR  88
             +    YPPY  K + L R
Sbjct  323  LNSKLLYPPYKGKLSLLKR  341



>ref|XP_010271510.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nelumbo 
nucifera]
Length=484

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R VL     G+   ND A+       P GG+G+SG G YHGKFSFEAF+H  AV +R
Sbjct  384  TLKRLVLSRTSSGSVTFNDIAVQFMSDDLPFGGIGQSGLGKYHGKFSFEAFTHEKAVLRR  443

Query  153  SFGXDXGARYPPYTXKKAXLLRALMSXNLIFII  55
            +F  D  +RYPP++  K   +R L   +   II
Sbjct  444  NFIFDLESRYPPWSDFKLNFIRLLYKYDYFGII  476



>ref|WP_015149862.1| NAD-dependent aldehyde dehydrogenase [Oscillatoria acuminata]
 gb|AFY83235.1| NAD-dependent aldehyde dehydrogenase [Oscillatoria acuminata 
PCC 6304]
Length=459

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -2

Query  324  RSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFG  145
            + VL     G   +NDT +H+AV   P GGVGESG GSYHGK SF+ FSH  +V ++SF 
Sbjct  377  QQVLRETSSGGVCLNDTIMHLAVSKLPFGGVGESGMGSYHGKASFDTFSHSKSVLEKSFR  436

Query  144  XDXGARYPPYTXKKAXLLRAL  82
             D   RYPPY  K A + R +
Sbjct  437  FDLDLRYPPYKNKLALIKRLI  457



>ref|XP_007132014.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
 gb|ESW04008.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
Length=492

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -2

Query  333  TXSRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKR  154
            T  R ++     G+   ND  +  A  T P GGVGESG G YHGKFSF+ FSH  A+ +R
Sbjct  382  TLERRMVSETSSGSLTFNDAIVQYAADTLPFGGVGESGFGMYHGKFSFDTFSHQKAIVRR  441

Query  153  SFGXDXGARYPPYTXKKAXLL  91
            SF  D   RYPP+T  K  LL
Sbjct  442  SFLTDFWFRYPPWTLNKLQLL  462



>emb|CDS09687.1| hypothetical protein LRAMOSA02364 [Absidia idahoensis var. thermophila]
Length=507

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  327  SRSVLXIXQLGAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSF  148
            ++ +L   Q G   IND  +H A ++ P GG+G SG G+YHG+ SF  F+H  +V  +  
Sbjct  390  AKKILDNTQSGGVCINDCLMHQAEYSLPFGGIGNSGIGNYHGERSFRTFTHERSVMAKKL  449

Query  147  GXDX--GARYPPYTXKKAXLLRALM  79
            G +   G RYPPYT +   ++RALM
Sbjct  450  GMESLIGVRYPPYTERSVSMMRALM  474



>gb|KEH30216.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+   ND  L  A  + P GGVG SG G YHGKFSF+ FSH  A+ +RSF  D   RYPP
Sbjct  393  GSVTFNDAILQYAADSLPFGGVGGSGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPP  452

Query  117  YTXKKAXLL  91
            +T  K  LL
Sbjct  453  WTANKFQLL  461



>gb|AFK41010.1| unknown [Lotus japonicus]
Length=293

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -2

Query  297  GAXLINDTALHVAVHTXPxggvgesgtgsyhGKFSFEAFSHXXAVXKRSFGXDXGARYPP  118
            G+ + ND+ L  A  T P GGVGESG G YHGKFSF+ FSH   + +RS+  D   RYPP
Sbjct  196  GSLMFNDSMLQYAADTLPFGGVGESGFGMYHGKFSFDTFSHHKGIVRRSYLTDFWYRYPP  255

Query  117  YTXKKAXLLRA  85
            +T  K  LL  
Sbjct  256  WTLNKFQLLEV  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563570228265