BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004I13

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007137195.1|  hypothetical protein PHAVU_009G1078001g            121   6e-32   Phaseolus vulgaris [French bean]
emb|CDX70403.1|  BnaC03g04870D                                          122   2e-31   
ref|XP_011094459.1|  PREDICTED: ER membrane protein complex subun...    130   3e-31   Sesamum indicum [beniseed]
ref|XP_010049093.1|  PREDICTED: ER membrane protein complex subun...    130   5e-31   Eucalyptus grandis [rose gum]
ref|XP_010049094.1|  PREDICTED: ER membrane protein complex subun...    129   5e-31   Eucalyptus grandis [rose gum]
ref|XP_007227052.1|  hypothetical protein PRUPE_ppa000842mg             129   5e-31   
ref|XP_008393881.1|  PREDICTED: ER membrane protein complex subun...    129   6e-31   
ref|XP_008220058.1|  PREDICTED: ER membrane protein complex subun...    129   6e-31   Prunus mume [ume]
ref|XP_009367894.1|  PREDICTED: ER membrane protein complex subun...    129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009346082.1|  PREDICTED: ER membrane protein complex subun...    129   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_008378089.1|  PREDICTED: ER membrane protein complex subun...    129   1e-30   
emb|CDP15321.1|  unnamed protein product                                129   1e-30   Coffea canephora [robusta coffee]
ref|XP_004291191.2|  PREDICTED: ER membrane protein complex subun...    127   4e-30   Fragaria vesca subsp. vesca
gb|AFW82065.1|  hypothetical protein ZEAMMB73_934117                    120   5e-30   
ref|XP_007012092.1|  Catalytics isoform 1                               126   6e-30   
gb|EYU41569.1|  hypothetical protein MIMGU_mgv1a000799mg                126   9e-30   Erythranthe guttata [common monkey flower]
ref|XP_009623191.1|  PREDICTED: ER membrane protein complex subun...    126   9e-30   Nicotiana tomentosiformis
ref|XP_009759124.1|  PREDICTED: ER membrane protein complex subun...    126   9e-30   Nicotiana sylvestris
ref|XP_004501175.1|  PREDICTED: ER membrane protein complex subun...    125   1e-29   Cicer arietinum [garbanzo]
ref|XP_009597396.1|  PREDICTED: ER membrane protein complex subun...    125   2e-29   Nicotiana tomentosiformis
gb|KJB82870.1|  hypothetical protein B456_013G218700                    125   2e-29   Gossypium raimondii
gb|KJB65683.1|  hypothetical protein B456_010G108200                    125   2e-29   Gossypium raimondii
gb|KHG08509.1|  Uncharacterized protein F383_13837                      125   2e-29   Gossypium arboreum [tree cotton]
gb|KJB65682.1|  hypothetical protein B456_010G108200                    125   2e-29   Gossypium raimondii
gb|KHG26099.1|  Uncharacterized protein F383_09262                      125   2e-29   Gossypium arboreum [tree cotton]
ref|XP_009785843.1|  PREDICTED: ER membrane protein complex subun...    125   3e-29   Nicotiana sylvestris
ref|XP_010254044.1|  PREDICTED: ER membrane protein complex subun...    124   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_002284012.1|  PREDICTED: ER membrane protein complex subun...    124   5e-29   Vitis vinifera
ref|XP_010325953.1|  PREDICTED: ER membrane protein complex subun...    124   5e-29   Solanum lycopersicum
ref|XP_003526482.1|  PREDICTED: ER membrane protein complex subun...    124   5e-29   Glycine max [soybeans]
ref|XP_003522701.1|  PREDICTED: ER membrane protein complex subun...    124   5e-29   Glycine max [soybeans]
gb|KHN10213.1|  Hypothetical protein glysoja_017817                     124   5e-29   Glycine soja [wild soybean]
gb|KHN18187.1|  Hypothetical protein glysoja_025077                     124   6e-29   Glycine soja [wild soybean]
ref|XP_002516556.1|  catalytic, putative                                123   7e-29   
ref|XP_006366781.1|  PREDICTED: ER membrane protein complex subun...    123   8e-29   Solanum tuberosum [potatoes]
ref|XP_006450658.1|  hypothetical protein CICLE_v10007348mg             123   9e-29   Citrus clementina [clementine]
gb|KJB65685.1|  hypothetical protein B456_010G108200                    122   1e-28   Gossypium raimondii
emb|CDY68532.1|  BnaCnng59410D                                          119   3e-28   Brassica napus [oilseed rape]
gb|KEH36029.1|  ER membrane protein complex subunit-like protein        121   3e-28   Medicago truncatula
ref|XP_003636402.1|  hypothetical protein MTR_040s0031                  121   3e-28   
ref|XP_010254043.1|  PREDICTED: ER membrane protein complex subun...    122   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006399663.1|  hypothetical protein EUTSA_v10012570mg             122   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_010925904.1|  PREDICTED: ER membrane protein complex subun...    121   3e-28   Elaeis guineensis
gb|KDP34198.1|  hypothetical protein JCGZ_07769                         121   4e-28   Jatropha curcas
gb|KEH36041.1|  ER membrane protein complex subunit-like protein        121   4e-28   Medicago truncatula
emb|CDX91208.1|  BnaC02g03890D                                          121   5e-28   
ref|XP_008802826.1|  PREDICTED: ER membrane protein complex subun...    121   5e-28   Phoenix dactylifera
ref|XP_003636448.1|  hypothetical protein MTR_041s0018                  121   5e-28   
dbj|BAJ90673.1|  predicted protein                                      121   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009395509.1|  PREDICTED: ER membrane protein complex subun...    120   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568721.1|  PREDICTED: ER membrane protein complex subun...    120   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_011026615.1|  PREDICTED: ER membrane protein complex subun...    120   1e-27   Populus euphratica
ref|XP_002324236.2|  hypothetical protein POPTR_0018s00550g             120   1e-27   
ref|XP_009121935.1|  PREDICTED: ER membrane protein complex subun...    120   1e-27   Brassica rapa
gb|KFK25418.1|  hypothetical protein AALP_AA8G112000                    120   1e-27   Arabis alpina [alpine rockcress]
ref|XP_009125814.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...    120   1e-27   Brassica rapa
gb|EMT32849.1|  hypothetical protein F775_31297                         120   1e-27   
ref|XP_004960655.1|  PREDICTED: ER membrane protein complex subun...    120   1e-27   Setaria italica
ref|XP_002439481.1|  hypothetical protein SORBIDRAFT_09g007880          120   1e-27   Sorghum bicolor [broomcorn]
emb|CDX69747.1|  BnaA10g20960D                                          120   2e-27   
ref|XP_006287000.1|  hypothetical protein CARUB_v10000146mg             119   2e-27   Capsella rubella
ref|XP_006654166.1|  PREDICTED: ER membrane protein complex subun...    119   3e-27   Oryza brachyantha
ref|XP_008656322.1|  PREDICTED: ER membrane protein complex subun...    119   3e-27   
ref|NP_001054975.1|  Os05g0230600                                       118   4e-27   
gb|EEE62894.1|  hypothetical protein OsJ_17698                          118   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78801.1|  hypothetical protein OsI_19058                          118   5e-27   Oryza sativa Indica Group [Indian rice]
emb|CAB87716.1|  putative protein                                       118   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196717.3|  PQQ_DH domain-containing protein                      118   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873520.1|  hypothetical protein ARALYDRAFT_487993             118   6e-27   
ref|XP_006382057.1|  hypothetical protein POPTR_0006s25700g             117   8e-27   
ref|XP_002308610.1|  hypothetical protein POPTR_0006s25700g             117   8e-27   
ref|XP_010100254.1|  hypothetical protein L484_007251                   117   9e-27   
ref|XP_008445027.1|  PREDICTED: ER membrane protein complex subun...    117   1e-26   Cucumis melo [Oriental melon]
ref|XP_004150284.1|  PREDICTED: ER membrane protein complex subun...    117   1e-26   Cucumis sativus [cucumbers]
ref|XP_004164260.1|  PREDICTED: ER membrane protein complex subun...    117   1e-26   
gb|EPS59522.1|  hypothetical protein M569_15283                         116   2e-26   Genlisea aurea
ref|XP_010491889.1|  PREDICTED: ER membrane protein complex subun...    116   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009396281.1|  PREDICTED: ER membrane protein complex subun...    116   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001168216.1|  hypothetical protein                               110   3e-26   
ref|XP_011019630.1|  PREDICTED: ER membrane protein complex subun...    115   3e-26   Populus euphratica
ref|XP_010668174.1|  PREDICTED: ER membrane protein complex subun...    115   4e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010541259.1|  PREDICTED: ER membrane protein complex subun...    115   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_010419729.1|  PREDICTED: ER membrane protein complex subun...    115   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010453205.1|  PREDICTED: ER membrane protein complex subun...    115   6e-26   Camelina sativa [gold-of-pleasure]
emb|CDX85707.1|  BnaA02g01060D                                          114   2e-25   
ref|XP_008648064.1|  PREDICTED: uncharacterized protein LOC100381...    110   3e-24   
ref|XP_006833394.1|  hypothetical protein AMTR_s00109p00121860          110   3e-24   Amborella trichopoda
gb|KJB27314.1|  hypothetical protein B456_004G290400                    109   6e-24   Gossypium raimondii
gb|KHG18967.1|  Uncharacterized protein F383_07420                      109   7e-24   Gossypium arboreum [tree cotton]
ref|XP_002962821.1|  hypothetical protein SELMODRAFT_165412             106   5e-23   
ref|XP_002965963.1|  hypothetical protein SELMODRAFT_84520              106   5e-23   
ref|XP_001765108.1|  predicted protein                                  104   3e-22   
emb|CDX78431.1|  BnaA03g03430D                                        72.8    6e-15   
gb|AAW25613.1|  SJCHGC05873 protein                                   66.6    5e-11   Schistosoma japonicum
emb|CDS34284.1|  protein of unknown function DUF1620                  70.9    8e-11   
ref|XP_003082510.1|  PQQ enzyme repeat-containing protein (ISS)       69.3    2e-10   
gb|KDQ23663.1|  hypothetical protein PLEOSDRAFT_1086136               69.3    2e-10   Pleurotus ostreatus PC15
gb|AIG55856.1|  secreted protein                                      68.9    3e-10   Achlya hypogyna
gb|KIM89724.1|  hypothetical protein PILCRDRAFT_94960                 68.2    5e-10   Piloderma croceum F 1598
ref|XP_001690163.1|  predicted protein                                67.4    5e-10   Chlamydomonas reinhardtii
ref|XP_009548280.1|  hypothetical protein HETIRDRAFT_435076           68.2    6e-10   Heterobasidion irregulare TC 32-1
gb|KIM42028.1|  hypothetical protein M413DRAFT_445212                 68.2    6e-10   Hebeloma cylindrosporum h7
gb|EUB58619.1|  hypothetical protein EGR_06502                        67.8    6e-10   Echinococcus granulosus
emb|CEG00025.1|  ER membrane protein complex subunit 1                67.8    7e-10   Ostreococcus tauri
ref|XP_002113501.1|  hypothetical protein TRIADDRAFT_37902            67.0    8e-10   Trichoplax adhaerens
ref|XP_001420893.1|  predicted protein                                66.6    8e-10   Ostreococcus lucimarinus CCE9901
gb|KIY53056.1|  DUF1620-domain-containing protein                     67.4    1e-09   Fistulina hepatica ATCC 64428
ref|XP_002129828.1|  PREDICTED: ER membrane protein complex subun...  64.7    1e-09   Ciona intestinalis [sea vase]
ref|XP_002501994.1|  predicted protein                                66.2    1e-09   Micromonas commoda
ref|XP_002731135.2|  PREDICTED: ER membrane protein complex subun...  67.0    1e-09   Saccoglossus kowalevskii
emb|CDS21066.1|  protein of unknown function DUF1620                  67.0    1e-09   Echinococcus granulosus
emb|CDJ00868.1|  protein of unknown function DUF1620                  67.0    1e-09   
gb|KII83787.1|  hypothetical protein PLICRDRAFT_147866                66.6    2e-09   Plicaturopsis crispa FD-325 SS-3
gb|KIK60871.1|  hypothetical protein GYMLUDRAFT_59265                 65.9    2e-09   Gymnopus luxurians FD-317 M1
ref|XP_007386867.1|  DUF1620-domain-containing protein                66.2    2e-09   Punctularia strigosozonata HHB-11173 SS5
gb|EMD34983.1|  hypothetical protein CERSUDRAFT_116509                65.9    3e-09   Gelatoporia subvermispora B
gb|KIK60873.1|  hypothetical protein GYMLUDRAFT_96989                 65.9    3e-09   Gymnopus luxurians FD-317 M1
gb|AAZ14939.1|  conserved hypothetical protein                        62.0    3e-09   Coprinellus disseminatus [Fairies Bonnets]
gb|KDO31298.1|  hypothetical protein SPRG_03914                       65.5    4e-09   Saprolegnia parasitica CBS 223.65
ref|XP_008613467.1|  hypothetical protein SDRG_09320                  65.5    4e-09   Saprolegnia diclina VS20
ref|XP_003057541.1|  predicted protein                                65.1    5e-09   Micromonas pusilla CCMP1545
gb|KIP12195.1|  hypothetical protein PHLGIDRAFT_62449                 65.1    5e-09   Phlebiopsis gigantea 11061_1 CR5-6
gb|ESA11291.1|  hypothetical protein GLOINDRAFT_191595                64.7    5e-09   
ref|XP_001879910.1|  predicted protein                                65.1    5e-09   Laccaria bicolor S238N-H82
ref|XP_009822483.1|  hypothetical protein H257_01127                  65.1    6e-09   Aphanomyces astaci
ref|XP_002428345.1|  conserved hypothetical protein                   65.1    6e-09   Pediculus humanus corporis [human body lice]
emb|CCD74813.1|  hypothetical protein Smp_003340                      65.1    6e-09   Schistosoma mansoni
ref|XP_007306452.1|  DUF1620-domain-containing protein                65.1    6e-09   Stereum hirsutum FP-91666 SS1
gb|KGB32850.1|  ER membrane protein complex subunit 1                 64.7    7e-09   Schistosoma haematobium
ref|XP_003244708.1|  PREDICTED: ER membrane protein complex subun...  64.7    7e-09   
ref|XP_008183329.1|  PREDICTED: ER membrane protein complex subun...  64.7    7e-09   Acyrthosiphon pisum
gb|KIK01760.1|  hypothetical protein K443DRAFT_550803                 64.7    8e-09   Laccaria amethystina LaAM-08-1
ref|XP_008861519.1|  hypothetical protein H310_00483                  64.3    1e-08   Aphanomyces invadans
gb|EPS99972.1|  hypothetical protein FOMPIDRAFT_1163474               63.9    1e-08   Fomitopsis pinicola FP-58527 SS1
emb|CDP95566.1|  Protein Bm4655, isoform b                            63.9    1e-08   
ref|XP_001900843.1|  PQQ enzyme repeat family protein                 63.9    1e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_007854548.1|  duf1620 domain-containing protein                63.9    1e-08   
gb|KJA26496.1|  hypothetical protein HYPSUDRAFT_132623                63.5    2e-08   Hypholoma sublateritium FD-334 SS-4
emb|CDO75706.1|  hypothetical protein BN946_scf184493.g4              63.2    2e-08   Trametes cinnabarina
emb|CDS09359.1|  hypothetical protein LRAMOSA10719                    63.2    2e-08   Lichtheimia ramosa
gb|KIK39148.1|  hypothetical protein CY34DRAFT_808626                 63.2    2e-08   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007775044.1|  DUF1620-domain-containing protein                63.2    2e-08   Coniophora puteana RWD-64-598 SS2
emb|CDH61324.1|  duf1620-domain-containing protein                    63.2    2e-08   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEP08079.1|  hypothetical protein                                 63.2    2e-08   Parasitella parasitica
ref|XP_004333139.1|  hypothetical protein ACA1_387250                 62.8    3e-08   Acanthamoeba castellanii str. Neff
dbj|GAN10947.1|  DUF1620-domain-containing protein                    62.8    3e-08   Mucor ambiguus
gb|EPB91074.1|  hypothetical protein HMPREF1544_02143                 62.8    3e-08   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005645637.1|  DUF1620-domain-containing protein                62.0    3e-08   Coccomyxa subellipsoidea C-169
ref|XP_007314994.1|  hypothetical protein SERLADRAFT_446202           62.4    3e-08   Serpula lacrymans var. lacrymans S7.9
gb|KDQ54694.1|  hypothetical protein JAAARDRAFT_182191                62.4    3e-08   Jaapia argillacea MUCL 33604
gb|EGO03055.1|  hypothetical protein SERLA73DRAFT_103134              62.4    3e-08   Serpula lacrymans var. lacrymans S7.3
ref|XP_011168484.1|  PREDICTED: ER membrane protein complex subun...  58.9    4e-08   
ref|XP_002632207.1|  Hypothetical protein CBG07074                    62.4    4e-08   Caenorhabditis briggsae
ref|XP_001664165.1|  AAEL003785-PA                                    62.0    5e-08   
ref|XP_001989854.1|  GH19025                                          62.0    6e-08   Drosophila grimshawi
ref|XP_008550454.1|  PREDICTED: ER membrane protein complex subun...  62.0    6e-08   Microplitis demolitor
ref|XP_003105800.1|  hypothetical protein CRE_17862                   61.6    6e-08   Caenorhabditis remanei
pir||T32814  hypothetical protein H17B01.4 - Caenorhabditis elegans   61.6    6e-08
gb|EGT52693.1|  hypothetical protein CAEBREN_25452                    61.6    7e-08   Caenorhabditis brenneri
ref|NP_493980.1|  Protein EMC-1, isoform a                            61.6    7e-08   Caenorhabditis elegans [roundworm]
gb|KIM65686.1|  hypothetical protein SCLCIDRAFT_444798                61.2    8e-08   Scleroderma citrinum Foug A
ref|XP_002170353.2|  PREDICTED: ER membrane protein complex subun...  61.2    9e-08   
ref|XP_011453664.1|  PREDICTED: ER membrane protein complex subun...  57.0    1e-07   Crassostrea gigas
gb|EFX81955.1|  hypothetical protein DAPPUDRAFT_211018                60.5    1e-07   Daphnia pulex
ref|XP_004923563.1|  PREDICTED: ER membrane protein complex subun...  60.8    1e-07   Bombyx mori [silk moth]
ref|XP_004345642.2|  hypothetical protein CAOG_06052                  60.8    1e-07   Capsaspora owczarzaki ATCC 30864
gb|KDR78137.1|  hypothetical protein GALMADRAFT_94668                 60.8    1e-07   Galerina marginata CBS 339.88
ref|XP_011347663.1|  PREDICTED: ER membrane protein complex subun...  60.8    1e-07   
ref|XP_011347662.1|  PREDICTED: ER membrane protein complex subun...  60.8    1e-07   Ooceraea biroi
ref|XP_011347660.1|  PREDICTED: ER membrane protein complex subun...  60.8    1e-07   Ooceraea biroi
ref|XP_011347659.1|  PREDICTED: ER membrane protein complex subun...  60.8    1e-07   Ooceraea biroi
ref|XP_011303674.1|  PREDICTED: ER membrane protein complex subun...  60.5    1e-07   Fopius arisanus
ref|XP_001864835.1|  conserved hypothetical protein                   60.5    1e-07   Culex quinquefasciatus
ref|XP_011054864.1|  PREDICTED: ER membrane protein complex subun...  60.5    1e-07   Acromyrmex echinatior
ref|XP_011054863.1|  PREDICTED: ER membrane protein complex subun...  60.5    1e-07   Acromyrmex echinatior
ref|XP_011303673.1|  PREDICTED: ER membrane protein complex subun...  60.5    1e-07   Fopius arisanus
ref|XP_007865560.1|  DUF1620-domain-containing protein                60.5    1e-07   Gloeophyllum trabeum ATCC 11539
ref|XP_009048195.1|  hypothetical protein LOTGIDRAFT_238345           60.5    1e-07   Lottia gigantea
ref|XP_011142308.1|  PREDICTED: ER membrane protein complex subun...  60.5    2e-07   
gb|EFN82684.1|  Uncharacterized protein KIAA0090-like protein         60.5    2e-07   Harpegnathos saltator
ref|XP_011142310.1|  PREDICTED: ER membrane protein complex subun...  60.5    2e-07   
ref|XP_003385319.1|  PREDICTED: ER membrane protein complex subun...  60.5    2e-07   
emb|CCX06285.1|  Similar to Uncharacterized protein KIAA0090 homo...  60.5    2e-07   Pyronema omphalodes CBS 100304
ref|XP_007393484.1|  hypothetical protein PHACADRAFT_116839           60.1    2e-07   Phanerochaete carnosa HHB-10118-sp
ref|XP_002902249.1|  conserved hypothetical protein                   60.1    2e-07   Phytophthora infestans T30-4
ref|XP_001621302.1|  hypothetical protein NEMVEDRAFT_v1g145387        59.3    2e-07   Nematostella vectensis
ref|XP_008901756.1|  hypothetical protein PPTG_08786                  60.1    2e-07   Phytophthora parasitica INRA-310
ref|XP_008204908.1|  PREDICTED: ER membrane protein complex subun...  60.1    2e-07   Nasonia vitripennis
gb|ETM51987.1|  hypothetical protein L914_04285                       60.1    2e-07   Phytophthora parasitica
gb|ETK92263.1|  hypothetical protein L915_04340                       60.1    2e-07   Phytophthora parasitica
ref|XP_001999872.1|  GI22838                                          59.7    2e-07   Drosophila mojavensis
ref|XP_011504565.1|  PREDICTED: ER membrane protein complex subun...  59.7    2e-07   Ceratosolen solmsi marchali
ref|XP_009522565.1|  hypothetical protein PHYSODRAFT_328023           59.7    2e-07   Phytophthora sojae
gb|KIH61400.1|  g-patch domain protein                                60.1    2e-07   Ancylostoma duodenale
ref|XP_003380081.1|  conserved hypothetical protein                   59.7    3e-07   Trichinella spiralis
ref|XP_008469500.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...  59.7    3e-07   
ref|XP_624458.2|  PREDICTED: ER membrane protein complex subunit ...  59.7    3e-07   Apis mellifera [bee]
ref|XP_006614761.1|  PREDICTED: ER membrane protein complex subun...  59.7    3e-07   Apis dorsata [rock honeybee]
ref|XP_006967829.1|  predicted protein                                59.7    3e-07   Trichoderma reesei QM6a
ref|XP_006562727.1|  PREDICTED: ER membrane protein complex subun...  59.7    3e-07   Apis mellifera [bee]
ref|XP_006562726.1|  PREDICTED: ER membrane protein complex subun...  59.7    3e-07   Apis mellifera [bee]
ref|XP_007514832.1|  predicted protein                                59.7    3e-07   Bathycoccus prasinos
ref|XP_003694723.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  59.3    3e-07   
gb|EIE91052.1|  hypothetical protein RO3G_15763                       59.3    3e-07   Rhizopus delemar RA 99-880
ref|XP_001638961.1|  predicted protein                                59.3    3e-07   Nematostella vectensis
ref|XP_007365855.1|  hypothetical protein DICSQDRAFT_155168           59.3    3e-07   Dichomitus squalens LYAD-421 SS1
ref|XP_003741298.1|  PREDICTED: uncharacterized protein KIAA0090 ...  59.3    3e-07   Galendromus occidentalis
emb|CCM05286.1|  predicted protein                                    59.3    4e-07   Fibroporia radiculosa
gb|ETN68661.1|  g-patch domain protein                                59.3    4e-07   Necator americanus
gb|KHJ96160.1|  g-patch domain protein                                59.3    4e-07   Oesophagostomum dentatum [nodule worm]
gb|ADY17769.1|  UT01015p                                              58.9    4e-07   Drosophila melanogaster
ref|XP_002096611.1|  GE25763                                          59.3    4e-07   
ref|XP_003394767.1|  PREDICTED: uncharacterized protein KIAA0090-...  59.3    4e-07   
ref|XP_003736887.1|  GA15535, isoform B                               59.3    4e-07   Drosophila pseudoobscura pseudoobscura
ref|XP_003485666.1|  PREDICTED: uncharacterized protein KIAA0090-...  59.3    4e-07   
ref|NP_001287216.1|  CG2943, isoform C                                59.3    4e-07   Drosophila melanogaster
ref|XP_002019570.1|  GL12143                                          59.3    4e-07   Drosophila persimilis
ref|XP_001979234.1|  GG24873                                          58.9    4e-07   
ref|XP_001359799.2|  GA15535, isoform A                               58.9    4e-07   Drosophila pseudoobscura pseudoobscura
ref|XP_002102532.1|  GD19453                                          58.9    4e-07   Drosophila simulans
ref|XP_008040432.1|  DUF1620-domain-containing protein                59.3    4e-07   Trametes versicolor FP-101664 SS1
ref|XP_011264128.1|  PREDICTED: ER membrane protein complex subun...  58.9    4e-07   Camponotus floridanus
gb|AAL13840.1|  LD30573p                                              58.9    4e-07   Drosophila melanogaster
gb|KIL61586.1|  hypothetical protein M378DRAFT_109215                 59.3    4e-07   Amanita muscaria Koide BX008
ref|XP_003705002.1|  PREDICTED: uncharacterized protein KIAA0090-...  58.9    4e-07   Megachile rotundata
ref|XP_002038741.1|  GM10448                                          58.9    4e-07   Drosophila sechellia
ref|NP_649747.1|  CG2943, isoform A                                   58.9    4e-07   Drosophila melanogaster
ref|XP_006732521.1|  PREDICTED: ER membrane protein complex subun...  54.7    4e-07   Leptonychotes weddellii
gb|ETN63708.1|  hypothetical protein AND_004576                       58.9    4e-07   Anopheles darlingi [American malaria mosquito]
ref|XP_011264127.1|  PREDICTED: ER membrane protein complex subun...  58.9    4e-07   Camponotus floridanus
ref|XP_001954241.1|  GF16847                                          58.9    4e-07   Drosophila ananassae
gb|EIE91341.1|  hypothetical protein RO3G_16052                       58.9    4e-07   Rhizopus delemar RA 99-880
gb|EPQ61850.1|  hypothetical protein BGT96224_652                     58.9    5e-07   Blumeria graminis f. sp. tritici 96224
gb|EYC44584.1|  hypothetical protein Y032_0456g1777                   58.9    5e-07   Ancylostoma ceylanicum
gb|EYC44585.1|  hypothetical protein Y032_0456g1777                   58.9    5e-07   Ancylostoma ceylanicum
ref|XP_009020824.1|  hypothetical protein HELRODRAFT_82224            58.5    5e-07   Helobdella robusta
gb|KIJ47261.1|  hypothetical protein M422DRAFT_66579                  58.5    5e-07   Sphaerobolus stellatus SS14
gb|KIJ24147.1|  hypothetical protein M422DRAFT_56525                  58.5    6e-07   Sphaerobolus stellatus SS14
ref|XP_009169407.1|  hypothetical protein T265_05991                  58.5    6e-07   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_001595133.1|  hypothetical protein SS1G_03221                  58.5    7e-07   Sclerotinia sclerotiorum 1980 UF-70
emb|CCU82868.1|  DUF1620 domain-containing protein                    58.5    7e-07   Blumeria graminis f. sp. hordei DH14
gb|EHK47718.1|  hypothetical protein TRIATDRAFT_154130                58.5    7e-07   Trichoderma atroviride IMI 206040
gb|EMF13073.1|  DUF1620-domain-containing protein                     58.2    7e-07   Sphaerulina musiva SO2202
ref|XP_562511.3|  AGAP003647-PA                                       58.2    8e-07   Anopheles gambiae str. PEST
gb|KHJ32329.1|  putative duf1620 domain-containing protein            58.2    8e-07   Erysiphe necator
ref|XP_004176591.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...  58.2    8e-07   
ref|XP_001742198.1|  hypothetical protein                             57.8    8e-07   Monosiga brevicollis MX1
emb|CEI93176.1|  hypothetical protein RMCBS344292_07416               58.2    8e-07   Rhizopus microsporus
ref|XP_005833007.1|  hypothetical protein GUITHDRAFT_163084           58.2    9e-07   Guillardia theta CCMP2712
gb|KFB41320.1|  AGAP003647-PA-like protein                            58.2    9e-07   Anopheles sinensis
ref|XP_002606692.1|  hypothetical protein BRAFLDRAFT_72541            57.8    1e-06   Branchiostoma floridae
ref|XP_002070396.1|  GK11051                                          57.8    1e-06   Drosophila willistoni
gb|EKC38401.1|  hypothetical protein CGI_10002987                     57.8    1e-06   Crassostrea gigas
ref|XP_011456692.1|  PREDICTED: ER membrane protein complex subun...  57.8    1e-06   Crassostrea gigas
ref|XP_011456699.1|  PREDICTED: ER membrane protein complex subun...  57.8    1e-06   Crassostrea gigas
gb|KFH69243.1|  hypothetical protein MVEG_04058                       57.8    1e-06   Mortierella verticillata NRRL 6337
ref|XP_002628323.1|  DUF1620 domain-containing protein                57.8    1e-06   Blastomyces gilchristii SLH14081
gb|EEQ89118.1|  DUF1620 domain-containing protein                     57.8    1e-06   Blastomyces dermatitidis ER-3
gb|EJD76132.1|  PQQ enzyme repeat family protein                      57.8    1e-06   Loa loa
gb|EGE81558.1|  DUF1620 domain-containing protein                     57.8    1e-06   Blastomyces dermatitidis ATCC 18188
ref|XP_002408222.1|  conserved hypothetical protein                   57.8    1e-06   Ixodes scapularis [blacklegged tick]
ref|XP_005495916.1|  PREDICTED: ER membrane protein complex subun...  57.8    1e-06   
ref|XP_003145059.1|  PQQ enzyme repeat family protein                 57.4    1e-06   
ref|XP_003007989.1|  conserved hypothetical protein                   57.4    1e-06   Verticillium alfalfae VaMs.102
ref|XP_002682358.1|  hypothetical protein NAEGRDRAFT_78106            57.4    1e-06   Naegleria gruberi strain NEG-M
gb|ELU06819.1|  hypothetical protein CAPTEDRAFT_171523                57.4    2e-06   Capitella teleta
gb|EHK17277.1|  hypothetical protein TRIVIDRAFT_75839                 57.0    2e-06   Trichoderma virens Gv29-8
ref|XP_005101903.1|  PREDICTED: ER membrane protein complex subun...  57.0    2e-06   Aplysia californica
emb|CDJ95286.1|  Pyrrolo-quinoline quinone repeat and Protein of ...  57.0    2e-06   Haemonchus contortus [red stomach worm]
ref|XP_008632544.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  57.4    2e-06   
gb|EMP28302.1|  E3 ubiquitin-protein ligase UBR4                      57.0    2e-06   Chelonia mydas [green seaturtle]
ref|XP_011184855.1|  PREDICTED: ER membrane protein complex subun...  57.0    2e-06   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005846272.1|  hypothetical protein CHLNCDRAFT_58253            57.0    2e-06   Chlorella variabilis
ref|XP_011184853.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005528439.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009097868.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   Serinus canaria [canary]
ref|XP_005057879.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_010410820.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
gb|KFO59600.1|  ER membrane protein complex subunit 1                 56.6    2e-06   Corvus brachyrhynchos
ref|XP_008165539.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
gb|KFZ04814.1|  hypothetical protein V501_08940                       56.6    2e-06   
ref|XP_011198451.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_967657.1|  PREDICTED: ER membrane protein complex subunit 1    56.6    2e-06   
ref|XP_009651592.1|  hypothetical protein VDAG_02644                  56.6    2e-06   
ref|XP_008165538.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_007005541.1|  hypothetical protein TREMEDRAFT_69081            56.6    2e-06   
gb|KFY71358.1|  hypothetical protein V499_08451                       56.6    2e-06   
ref|XP_007067788.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_004529246.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_005428228.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_011198452.1|  PREDICTED: ER membrane protein complex subun...  56.6    2e-06   
ref|XP_006115158.1|  PREDICTED: ER membrane protein complex subun...  56.6    3e-06   
gb|ELR01795.1|  hypothetical protein GMDG_00895                       56.6    3e-06   
ref|XP_004529245.1|  PREDICTED: ER membrane protein complex subun...  56.6    3e-06   
ref|XP_789622.3|  PREDICTED: uncharacterized protein KIAA0090-like    56.6    3e-06   
gb|KDQ19878.1|  hypothetical protein BOTBODRAFT_27299                 56.6    3e-06   
gb|EMR80714.1|  putative duf1620 domain-containing protein            56.6    3e-06   
ref|XP_001554621.1|  hypothetical protein BC1G_06764                  56.6    3e-06   
gb|KFY38294.1|  hypothetical protein V495_06652                       56.6    3e-06   
ref|XP_002387386.1|  hypothetical protein MPER_13913                  52.4    3e-06   
ref|XP_007356580.1|  DUF1620-domain-containing protein                56.6    3e-06   
gb|KEQ93454.1|  hypothetical protein AUEXF2481DRAFT_41682             56.2    3e-06   
gb|KFZ12898.1|  hypothetical protein V502_06873                       56.2    3e-06   
ref|XP_007785274.1|  hypothetical protein W97_09222                   56.2    3e-06   
emb|CAG03213.1|  unnamed protein product                              56.2    3e-06   
gb|KFY23274.1|  hypothetical protein V493_05961                       56.2    3e-06   
ref|XP_002544245.1|  conserved hypothetical protein                   56.2    3e-06   
ref|XP_003027948.1|  hypothetical protein SCHCODRAFT_70229            56.2    3e-06   
gb|EHJ70860.1|  hypothetical protein KGM_04938                        56.2    3e-06   
gb|ESZ89479.1|  hypothetical protein SBOR_10136                       56.2    3e-06   
ref|NP_001084811.1|  ER membrane protein complex subunit 1 precursor  56.2    3e-06   
gb|KFY56863.1|  hypothetical protein V497_05939                       56.2    3e-06   
gb|KFY38151.1|  hypothetical protein V494_04490                       56.2    4e-06   
gb|KFY11751.1|  hypothetical protein V492_04276                       56.2    4e-06   
gb|AAM88856.1|AF525925_1  unknown                                     55.5    4e-06   
emb|CEI98561.1|  hypothetical protein RMCBS344292_12667               56.2    4e-06   
gb|KIV91467.1|  hypothetical protein PV10_06003                       56.2    4e-06   
emb|CEG65592.1|  hypothetical protein RMATCC62417_02346               56.2    4e-06   
ref|XP_003854577.1|  hypothetical protein MYCGRDRAFT_99418            56.2    4e-06   
gb|KFY81414.1|  hypothetical protein V500_11451                       56.2    4e-06   
ref|XP_007678828.1|  hypothetical protein BAUCODRAFT_75439            55.8    4e-06   
ref|XP_006785514.1|  PREDICTED: ER membrane protein complex subun...  55.8    4e-06   
ref|XP_006785513.1|  PREDICTED: ER membrane protein complex subun...  55.8    4e-06   
ref|XP_011378059.1|  PREDICTED: ER membrane protein complex subun...  55.5    4e-06   
ref|XP_008122171.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...  55.8    4e-06   
emb|CAH90853.1|  hypothetical protein                                 55.5    4e-06   
ref|XP_003050969.1|  predicted protein                                55.8    4e-06   
gb|KFY96009.1|  hypothetical protein V498_02968                       55.8    4e-06   
ref|XP_001222337.1|  hypothetical protein CHGG_06242                  54.7    4e-06   
ref|XP_004554132.1|  PREDICTED: ER membrane protein complex subun...  55.8    4e-06   
ref|XP_004554131.1|  PREDICTED: ER membrane protein complex subun...  55.8    4e-06   
gb|KFY63101.1|  hypothetical protein V496_04200                       55.8    4e-06   
ref|XP_010220149.1|  PREDICTED: ER membrane protein complex subun...  55.5    5e-06   
ref|XP_010766508.1|  PREDICTED: ER membrane protein complex subun...  55.1    5e-06   
gb|KGL82244.1|  ER membrane protein complex subunit 1                 55.5    5e-06   
gb|EME45050.1|  hypothetical protein DOTSEDRAFT_70928                 55.8    5e-06   
ref|XP_007896029.1|  PREDICTED: ER membrane protein complex subun...  55.8    5e-06   
ref|XP_009554537.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  55.8    5e-06   
gb|KHN87674.1|  ER membrane protein complex subunit 1                 55.5    5e-06   
ref|XP_003069941.1|  hypothetical protein CPC735_031320               55.8    5e-06   
gb|EFW16197.1|  hypothetical protein CPSG_07247                       55.5    5e-06   
ref|XP_001242785.1|  hypothetical protein CIMG_06681                  55.5    5e-06   
gb|ELW68555.1|  hypothetical protein TREES_T100008839                 55.5    5e-06   
ref|XP_005544661.1|  PREDICTED: ER membrane protein complex subun...  55.5    5e-06   
ref|XP_007104659.1|  PREDICTED: ER membrane protein complex subun...  55.5    5e-06   
ref|XP_009232450.1|  PREDICTED: ER membrane protein complex subun...  55.5    5e-06   
ref|XP_008965353.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009232437.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006261817.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007104658.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007104656.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005245845.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007104655.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617944.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
gb|EAW94870.1|  KIAA0090, isoform CRA_a                               55.5    6e-06   
ref|NP_001258357.1|  ER membrane protein complex subunit 1 isofor...  55.5    6e-06   
ref|XP_004024832.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617946.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617945.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
dbj|BAC11702.1|  unnamed protein product                              55.5    6e-06   
ref|XP_009198835.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007979390.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965352.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009447860.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965351.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965350.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007104657.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_003934987.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_003814479.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009447853.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965349.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965348.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009447846.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008965347.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009447861.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009985687.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006188333.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
dbj|BAA07645.2|  KIAA0090                                             55.5    6e-06   
ref|XP_010343818.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009232432.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005544658.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005317580.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
emb|CAH56165.1|  hypothetical protein                                 55.5    6e-06   
ref|NP_001258356.1|  ER membrane protein complex subunit 1 isofor...  55.5    6e-06   
ref|XP_009232431.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_003891273.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_001162981.2|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
dbj|BAF84307.1|  unnamed protein product                              55.5    6e-06   
ref|NP_055862.1|  ER membrane protein complex subunit 1 isoform 1...  55.5    6e-06   
gb|ERG80934.1|  endoplasmic reticulum membrane protein                55.5    6e-06   
ref|XP_008540194.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004457491.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005245844.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005317581.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004741388.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_003271776.2|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006188332.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004457493.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007933832.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004457492.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008540196.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007933831.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
emb|CAH56140.1|  hypothetical protein                                 55.5    6e-06   
ref|XP_005617948.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009198839.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
gb|KFV18744.1|  ER membrane protein complex subunit 1                 55.5    6e-06   
ref|XP_008998776.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617947.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009198814.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008540193.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|NP_001126319.1|  ER membrane protein complex subunit 1 precursor  55.5    6e-06   
ref|XP_009232444.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004457494.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006766714.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
gb|EPQ18170.1|  Putative protein KIAA0090                             55.5    6e-06   
ref|XP_008540198.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007933833.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005317579.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004425702.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004377247.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|NP_001248047.1|  ER membrane protein complex subunit 1 precursor  55.5    6e-06   
ref|XP_003989661.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009198819.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008146375.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005544655.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008587717.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005317577.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004314498.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004024833.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005883089.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_010956063.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009198830.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006145275.1|  PREDICTED: LOW QUALITY PROTEIN: ER membrane ...  55.5    6e-06   
ref|XP_005544657.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_010383860.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005317578.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004397122.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008540195.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006068177.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005607457.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004850475.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005544662.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005544660.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006068174.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006068173.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008587739.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008540197.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005352999.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006766713.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006934424.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008587725.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008071747.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005607456.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_010343817.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008998779.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008146372.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006934423.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005607455.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006934422.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
gb|EQB78629.1|  hypothetical protein CB1_001086038                    55.8    6e-06   
ref|XP_005544659.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004592370.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004377248.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|NP_001258358.1|  ER membrane protein complex subunit 1 isofor...  55.5    6e-06   
ref|XP_008998778.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_010383862.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008998777.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004903411.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008587732.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007175096.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006766712.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_007175095.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_008146374.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005352998.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004272517.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
gb|ERE85473.1|  E3 ubiquitin-protein ligase                           55.8    6e-06   
ref|XP_006068176.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006068175.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006866390.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005004392.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004397123.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_009232435.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006068172.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004637726.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004657640.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004741385.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004657639.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_855253.2|  PREDICTED: ER membrane protein complex subunit ...  55.5    6e-06   
tpg|DAA32205.1|  TPA: hypothetical protein BOS_2447                   55.5    6e-06   
ref|XP_007459378.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617950.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006866387.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_006094127.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004603729.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004657641.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_004425703.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005617949.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_010383861.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005607459.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   
ref|XP_005607458.1|  PREDICTED: ER membrane protein complex subun...  55.5    6e-06   



>ref|XP_007137195.1| hypothetical protein PHAVU_009G1078001g, partial [Phaseolus vulgaris]
 gb|ESW09189.1| hypothetical protein PHAVU_009G1078001g, partial [Phaseolus vulgaris]
Length=86

 Score =   121 bits (304),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            SY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLLL
Sbjct  1    SYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLLL  60

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
            TIVALV AIF+TW+ SE+K+LQEKW+
Sbjct  61   TIVALVAAIFVTWVLSERKDLQEKWK  86



>emb|CDX70403.1| BnaC03g04870D [Brassica napus]
Length=136

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  50   QSYVTHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  109

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITWI S++KEL EKWR
Sbjct  110  ITIVALVAAIYITWILSKKKELSEKWR  136



>ref|XP_011094459.1| PREDICTED: ER membrane protein complex subunit 1 [Sesamum indicum]
Length=982

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGI T+PAKLESTTLVFAYGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  896  QSYVTHALKVEGLRGIATIPAKLESTTLVFAYGVDLFFTRLAPSRTYDSLTEDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+VAIF+TW+WSE+KELQEKWR
Sbjct  956  ITIVALLVAIFVTWVWSEKKELQEKWR  982



>ref|XP_010049093.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Eucalyptus 
grandis]
Length=986

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLESTTLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  900  QSYVTHALKVEGLRGIVTVPAKLESTTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  959

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI AL+VAIF+TWIWSE+K+LQEKWR
Sbjct  960  ITIAALIVAIFVTWIWSERKDLQEKWR  986



>ref|XP_010049094.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW81549.1| hypothetical protein EUGRSUZ_C02905 [Eucalyptus grandis]
Length=984

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLESTTLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  898  QSYVTHALKVEGLRGIVTVPAKLESTTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI AL+VAIF+TWIWSE+K+LQEKWR
Sbjct  958  ITIAALIVAIFVTWIWSERKDLQEKWR  984



>ref|XP_007227052.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
 gb|EMJ28251.1| hypothetical protein PRUPE_ppa000842mg [Prunus persica]
Length=983

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLESTTL FAYGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  897  QSYVTHALKVEGLRGIVTVPAKLESTTLAFAYGVDLFFTQLAPSRTYDSLTDDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TWI SE+KEL+EKWR
Sbjct  957  ITIVALIAAIFVTWILSEKKELREKWR  983



>ref|XP_008393881.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=988

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  902  QSYVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TWIWSE+KEL+EKWR
Sbjct  962  ITIVALIAAIFVTWIWSEKKELKEKWR  988



>ref|XP_008220058.1| PREDICTED: ER membrane protein complex subunit 1 [Prunus mume]
Length=988

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLESTTL FAYGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  902  QSYVTHALKVEGLRGIVTVPAKLESTTLAFAYGVDLFFTQLAPSRTYDSLTDDFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TWI SE+KEL+EKWR
Sbjct  962  ITIVALIAAIFVTWILSEKKELREKWR  988



>ref|XP_009367894.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=988

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  902  QSYVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  962  ITIVALIAAIFVTWVWSEKKELKEKWR  988



>ref|XP_009346082.1| PREDICTED: ER membrane protein complex subunit 1-like [Pyrus 
x bretschneideri]
Length=985

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  899  QSYVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  959  ITIVALIAAIFVTWVWSEKKELKEKWR  985



>ref|XP_008378089.1| PREDICTED: ER membrane protein complex subunit 1-like [Malus 
domestica]
Length=985

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH +K EGLRGIVTVPAKLESTTL F YGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  899  QSYVTHNLKVEGLRGIVTVPAKLESTTLAFTYGVDLFFTQLAPSRTYDSLTDDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TW+WSE+KEL+EKWR
Sbjct  959  ITIVALIAAIFVTWVWSEKKELKEKWR  985



>emb|CDP15321.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DFSYALLL
Sbjct  901  QSYVTHALKVEGLRGIVTVPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFSYALLL  960

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALVVAIF+TWI SE+KELQEKWR
Sbjct  961  ITIVALVVAIFVTWILSERKELQEKWR  987



>ref|XP_004291191.2| PREDICTED: ER membrane protein complex subunit 1 [Fragaria vesca 
subsp. vesca]
Length=988

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGIVT PAKLESTTLVF YGVDLFFTQLAPS+TYDSLTDDFSYALLL
Sbjct  902  QSYVTHALRVEGLRGIVTAPAKLESTTLVFVYGVDLFFTQLAPSRTYDSLTDDFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV L+ AIF+TWI SE+KEL+EKWR
Sbjct  962  ITIVVLIAAIFVTWILSEKKELREKWR  988



>gb|AFW82065.1| hypothetical protein ZEAMMB73_934117, partial [Zea mays]
Length=227

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LRGIV++PAKLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  38   QSFVTHSHQVEALRGIVSIPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  97

Query  360  ltivalvvaifiTWIWSEQKELQEKWR*VESGEVTI  253
            +TI  LV AI +TWIWSE+KEL +KWR +   EV +
Sbjct  98   ITIAVLVAAIIVTWIWSEKKELGDKWRSLNFNEVLV  133



>ref|XP_007012092.1| Catalytics isoform 1 [Theobroma cacao]
 gb|EOY29711.1| Catalytics isoform 1 [Theobroma cacao]
Length=988

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGL+GIVTVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL
Sbjct  902  QSYVTHALRVEGLQGIVTVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TWI SE+KELQEKWR
Sbjct  962  ITIVALVAAIFVTWILSERKELQEKWR  988



>gb|EYU41569.1| hypothetical protein MIMGU_mgv1a000799mg [Erythranthe guttata]
Length=983

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K E LRGIVTVPAKLESTTLVFAYGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  897  QSYVTHALKVESLRGIVTVPAKLESTTLVFAYGVDLFFTRLAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIV L+VAIF+TW+WSE+K+LQ+KWR
Sbjct  957  LTIVGLIVAIFVTWVWSEKKDLQDKWR  983



>ref|XP_009623191.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=983

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA+K EGLR I+TVPAKLESTTLVFA+GVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  897  QAYVTHALKVEGLRNIITVPAKLESTTLVFAHGVDLFFTRLAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV+AIF+TWIWSE+KEL+EKWR
Sbjct  957  ITIVALVIAIFVTWIWSERKELEEKWR  983



>ref|XP_009759124.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=983

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA+K EGLR I+TVPAKLESTTLVFA+GVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  897  QAYVTHALKVEGLRNIITVPAKLESTTLVFAHGVDLFFTRLAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV+AIF+TWIWSE+KEL+EKWR
Sbjct  957  ITIVALVIAIFVTWIWSERKELEEKWR  983



>ref|XP_004501175.1| PREDICTED: ER membrane protein complex subunit 1-like [Cicer 
arietinum]
Length=981

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APSKTYDSLT+DFSYALLL
Sbjct  895  QSYITHSLKIEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSKTYDSLTEDFSYALLL  954

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+F+TW+ SE+K+LQEKWR
Sbjct  955  LTIVALVAALFVTWVLSERKDLQEKWR  981



>ref|XP_009597396.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
tomentosiformis]
Length=982

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA+K EGL+ I+T+PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DF+YALLL
Sbjct  896  QAYVTHALKVEGLKSIITIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFNYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV+AIF+TWIWSE+KELQEKWR
Sbjct  956  LTIVALVIAIFVTWIWSERKELQEKWR  982



>gb|KJB82870.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82871.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82872.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
 gb|KJB82873.1| hypothetical protein B456_013G218700 [Gossypium raimondii]
Length=985

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLTDDF+YALLL
Sbjct  899  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTDDFNYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TW  SE+KELQE WR
Sbjct  959  ITIVALMAAIFLTWTLSERKELQENWR  985



>gb|KJB65683.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=964

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL
Sbjct  878  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLL  937

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TW  SE+KELQEKWR
Sbjct  938  ITIVALVAAIFVTWRLSERKELQEKWR  964



>gb|KHG08509.1| Uncharacterized protein F383_13837 [Gossypium arboreum]
Length=980

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLTDDF+YALLL
Sbjct  894  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTDDFNYALLL  953

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TW  SE+KELQE WR
Sbjct  954  ITIVALLAAIFVTWTLSERKELQENWR  980



>gb|KJB65682.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=984

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL
Sbjct  898  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TW  SE+KELQEKWR
Sbjct  958  ITIVALVAAIFVTWRLSERKELQEKWR  984



>gb|KHG26099.1| Uncharacterized protein F383_09262 [Gossypium arboreum]
Length=984

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL
Sbjct  898  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TW  SE+KELQEKWR
Sbjct  958  ITIVALVAAIFVTWRLSERKELQEKWR  984



>ref|XP_009785843.1| PREDICTED: ER membrane protein complex subunit 1-like [Nicotiana 
sylvestris]
Length=981

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA+K EGL+ I+T+PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLT+DF+YALLL
Sbjct  895  QAYVTHALKVEGLKSIITIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTEDFNYALLL  954

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV+AIF+TWIWSE+KELQEKWR
Sbjct  955  LTIVALVIAIFVTWIWSERKELQEKWR  981



>ref|XP_010254044.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Nelumbo 
nucifera]
Length=985

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFT++APS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+ AIF+TWI SE KEL+EKWR
Sbjct  959  ITIVALIAAIFVTWILSENKELREKWR  985



>ref|XP_002284012.1| PREDICTED: ER membrane protein complex subunit 1 [Vitis vinifera]
 emb|CBI20872.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH +K EGLRGIVT PAKLESTTLVFAYGVDLFFT++APS+TYD LTDDFSYALLL
Sbjct  901  QSYVTHNLKVEGLRGIVTAPAKLESTTLVFAYGVDLFFTRIAPSRTYDLLTDDFSYALLL  960

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TWI SE+KELQEKWR
Sbjct  961  ITIVALVAAIFVTWILSERKELQEKWR  987



>ref|XP_010325953.1| PREDICTED: ER membrane protein complex subunit 1 [Solanum lycopersicum]
Length=982

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q++VTHA+K EGLR I+ +PAKLESTTLVFA+GVDLFFT+LAPSKTYDSLTDDF+YALLL
Sbjct  896  QAFVTHALKVEGLRSIIAIPAKLESTTLVFAHGVDLFFTRLAPSKTYDSLTDDFNYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV++IF+TWIWSE+K+LQEKWR
Sbjct  956  LTIVALVISIFVTWIWSERKDLQEKWR  982



>ref|XP_003526482.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV AIF+TW+ S++K+LQEKWR
Sbjct  957  LTIVALVAAIFVTWVLSQRKDLQEKWR  983



>ref|XP_003522701.1| PREDICTED: ER membrane protein complex subunit 1-like [Glycine 
max]
Length=983

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV AIF+TW+ S++K+LQEKWR
Sbjct  957  LTIVALVAAIFVTWVLSQRKDLQEKWR  983



>gb|KHN10213.1| Hypothetical protein glysoja_017817 [Glycine soja]
Length=983

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV AIF+TW+ S++K+LQEKWR
Sbjct  957  LTIVALVAAIFVTWVLSQRKDLQEKWR  983



>gb|KHN18187.1| Hypothetical protein glysoja_025077 [Glycine soja]
Length=983

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV AIF+TW+ S++K+LQEKWR
Sbjct  957  LTIVALVAAIFVTWVLSQRKDLQEKWR  983



>ref|XP_002516556.1| catalytic, putative [Ricinus communis]
 gb|EEF45897.1| catalytic, putative [Ricinus communis]
Length=983

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFAYGVDLFFT++APS+TYDSLT+DFSYALLL
Sbjct  897  QSYVTHALQVEGLRGIITVPAKLESTTLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALVVAIF TWI SE+KEL++KWR
Sbjct  957  LTIVALVVAIFATWILSEKKELRDKWR  983



>ref|XP_006366781.1| PREDICTED: ER membrane protein complex subunit 1-like [Solanum 
tuberosum]
Length=982

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q++VTHA+K EGLR I+ +PAKLESTTL+FA+GVDLFFT+LAPSKTYDSLTDDF+YALLL
Sbjct  896  QAFVTHALKVEGLRSIIAIPAKLESTTLIFAHGVDLFFTRLAPSKTYDSLTDDFNYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV+++F+TWIWSE+K+LQEKWR
Sbjct  956  LTIVALVISLFVTWIWSERKDLQEKWR  982



>ref|XP_006450658.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 ref|XP_006476068.1| PREDICTED: ER membrane protein complex subunit 1-like [Citrus 
sinensis]
 gb|ESR63898.1| hypothetical protein CICLE_v10007348mg [Citrus clementina]
 gb|KDO79763.1| hypothetical protein CISIN_1g002016mg [Citrus sinensis]
Length=981

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH++K EGLRGI+TVPAKLESTTLVFAYGVDLF+T+LAPS+TYDSLT+DFSYALLL
Sbjct  895  QSYVTHSLKVEGLRGILTVPAKLESTTLVFAYGVDLFYTRLAPSRTYDSLTEDFSYALLL  954

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV AIF+TW+ SE+KEL+EKWR
Sbjct  955  LTIVALVAAIFVTWVLSEKKELREKWR  981



>gb|KJB65685.1| hypothetical protein B456_010G108200 [Gossypium raimondii]
Length=1003

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI+TVPAKLESTTLVFA+GVDLFFTQLAPS+TYDSLT+DFSYALLL
Sbjct  898  QSYVTHALRVEGLRGIITVPAKLESTTLVFAHGVDLFFTQLAPSRTYDSLTEDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKW  283
            +TIVALV AIF+TW  SE+KELQEKW
Sbjct  958  ITIVALVAAIFVTWRLSERKELQEKW  983



>emb|CDY68532.1| BnaCnng59410D, partial [Brassica napus]
Length=536

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  450  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  509

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW  SE+KEL EKWR
Sbjct  510  ITIVALVAAIYITWALSEKKELSEKWR  536



>gb|KEH36029.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=849

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  763  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  822

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+F+T++ SE+K+L+EKWR
Sbjct  823  LTIVALVAALFVTYVLSERKDLEEKWR  849



>ref|XP_003636402.1| hypothetical protein MTR_040s0031 [Medicago truncatula]
Length=871

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  785  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  844

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+F+T++ SE+K+L+EKWR
Sbjct  845  LTIVALVAALFVTYVLSERKDLEEKWR  871



>ref|XP_010254043.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Nelumbo 
nucifera]
Length=989

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFT++APS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTRIAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKW  283
            +TIVAL+ AIF+TWI SE KEL+EKW
Sbjct  959  ITIVALIAAIFVTWILSENKELREKW  984



>ref|XP_006399663.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
 gb|ESQ41116.1| hypothetical protein EUTSA_v10012570mg [Eutrema salsugineum]
Length=984

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  898  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  958  ITIVALVAAIYITWVLSEKKELSEKWR  984



>ref|XP_010925904.1| PREDICTED: ER membrane protein complex subunit 1 [Elaeis guineensis]
Length=983

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA++ EGLRGI+T+PAKLESTTLVF+YGVD+FFT++APS+TYDSLT+DFSYALLL
Sbjct  897  QAYVTHALQVEGLRGIITIPAKLESTTLVFSYGVDIFFTRIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TWI SE+KEL+EKWR
Sbjct  957  ITIVALVAAIFVTWILSEKKELREKWR  983



>gb|KDP34198.1| hypothetical protein JCGZ_07769 [Jatropha curcas]
Length=985

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGI++ PAKLESTTLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHALQVEGLRGIISAPAKLESTTLVFVYGVDLFFTRLAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVAL+VAIF+TWI SE+KELQ+KWR
Sbjct  959  ITIVALIVAIFVTWILSERKELQDKWR  985



>gb|KEH36041.1| ER membrane protein complex subunit-like protein [Medicago truncatula]
Length=983

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+F+T++ SE+K+L+EKWR
Sbjct  957  LTIVALVAALFVTYVLSERKDLEEKWR  983



>emb|CDX91208.1| BnaC02g03890D [Brassica napus]
Length=997

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  911  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  970

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  971  ITIVALVAAIYITWVVSEKKELSEKWR  997



>ref|XP_008802826.1| PREDICTED: ER membrane protein complex subunit 1 [Phoenix dactylifera]
Length=985

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA++ EGLRGIVT+PA+LESTTLVF+YGVD+FFT++APS+TYDSLT+DFSYALLL
Sbjct  899  QAYVTHALQVEGLRGIVTIPARLESTTLVFSYGVDIFFTRIAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF TWI SE+KEL+EKWR
Sbjct  959  ITIVALVAAIFATWILSEKKELREKWR  985



>ref|XP_003636448.1| hypothetical protein MTR_041s0018 [Medicago truncatula]
Length=982

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVTVPAKLEST+LVFAYGVDLFFTQ+APS+TYDSLT+DFSYALLL
Sbjct  896  QSYITHSLKVEGLRGIVTVPAKLESTSLVFAYGVDLFFTQIAPSRTYDSLTEDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+F+T++ SE+K+L+EKWR
Sbjct  956  LTIVALVAALFVTYVLSERKDLEEKWR  982



>dbj|BAJ90673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=989

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+++ E LRGIV++PAKLESTTLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL
Sbjct  903  QSYVTHSLQVEALRGIVSIPAKLESTTLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLL  962

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV A+F+TWIWSE+KEL++KWR
Sbjct  963  ITIVALVAALFVTWIWSEKKELRDKWR  989



>ref|XP_009395509.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=983

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA++ EGLRGIVT PAKLESTTLVF+YGVDLFFT++APS+TYDSLT+DFSYALLL
Sbjct  897  QSYVTHALQVEGLRGIVTTPAKLESTTLVFSYGVDLFFTRIAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIVALV A+ +TW  SE+KEL+EKWR
Sbjct  957  LTIVALVAALLVTWALSEKKELREKWR  983



>ref|XP_003568721.1| PREDICTED: ER membrane protein complex subunit 1 [Brachypodium 
distachyon]
Length=989

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+++ E LRGIV +PAKLESTTLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL
Sbjct  903  QSYVTHSLQVEALRGIVAIPAKLESTTLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLL  962

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI ALV A+ +TW+WSE+KEL++KWR
Sbjct  963  ITIAALVAALVVTWVWSEKKELRDKWR  989



>ref|XP_011026615.1| PREDICTED: ER membrane protein complex subunit 1 [Populus euphratica]
Length=985

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHALKVEGLRGIVTVPAKLESATLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AIF+TW+ SE+K+L++KWR
Sbjct  959  ITIFVLVAAIFVTWVLSEKKDLRDKWR  985



>ref|XP_002324236.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
 gb|EEF02801.2| hypothetical protein POPTR_0018s00550g [Populus trichocarpa]
Length=985

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTHA+K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHALKVEGLRGIVTVPAKLESATLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  L+ AIF+TW+ SE+K+L++KWR
Sbjct  959  ITIFVLIAAIFVTWVLSEKKDLRDKWR  985



>ref|XP_009121935.1| PREDICTED: ER membrane protein complex subunit 1 [Brassica rapa]
Length=980

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  894  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  953

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW  SE+KEL EKWR
Sbjct  954  ITIVALVAAIYITWALSEKKELSEKWR  980



>gb|KFK25418.1| hypothetical protein AALP_AA8G112000 [Arabis alpina]
Length=982

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH+ K EGLRGI+T PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  896  QSYITHSHKVEGLRGIITAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  956  ITIVALVAAIYITWVLSEKKELSEKWR  982



>ref|XP_009125814.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1-like [Brassica rapa]
Length=984

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSL DDFSYALLL
Sbjct  898  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLADDFSYALLL  957

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  958  ITIVALVAAIYITWVISEKKELSEKWR  984



>gb|EMT32849.1| hypothetical protein F775_31297 [Aegilops tauschii]
Length=1139

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH ++ E LRGIV++PAKLESTTLVF YGVDLF+T+LAPS+TYDSLTD+FSYALLL
Sbjct  903  QSYVTHTLQVEALRGIVSIPAKLESTTLVFTYGVDLFYTRLAPSRTYDSLTDEFSYALLL  962

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV A+F+TWIWSE+KEL++KWR
Sbjct  963  ITIVALVAALFVTWIWSEKKELRDKWR  989



>ref|XP_004960655.1| PREDICTED: ER membrane protein complex subunit 1-like [Setaria 
italica]
Length=988

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LRGIV++PAKLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  902  QSFVTHSHQVEALRGIVSIPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AI +TWIWSE+KEL++KWR
Sbjct  962  ITIAVLVAAIIVTWIWSEKKELRDKWR  988



>ref|XP_002439481.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
 gb|EES17911.1| hypothetical protein SORBIDRAFT_09g007880 [Sorghum bicolor]
Length=989

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LRGIV++PAKLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  903  QSFVTHSHQVEALRGIVSIPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  962

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AI  TWIWSE+KEL++KWR
Sbjct  963  ITIAVLVGAIIATWIWSEKKELRDKWR  989



>emb|CDX69747.1| BnaA10g20960D [Brassica napus]
Length=1546

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             QSY+TH++K EGLRGIVT PAKLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  1460  QSYITHSLKVEGLRGIVTAPAKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  1519

Query  360   ltivalvvaifiTWIWSEQKELQEKWR  280
             +TIVALV AI+ITW  SE+KEL EKWR
Sbjct  1520  ITIVALVAAIYITWALSEKKELSEKWR  1546



>ref|XP_006287000.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
 gb|EOA19898.1| hypothetical protein CARUB_v10000146mg [Capsella rubella]
Length=981

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  895  QSYVTHSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  954

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  955  ITIVALVAAIYITWVLSEKKELSEKWR  981



>ref|XP_006654166.1| PREDICTED: ER membrane protein complex subunit 1-like [Oryza 
brachyantha]
Length=985

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            SYVTH+++ E LRGIV++P+KLESTTL+F YGVDLF+TQLAPS+TYDSLTD+FSYALLL+
Sbjct  900  SYVTHSLQVEALRGIVSIPSKLESTTLIFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLI  959

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
            TIVAL+ AI +TWIWSE+KEL++KWR
Sbjct  960  TIVALIAAIVVTWIWSEKKELRDKWR  985



>ref|XP_008656322.1| PREDICTED: ER membrane protein complex subunit 1-like [Zea mays]
Length=989

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LRGIV++PAKLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  903  QSFVTHSHQVEALRGIVSIPAKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  962

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AI +TWIWSE+KEL +KWR
Sbjct  963  ITIAVLVAAIIVTWIWSEKKELGDKWR  989



>ref|NP_001054975.1| Os05g0230600 [Oryza sativa Japonica Group]
 gb|AAS98480.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT93850.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16889.1| Os05g0230600 [Oryza sativa Japonica Group]
 dbj|BAG91928.1| unnamed protein product [Oryza sativa Japonica Group]
Length=989

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            SY+TH+++ E LRGIV++P+KLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+
Sbjct  904  SYLTHSLQVEALRGIVSIPSKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLI  963

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
            TI ALV AI +TWIWSE+KEL++KWR
Sbjct  964  TIAALVAAIVVTWIWSEKKELRDKWR  989



>gb|EEE62894.1| hypothetical protein OsJ_17698 [Oryza sativa Japonica Group]
Length=950

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            SY+TH+++ E LRGIV++P+KLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+
Sbjct  865  SYLTHSLQVEALRGIVSIPSKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLI  924

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
            TI ALV AI +TWIWSE+KEL++KWR
Sbjct  925  TIAALVAAIVVTWIWSEKKELRDKWR  950



>gb|EEC78801.1| hypothetical protein OsI_19058 [Oryza sativa Indica Group]
Length=1036

 Score =   118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  537   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
             SY+TH+++ E LRGIV++P+KLESTTLVF YGVDLF+TQLAPS+TYDSLTD+FSYALLL+
Sbjct  951   SYLTHSLQVEALRGIVSIPSKLESTTLVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLLI  1010

Query  357   tivalvvaifiTWIWSEQKELQEKWR  280
             TI ALV AI +TWIWSE+KEL++KWR
Sbjct  1011  TIAALVAAIVVTWIWSEKKELRDKWR  1036



>emb|CAB87716.1| putative protein [Arabidopsis thaliana]
Length=955

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  869  QAYVTHSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  928

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  929  ITIVALVAAIYITWVLSEKKELSEKWR  955



>ref|NP_196717.3| PQQ_DH domain-containing protein [Arabidopsis thaliana]
 gb|AED91695.1| PQQ_DH domain-containing protein [Arabidopsis thaliana]
Length=982

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  896  QAYVTHSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  956  ITIVALVAAIYITWVLSEKKELSEKWR  982



>ref|XP_002873520.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49779.1| hypothetical protein ARALYDRAFT_487993 [Arabidopsis lyrata subsp. 
lyrata]
Length=982

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH+ K EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  896  QAYVTHSHKVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+ SE+KEL EKWR
Sbjct  956  ITIVALVAAIYITWVLSEKKELSEKWR  982



>ref|XP_006382057.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|ERP59854.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=918

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  832  QSYVTHSHKVEGLRGIVTVPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  891

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALVVAIF+TW+ SE+K+L +KWR
Sbjct  892  ITIVALVVAIFVTWVLSEKKDLSDKWR  918



>ref|XP_002308610.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
 gb|EEE92133.1| hypothetical protein POPTR_0006s25700g [Populus trichocarpa]
Length=985

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHSHKVEGLRGIVTVPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALVVAIF+TW+ SE+K+L +KWR
Sbjct  959  ITIVALVVAIFVTWVLSEKKDLSDKWR  985



>ref|XP_010100254.1| hypothetical protein L484_007251 [Morus notabilis]
 gb|EXB82261.1| hypothetical protein L484_007251 [Morus notabilis]
Length=973

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ + EGLRGIVTVPAKLEST LVFAYGVDLF+T++APS+TYDSLT+DFSYALLL
Sbjct  887  QSYVTHSQRVEGLRGIVTVPAKLESTALVFAYGVDLFYTRIAPSRTYDSLTEDFSYALLL  946

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LV AIF TWI SE+K+L++KWR
Sbjct  947  ITIVVLVAAIFATWILSEKKDLRDKWR  973



>ref|XP_008445027.1| PREDICTED: ER membrane protein complex subunit 1 [Cucumis melo]
Length=985

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTHA++ EGLRGI+T+PAKLESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL
Sbjct  899  QTYVTHALQVEGLRGIMTIPAKLESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV+AIF TW+ SE+KELQ+KW+
Sbjct  959  ITIVALVIAIFATWVLSERKELQDKWK  985



>ref|XP_004150284.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
 gb|KGN62826.1| Catalytic [Cucumis sativus]
Length=985

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH+++ EGLRGIVT+PAKLESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL
Sbjct  899  QTYVTHSLQVEGLRGIVTIPAKLESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV+AIF TW+ SE+KELQ+KW+
Sbjct  959  ITIVALVIAIFATWVLSERKELQDKWK  985



>ref|XP_004164260.1| PREDICTED: ER membrane protein complex subunit 1-like [Cucumis 
sativus]
Length=985

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH+++ EGLRGIVT+PAKLESTTL FAYGVDLFFT++ PS+TYDSLT+DFSYALLL
Sbjct  899  QTYVTHSLQVEGLRGIVTIPAKLESTTLAFAYGVDLFFTRITPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV+AIF TW+ SE+KELQ+KW+
Sbjct  959  ITIVALVIAIFATWVLSERKELQDKWK  985



>gb|EPS59522.1| hypothetical protein M569_15283, partial [Genlisea aurea]
Length=908

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH VK EGLR +VT PA+LEST LVFA+GVDLFF +LAPSKT+DSLT++FSYALLL
Sbjct  822  QSYVTHGVKVEGLRNVVTFPARLESTALVFAHGVDLFFARLAPSKTFDSLTEEFSYALLL  881

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTI AL+VAIF+TWIWSE+KELQ+KWR
Sbjct  882  LTIAALLVAIFVTWIWSEKKELQDKWR  908



>ref|XP_010491889.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ + EGLRGIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  892  QSYVTHSHRVEGLRGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  951

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LV AI+ITW  SE+KEL EKWR
Sbjct  952  ITIVVLVAAIYITWALSEKKELSEKWR  978



>ref|XP_009396281.1| PREDICTED: ER membrane protein complex subunit 1-like [Musa acuminata 
subsp. malaccensis]
Length=997

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH+++ EGLR +VT+PAKLESTTLVF+YGVDLFFT++APS+TYDSLT+DFSYALLL
Sbjct  911  QSYITHSLQVEGLRSMVTIPAKLESTTLVFSYGVDLFFTRIAPSRTYDSLTEDFSYALLL  970

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LV AIF+TW  SE+KEL+EKWR
Sbjct  971  ITIVVLVAAIFVTWALSEKKELKEKWR  997



>ref|NP_001168216.1| hypothetical protein [Zea mays]
 gb|ACN27477.1| unknown [Zea mays]
Length=200

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LR IV++PAKLEST +VF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  115  QSFVTHSHQVEALRAIVSIPAKLEST-IVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  173

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AI  TWIWSE+KEL++KWR
Sbjct  174  ITIAVLVAAIIGTWIWSEKKELRDKWR  200



>ref|XP_011019630.1| PREDICTED: ER membrane protein complex subunit 1-like [Populus 
euphratica]
Length=985

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ K EGLRGIVTVPAKLES TLVF YGVDLFFT+LAPS+TYDSLT+DFSYALLL
Sbjct  899  QSYVTHSHKVEGLRGIVTVPAKLESNTLVFTYGVDLFFTRLAPSRTYDSLTEDFSYALLL  958

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALVVAIF+TW+ S++K+L +KWR
Sbjct  959  ITIVALVVAIFVTWVLSKKKDLSDKWR  985



>ref|XP_010668174.1| PREDICTED: ER membrane protein complex subunit 1 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLRG+++VPAKLESTTLVFAYG DLF T+LAPS+TYDSLT+DFSYALLL
Sbjct  897  QSYITHSLKVEGLRGLLSVPAKLESTTLVFAYGADLFLTRLAPSRTYDSLTEDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            LTIV LV AIF+TWI SE+K+L++KWR
Sbjct  957  LTIVVLVAAIFVTWILSERKDLRDKWR  983



>ref|XP_010541259.1| PREDICTED: ER membrane protein complex subunit 1 [Tarenaya hassleriana]
Length=983

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+YVTH++K EGLRGIVT PAKLEST+ VFAYG+D+F+T+LAPS+TYDSLTDDFSYALLL
Sbjct  897  QTYVTHSLKVEGLRGIVTEPAKLESTSHVFAYGMDIFYTRLAPSRTYDSLTDDFSYALLL  956

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALVVAI++TW+ SE+KEL++KWR
Sbjct  957  ITIVALVVAIYVTWVLSEKKELRDKWR  983



>ref|XP_010419729.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ + EGL+GIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  892  QSYVTHSHRVEGLKGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  951

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW  SE+KEL EKWR
Sbjct  952  ITIVALVAAIYITWALSEKKELSEKWR  978



>ref|XP_010453205.1| PREDICTED: ER membrane protein complex subunit 1-like [Camelina 
sativa]
Length=978

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+ + EGL+GIVT P+KLESTT VFAYGVDLF+T+LAPSKTYDSLTDDFSYALLL
Sbjct  892  QSYVTHSHRVEGLKGIVTAPSKLESTTHVFAYGVDLFYTRLAPSKTYDSLTDDFSYALLL  951

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW  SE+KEL EKWR
Sbjct  952  ITIVALVAAIYITWALSEKKELSEKWR  978



>emb|CDX85707.1| BnaA02g01060D [Brassica napus]
Length=942

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH++K EGLR IVT PAKLESTT VFAYGVDLF+ +LAPSKTYDSLTDDFSYALLL
Sbjct  856  QSYITHSLKVEGLRCIVTAPAKLESTTYVFAYGVDLFYKRLAPSKTYDSLTDDFSYALLL  915

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AI+ITW+  E+KEL EKWR
Sbjct  916  ITIVALVAAIYITWVVLEKKELSEKWR  942



>ref|XP_008648064.1| PREDICTED: uncharacterized protein LOC100381974 isoform X1 [Zea 
mays]
 gb|AFW77478.1| hypothetical protein ZEAMMB73_969683 [Zea mays]
Length=988

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VTH+ + E LR IV++PAKLEST +VF YGVDLF+TQLAPS+TYDSLTD+FSYALLL
Sbjct  903  QSFVTHSHQVEALRAIVSIPAKLEST-IVFTYGVDLFYTQLAPSRTYDSLTDEFSYALLL  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TI  LV AI  TWIWSE+KEL++KWR
Sbjct  962  ITIAVLVAAIIGTWIWSEKKELRDKWR  988



>ref|XP_006833394.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
 gb|ERM98672.1| hypothetical protein AMTR_s00109p00121860 [Amborella trichopoda]
Length=976

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSYVTH+V+ EGLRGI T PAKLEST+LVF YGVDLF+T++APS+TYDSLT++FSY+LLL
Sbjct  890  QSYVTHSVRVEGLRGIETFPAKLESTSLVFIYGVDLFYTRIAPSRTYDSLTEEFSYSLLL  949

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIFITW  SE+KEL++KWR
Sbjct  950  ITIVALVAAIFITWRLSEKKELRDKWR  976



>gb|KJB27314.1| hypothetical protein B456_004G290400 [Gossypium raimondii]
Length=982

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH+++ EGL+ I+TV AKLESTTLVFA+G+DLFFT  APS+TYDSLT+DFSYALLL
Sbjct  896  QSYITHSLRVEGLQSIITVAAKLESTTLVFAHGLDLFFTHYAPSRTYDSLTEDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIVALV AIF+TWI S++KELQ++WR
Sbjct  956  ITIVALVAAIFVTWILSQRKELQDRWR  982



>gb|KHG18967.1| Uncharacterized protein F383_07420 [Gossypium arboreum]
Length=982

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH+++ EGL+ I+TV AKLESTTLVFA+G+DLFFT  APS+TYDSLT+DFSYALLL
Sbjct  896  QSYITHSLRVEGLQSIITVAAKLESTTLVFAHGLDLFFTHYAPSRTYDSLTEDFSYALLL  955

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LV AIF+TWI S++KELQ++WR
Sbjct  956  ITIVVLVAAIFVTWILSQRKELQDRWR  982



>ref|XP_002962821.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
 gb|EFJ36284.1| hypothetical protein SELMODRAFT_165412 [Selaginella moellendorffii]
Length=942

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+THA + E LRGI++VPA+LEST LVFAYG+DLFFT+ APS+TYDSLT+DFSYALLL
Sbjct  856  QSYLTHAARVEELRGIISVPARLESTCLVFAYGIDLFFTRTAPSRTYDSLTEDFSYALLL  915

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LVVAI ++ + S++KEL+EKW+
Sbjct  916  ITIVVLVVAIAVSMVLSQRKELREKWK  942



>ref|XP_002965963.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
 gb|EFJ33383.1| hypothetical protein SELMODRAFT_84520 [Selaginella moellendorffii]
Length=942

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+THA + E LRGI++VPA+LEST LVFAYG+DLFFT+ APS+TYDSLT+DFSYALLL
Sbjct  856  QSYLTHAARVEELRGIISVPARLESTCLVFAYGIDLFFTRTAPSRTYDSLTEDFSYALLL  915

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV LVVAI ++ + S++KEL+EKW+
Sbjct  916  ITIVVLVVAIAVSMVLSQRKELREKWK  942



>ref|XP_001765108.1| predicted protein [Physcomitrella patens]
 gb|EDQ70103.1| predicted protein [Physcomitrella patens]
Length=998

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QSY+TH+ + EGLRG++T+PA+LEST+LVFAYG+DLF+T  APSK YDSLT+DFSYALLL
Sbjct  912  QSYLTHSYQVEGLRGLLTIPARLESTSLVFAYGLDLFYTHTAPSKIYDSLTEDFSYALLL  971

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +TIV L ++I +T++ SE++EL EKW+
Sbjct  972  VTIVVLFLSIIVTYVLSERRELAEKWK  998



>emb|CDX78431.1| BnaA03g03430D [Brassica napus]
Length=147

 Score = 72.8 bits (177),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPS  409
            QSYVTH++K EGLRGIVT PAKLESTT VFAY VDLF+T+LA S
Sbjct  55   QSYVTHSLKVEGLRGIVTAPAKLESTTHVFAYEVDLFYTRLACS  98


 Score = 34.3 bits (77),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = -3

Query  421  ACSFKDL*FSNGRLQLCSASPYYCCTCSGYFHNMDLVRAERAAGEVEMS  275
            ACSFKDL  ++ R QL ++  Y C     Y H++   R E    ++E++
Sbjct  96   ACSFKDLRLADRRFQLRTSLDYDCSPRCSYIHHLIPFREEGTKRKIEVT  144



>gb|AAW25613.1| SJCHGC05873 protein [Schistosoma japonicum]
Length=108

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            QS +T+      +R I T P  LEST LVFAYG+DLFFT+++PS+TYD L +DF Y
Sbjct  22   QSMITYNQSVMRIRAIRTAPTGLESTGLVFAYGLDLFFTRISPSQTYDLLKEDFDY  77



>emb|CDS34284.1| protein of unknown function DUF1620 [Hymenolepis microstoma]
Length=979

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -1

Query  510  EGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvai  331
            E ++ I T P+ LEST+LVFA+G+DLFFT++APSKTYD L DDF Y  +   ++ + +A 
Sbjct  903  ERIKRIHTAPSGLESTSLVFAHGLDLFFTRIAPSKTYDMLRDDFDYLFIATIVIGMAIAS  962

Query  330  fiTWIWSEQKELQEKWR  280
             +   ++ +KEL + WR
Sbjct  963  IVARSFAARKELAKAWR  979



>ref|XP_003082510.1| PQQ enzyme repeat-containing protein (ISS) [Ostreococcus tauri]
Length=884

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            QS++TH    + LRGI+T PA LES   VFAYG+D+F+ ++ PS ++D+L DDF++
Sbjct  798  QSWITHREVVKRLRGIITAPADLESNVHVFAYGLDMFYARITPSASFDALDDDFNF  853



>gb|KDQ23663.1| hypothetical protein PLEOSDRAFT_1086136 [Pleurotus ostreatus 
PC15]
Length=1000

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
            ++H  +   +R IVT PA LEST+LVFAYG+DLFFT++APS T+D L ++F+   L++T+
Sbjct  916  LSHNYEVANVRRIVTAPALLESTSLVFAYGLDLFFTRVAPSNTFDVLNENFNKGQLVVTV  975

Query  351  valvvaifiTWIWSEQKELQEKW  283
              L VAI +T    ++K L+E+W
Sbjct  976  TGLAVAIMVTRPMVKRKRLRERW  998



>gb|AIG55856.1| secreted protein [Achlya hypogyna]
Length=954

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ V+H     GLR IV+ PA LEST+L FAYG+DL++ +LAP+  +D L  DF+Y LLL
Sbjct  868  QAMVSHNQTLLGLRAIVSAPANLESTSLTFAYGLDLYYVRLAPANAFDVLPSDFNYELLL  927

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L I   V A + T   +E+K L + W+
Sbjct  928  LLIAGFVGAAYATKSLAERKLLHDAWK  954



>gb|KIM89724.1| hypothetical protein PILCRDRAFT_94960 [Piloderma croceum F 1598]
Length=1066

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             Q  ++H+ +   +R IVT PA LEST+LVFAYG+DLF T+++PS T+D L ++F+ A L+
Sbjct  979   QRVLSHSYQVNNVRRIVTAPALLESTSLVFAYGLDLFLTRVSPSGTFDVLNENFNKAQLV  1038

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             LTIVAL VAI +T    ++K L+E+W
Sbjct  1039  LTIVALAVAIVVTKPMVQRKRLRERW  1064



>ref|XP_001690163.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09901.1| predicted protein [Chlamydomonas reinhardtii]
Length=500

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            S+ T   +  GLR +   P +LEST L+FA+GVDLF+T+LAP+K +DSL DDF+YALL+ 
Sbjct  415  SFATLDKQVLGLRAVTVEPTRLESTCLMFAHGVDLFYTRLAPAKGFDSLEDDFNYALLIA  474

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
             +VAL V   I    ++Q +L  KW+
Sbjct  475  ALVALSVGAVIMNYMTKQAQLAWKWK  500



>ref|XP_009548280.1| hypothetical protein HETIRDRAFT_435076 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79718.1| hypothetical protein HETIRDRAFT_435076 [Heterobasidion irregulare 
TC 32-1]
Length=998

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
            ++H  +   +R I+T P++LEST+LVFAYG+DLFFT++APS T+D L+D F+   L+LT+
Sbjct  914  LSHNYEVANIRHILTSPSQLESTSLVFAYGLDLFFTRVAPSGTFDVLSDSFNKVQLVLTV  973

Query  351  valvvaifiTWIWSEQKELQEKW  283
              L +AI IT    ++K L+E+W
Sbjct  974  CGLAIAIMITKPMVQKKRLRERW  996



>gb|KIM42028.1| hypothetical protein M413DRAFT_445212 [Hebeloma cylindrosporum 
h7]
Length=1010

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H      ++GIVT PA LEST+LVFA+G+DLF T++APS T+D L ++F+   L+ T+
Sbjct  926   LSHNYDVANVKGIVTSPALLESTSLVFAFGLDLFITRIAPSNTFDVLNENFNKVQLVFTV  985

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L++AI IT    E+K L+EKW
Sbjct  986   SGLLLAILITRPMVERKRLREKW  1008



>gb|EUB58619.1| hypothetical protein EGR_06502 [Echinococcus granulosus]
Length=610

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
            +++ +  E ++ I T P+ LEST+LVFA+G+DLFFT++APSKTYD L DDF Y  + + +
Sbjct  527  ISYNLTLERIQRIYTAPSGLESTSLVFAHGLDLFFTRIAPSKTYDMLRDDFDYYFISMIV  586

Query  351  valvvaifiTWIWSEQKELQEKWR  280
            V + VA ++T  ++ ++EL   W+
Sbjct  587  VGMTVASYVTKHFATRRELARAWQ  610



>emb|CEG00025.1| ER membrane protein complex subunit 1 [Ostreococcus tauri]
Length=992

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            QS++TH    + LRGI+T PA LES   VFAYG+D+F+ ++ PS ++D+L DDF++
Sbjct  906  QSWITHREVVKRLRGIITAPADLESNVHVFAYGLDMFYARITPSASFDALDDDFNF  961



>ref|XP_002113501.1| hypothetical protein TRIADDRAFT_37902 [Trichoplax adhaerens]
 gb|EDV23975.1| hypothetical protein TRIADDRAFT_37902 [Trichoplax adhaerens]
Length=587

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -1

Query  510  EGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             GLR IVT PA LEST+LVFAYG+DLF+T++ PSK +D L +DF Y
Sbjct  511  NGLRKIVTAPAGLESTSLVFAYGLDLFYTRVTPSKMFDVLKEDFDY  556



>ref|XP_001420893.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99186.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=398

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            S+VTH     GLRG+VT PA+LES+    A+G+DLF+ ++ PS+++D+L DDF+Y
Sbjct  313  SWVTHKRVVHGLRGLVTAPAELESSIHFVAHGLDLFYARITPSQSFDALDDDFNY  367



>gb|KIY53056.1| DUF1620-domain-containing protein [Fistulina hepatica ATCC 64428]
Length=1001

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            +  V+HA K   + G++T PA LEST+L+FAYG+DLF T++APS T+D L+++F+ A L+
Sbjct  915  RRIVSHAWKISSVNGLLTSPALLESTSLIFAYGLDLFVTRVAPSNTFDLLSENFNKAQLV  974

Query  360  ltivalvvaifiTWIWSEQKELQEKW  283
             TI  L  AI IT    ++K+L+E+W
Sbjct  975  FTITGLATAIMITRPMVKRKQLKERW  1000



>ref|XP_002129828.1| PREDICTED: ER membrane protein complex subunit 1 [Ciona intestinalis]
Length=251

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllt  355
            +V++ +  E + GI + PA LEST+LVF  G+D+FFT++ PSK +D L +DF +  + + 
Sbjct  167  FVSYNLSVEKINGIYSSPAALESTSLVFVTGIDIFFTRIQPSKMFDVLKEDFDHMFISIV  226

Query  354  ivalvvaifiTWIWSEQKELQEKWR  280
            ++ + VA  +    S+ K+L++ WR
Sbjct  227  LIGMFVAALVARRMSQIKQLKKSWR  251



>ref|XP_002501994.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63252.1| predicted protein [Micromonas sp. RCC299]
Length=427

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            QS+VT   +   L+GIVT PA LEST L  A+G+D FFT+L PS++YD L ++FSY LL+
Sbjct  341  QSWVTTRHQVAKLQGIVTSPASLESTVLFVAHGLDFFFTRLHPSRSYDMLDEEFSYLLLV  400

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            +T+VAL    F+T   + +K+++++WR
Sbjct  401  VTMVALAAGAFVTQGLAYKKDMEKRWR  427



>ref|XP_002731135.2| PREDICTED: ER membrane protein complex subunit 1-like, partial 
[Saccoglossus kowalevskii]
Length=954

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            ++Y+ +     G+RG+ T PA LEST+LV  YG+DLF+T++ PSK +D L DDF Y L++
Sbjct  868  EAYINYNKTVLGVRGVQTAPAGLESTSLVLVYGLDLFYTRVFPSKMFDVLKDDFDYYLII  927

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
              ++ L+ A  IT   +  K L++ WR
Sbjct  928  TVVIGLLAASVITQKLASMKTLKKAWR  954



>emb|CDS21066.1| protein of unknown function DUF1620 [Echinococcus granulosus]
Length=1003

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +++ +  E ++ I T P+ LEST+LVFA+G+DLFFT++APSKTYD L DDF Y
Sbjct  920  ISYNLTLERIQRIYTAPSGLESTSLVFAHGLDLFFTRIAPSKTYDMLRDDFDY  972



>emb|CDJ00868.1| protein of unknown function DUF1620 [Echinococcus multilocularis]
 emb|CDS38150.1| protein of unknown function DUF1620 [Echinococcus multilocularis]
Length=1003

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +++ +  E ++ I T P+ LEST+LVFA+G+DLFFT++APSKTYD L DDF Y
Sbjct  920  ISYNLTLERIQRIHTAPSGLESTSLVFAHGLDLFFTRIAPSKTYDMLRDDFDY  972



>gb|KII83787.1| hypothetical protein PLICRDRAFT_147866 [Plicaturopsis crispa 
FD-325 SS-3]
Length=1028

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   +R IVT PA LEST+LVFAYG+DLF T++APS T+D L+++F+   L+LTI
Sbjct  944   LSHDYQVSNVRHIVTSPALLESTSLVFAYGLDLFLTRVAPSGTFDVLSENFNKVQLVLTI  1003

Query  351   valvvaifiTWIWSEQKELQEKW  283
              AL VAI +T     +K L+EKW
Sbjct  1004  SALAVAIMVTKPMVHRKRLREKW  1026



>gb|KIK60871.1| hypothetical protein GYMLUDRAFT_59265 [Gymnopus luxurians FD-317 
M1]
Length=516

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
            ++H       R I+T PA LEST+LVFAYG+DLF T++APS T+D L+++F+   L+LT+
Sbjct  432  LSHDYDVSNTRSIITSPALLESTSLVFAYGLDLFLTRVAPSNTFDVLSENFNKVQLVLTV  491

Query  351  valvvaifiTWIWSEQKELQEKW  283
              L  AIF+T    ++K+L+EKW
Sbjct  492  TGLAAAIFVTRPMVKRKKLREKW  514



>ref|XP_007386867.1| DUF1620-domain-containing protein [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN05678.1| DUF1620-domain-containing protein [Punctularia strigosozonata 
HHB-11173 SS5]
Length=1025

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H    E +R I+T PA LEST+LVFAYG+DLF T+ APSKT+D L ++F+   L+
Sbjct  938   RRVLSHNYDVEKVRRIITSPALLESTSLVFAYGLDLFSTRTAPSKTFDVLNENFNKVQLV  997

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             LTI  L VAIF+T    ++K L+EKW
Sbjct  998   LTITGLAVAIFVTKPMVQRKRLREKW  1023



>gb|EMD34983.1| hypothetical protein CERSUDRAFT_116509 [Ceriporiopsis subvermispora 
B]
Length=1019

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H+ + E +R IVT P+ LEST+LVFA+G+DLFFT++APS T+D L+++F+   L+LT+
Sbjct  935   LSHSYEVEHVRRIVTSPSLLESTSLVFAFGLDLFFTRVAPSDTFDVLSENFNKLQLVLTV  994

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L +AI IT     +K L+E+W
Sbjct  995   AGLGLAIVITKPMVSRKRLRERW  1017



>gb|KIK60873.1| hypothetical protein GYMLUDRAFT_96989 [Gymnopus luxurians FD-317 
M1]
Length=1050

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H       R I+T PA LEST+LVFAYG+DLF T++APS T+D L+++F+   L+LT+
Sbjct  966   LSHNYDVSNTRSIITSPALLESTSLVFAYGLDLFLTRVAPSNTFDVLSENFNKVQLVLTV  1025

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L  AIF+T    ++K+L+EKW
Sbjct  1026  TGLAAAIFVTRPMVKRKKLREKW  1048



>gb|AAZ14939.1| conserved hypothetical protein [Coprinellus disseminatus]
Length=144

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
            ++H     G+R + T PA LEST+LVFA+G+D+F +++APS T D L+  F+ A L+LTI
Sbjct  60   ISHTYDVAGVRQVATAPALLESTSLVFAFGLDMFLSRVAPSGTSDVLSQSFNKAQLVLTI  119

Query  351  valvvaifiTWIWSEQKELQEKW  283
              L +AI +T    ++K L+EKW
Sbjct  120  TGLAIAIVVTRPMVQRKRLREKW  142



>gb|KDO31298.1| hypothetical protein SPRG_03914 [Saprolegnia parasitica CBS 223.65]
Length=958

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            S V+H    + L  IV+ PA LEST+L FA+G+DL++ +LAP+  +D L  DF+Y LLLL
Sbjct  873  SMVSHNQTLQKLEAIVSAPANLESTSLTFAFGLDLYYVRLAPANAFDVLPSDFNYELLLL  932

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
             I   V   + T + +E+K L E+W+
Sbjct  933  LIAGFVGGAYGTKLLAERKLLHEQWK  958



>ref|XP_008613467.1| hypothetical protein SDRG_09320 [Saprolegnia diclina VS20]
 gb|EQC33344.1| hypothetical protein SDRG_09320 [Saprolegnia diclina VS20]
Length=958

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            S V+H      L+ IV+ PA LEST+L FA+G+DL++ +LAP+  +D L  DF+Y LLLL
Sbjct  873  SMVSHNQTLHKLQAIVSAPANLESTSLTFAFGLDLYYVRLAPANAFDVLPSDFNYELLLL  932

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
             I   V   + T + +E+K L E+W+
Sbjct  933  LIAGFVGGAYGTKLLAERKLLHEQWK  958



>ref|XP_003057541.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59186.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1081

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             QS+VT   +   LRGI T PA LEST L  A+G+D F+T+L PS+++D+L D+FSY LL+
Sbjct  995   QSWVTTRHQVARLRGIKTAPASLESTVLCVAHGLDFFYTRLHPSRSFDTLDDEFSYLLLI  1054

Query  360   ltivalvvaifiTWIWSEQKELQEKWR  280
              T+ AL V  F+T   +  K+L  KW+
Sbjct  1055  ATLAALAVGAFVTHGMAYSKDLSRKWK  1081



>gb|KIP12195.1| hypothetical protein PHLGIDRAFT_62449 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=1011

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++HA +  G+RG++  PA LEST+LVFA+G+DLF +++APS T+D L++ F+   L++T+
Sbjct  927   LSHAYRVHGVRGLLASPALLESTSLVFAHGLDLFASRVAPSGTFDVLSESFNKPQLVVTL  986

Query  351   valvvaifiTWIWSEQKELQEKW  283
              AL +AI IT     +K+L+E+W
Sbjct  987   AALALAIVITKPMVARKKLRERW  1009



>gb|ESA11291.1| hypothetical protein GLOINDRAFT_191595 [Rhizophagus irregularis 
DAOM 181602]
Length=600

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  507  GLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            G+R I+T PA LEST+LV AYG+DL+FT+ APSKT+D L++DFS
Sbjct  525  GIRHIITSPALLESTSLVLAYGLDLWFTREAPSKTFDVLSEDFS  568



>ref|XP_001879910.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR09561.1| predicted protein [Laccaria bicolor S238N-H82]
Length=1008

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   ++ IVT PA LEST+LVFA+G+D+F T++APS T+D L+++F+ A L+ T+
Sbjct  924   LSHNYEVANVQRIVTAPALLESTSLVFAFGLDMFLTRVAPSNTFDVLSENFNKAQLVFTV  983

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L++AI IT    E+K L+EKW
Sbjct  984   SGLLLAIMITRPMVERKRLREKW  1006



>ref|XP_009822483.1| hypothetical protein H257_01127 [Aphanomyces astaci]
 gb|ETV87620.1| hypothetical protein H257_01127 [Aphanomyces astaci]
Length=968

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            + VT+     G+R +VT PA LEST+L FAYG+DL++ +LAP+  +D L  DF++ LLLL
Sbjct  883  NMVTYNQTIRGIRRLVTAPALLESTSLTFAYGLDLYYVRLAPANAFDVLPSDFNFELLLL  942

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
              +  +   ++T + +++KEL + W+
Sbjct  943  LCLGFIGGAYLTSVLADRKELHDAWK  968



>ref|XP_002428345.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB15607.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=899

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            ++ + H      +RG+ T  + LEST LVF YG+D+F+T++APSKT+D L DDF Y L+ 
Sbjct  813  EAIINHNQSVYNVRGMHTSSSGLESTCLVFVYGLDIFYTRVAPSKTFDLLKDDFDYYLIT  872

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L +VAL +  +++   + +K L++ W+
Sbjct  873  LVLVALTIVSYVSKKLASRKALRQAWK  899



>emb|CCD74813.1| hypothetical protein Smp_003340 [Schistosoma mansoni]
Length=1085

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             Q+ +T+      +R I T P  LEST LVFAYG+DLFFT+++PS+TYD L +DF Y
Sbjct  999   QAIITYNQSIMRIRAIRTAPTGLESTGLVFAYGLDLFFTRISPSQTYDLLKEDFDY  1054



>ref|XP_007306452.1| DUF1620-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM84301.1| DUF1620-domain-containing protein [Stereum hirsutum FP-91666 
SS1]
Length=1039

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H  +   +R ++T PA LEST+LVFAYG+DLFFT++ PS T+D L+++F+   L+
Sbjct  952   RRVLSHTYEVANVRQVLTSPALLESTSLVFAYGLDLFFTRVTPSGTFDILSENFNKVQLV  1011

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             LTI  L VAI +T    E+K L+E+W
Sbjct  1012  LTITGLAVAIIVTKPMVERKRLRERW  1037



>gb|KGB32850.1| ER membrane protein complex subunit 1 [Schistosoma haematobium]
Length=1043

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             Q+ +T+      +R I T P  LEST LVFAYG+DLFFT+++PS+TYD L +DF Y
Sbjct  957   QAMITYNQSIMRIRAIRTAPTGLESTGLVFAYGLDLFFTRISPSQTYDLLKEDFDY  1012



>ref|XP_003244708.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Acyrthosiphon 
pisum]
Length=896

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y ++++    L+++ ++T 
Sbjct  824  GIYTTPSSLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDYLVIIIVTTILLISAYVTK  883

Query  318  IWSEQKELQEKWR  280
              + QK L++ W+
Sbjct  884  NLASQKALKQAWK  896



>ref|XP_008183329.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Acyrthosiphon 
pisum]
Length=904

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y ++++    L+++ ++T 
Sbjct  832  GIYTTPSSLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDYLVIIIVTTILLISAYVTK  891

Query  318  IWSEQKELQEKWR  280
              + QK L++ W+
Sbjct  892  NLASQKALKQAWK  904



>gb|KIK01760.1| hypothetical protein K443DRAFT_550803 [Laccaria amethystina LaAM-08-1]
Length=1008

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   ++ IVT PA LEST+LVFA+G+D+F T++APS T+D L+++F+ A L+ T+
Sbjct  924   LSHDYEVANVQRIVTAPALLESTSLVFAFGLDMFLTRVAPSNTFDVLSENFNKAQLVFTV  983

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L++AI IT    E+K L+EKW
Sbjct  984   SGLLLAIMITRPMVERKRLREKW  1006



>ref|XP_008861519.1| hypothetical protein H310_00483 [Aphanomyces invadans]
 gb|ETW10108.1| hypothetical protein H310_00483 [Aphanomyces invadans]
Length=973

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallll  358
            + +T+      +R IVT PA LEST+L FAYG+DLF+ +LAP+  +D L  DF++ LLLL
Sbjct  888  NMITYNQTVVNIRRIVTAPALLESTSLTFAYGLDLFYVRLAPANAFDVLPSDFNFELLLL  947

Query  357  tivalvvaifiTWIWSEQKELQEKWR  280
               A +V  + T + +++KEL + W+
Sbjct  948  LCFAFIVGAYFTSVLADRKELHDAWK  973



>gb|EPS99972.1| hypothetical protein FOMPIDRAFT_1163474 [Fomitopsis pinicola 
FP-58527 SS1]
Length=1005

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H  +  G + I+T PA LEST+LVFAYG DLFFT++APS T+D L++ F+ A L+
Sbjct  918   KRVLSHRYEVIGTKHIITSPALLESTSLVFAYGHDLFFTRIAPSNTFDVLSESFNKAQLV  977

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             LTI  L +AI IT     +K L+E+W
Sbjct  978   LTIAGLALAIIITKPMVRRKRLRERW  1003



>emb|CDP95566.1| Protein Bm4655, isoform b [Brugia malayi]
Length=944

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            + ++ +     G+RG  T P+ LEST+L+ AYG DLFFTQL PS T+D L DDF +
Sbjct  858  EDFINYNQSIHGIRGFKTSPSGLESTSLMLAYGTDLFFTQLTPSGTFDILKDDFDH  913



>ref|XP_001900843.1| PQQ enzyme repeat family protein [Brugia malayi]
Length=944

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            + ++ +     G+RG  T P+ LEST+L+ AYG DLFFTQL PS T+D L DDF +
Sbjct  858  EDFINYNQSIHGIRGFKTSPSGLESTSLMLAYGTDLFFTQLTPSGTFDILKDDFDH  913



>ref|XP_007854548.1| duf1620 domain-containing protein [Moniliophthora roreri MCA 
2997]
 gb|ESK86134.1| duf1620 domain-containing protein [Moniliophthora roreri MCA 
2997]
Length=1034

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   +R I+T P+ LEST+LVFAYG+DLF T++APSKT+D L++ F+   L++TI
Sbjct  950   LSHNYEVAQVRHIITAPSLLESTSLVFAYGLDLFCTRVAPSKTFDVLSESFNKTQLVITI  1009

Query  351   valvvaifiTWIWSEQKELQEKW  283
             +ALVVAI        +K+L+EKW
Sbjct  1010  LALVVAIMFAKPAVRRKKLKEKW  1032



>gb|KJA26496.1| hypothetical protein HYPSUDRAFT_132623 [Hypholoma sublateritium 
FD-334 SS-4]
Length=1009

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H      ++ I+T PA LEST+LVFAYG+D+F T++APS T+D L+++F+   L+
Sbjct  922   RRVLSHNYDVANVQRIITSPALLESTSLVFAYGLDMFLTRVAPSNTFDVLSENFNKVQLV  981

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             +TI  L++AI +T    ++K+L+EKW
Sbjct  982   ITITGLLIAILVTRPMVQRKKLREKW  1007



>emb|CDO75706.1| hypothetical protein BN946_scf184493.g4 [Trametes cinnabarina]
Length=852

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++H  +    R IVT PA LEST+LVFAYG+DLFFT++APS T+D L+++F+
Sbjct  768  LSHNYQVAKTRRIVTSPALLESTSLVFAYGLDLFFTRIAPSNTFDVLSENFN  819



>emb|CDS09359.1| hypothetical protein LRAMOSA10719 [Absidia idahoensis var. thermophila]
Length=983

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            Q ++T+  +  G++ I+T PA LEST+LVFAYG+D FFTQ +PS+ +D L++DFS
Sbjct  897  QMFLTYNREVFGIKRILTSPALLESTSLVFAYGLDTFFTQSSPSRQFDVLSEDFS  951



>gb|KIK39148.1| hypothetical protein CY34DRAFT_808626 [Suillus luteus UH-Slu-Lm8-n1]
Length=1007

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   +R IVT P+ LEST+L+F YG+DLFFT+++PS T+D L+++F+   L+LT+
Sbjct  924   LSHNYEVANVRRIVTSPSLLESTSLIFVYGLDLFFTRISPSGTFDVLSENFNKVQLVLTV  983

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L +AI +T     +K L+E+W
Sbjct  984   AGLGIAIMVTKPMVRRKRLRERW  1006



>ref|XP_007775044.1| DUF1620-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW74996.1| DUF1620-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=1040

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   +R IVT P+ LESTTLVFA+G+DLF T++APS T+D L++ F+   L+LTI
Sbjct  956   LSHNYEVANVRQIVTAPSLLESTTLVFAFGLDLFCTRIAPSNTFDVLSEGFNKVQLVLTI  1015

Query  351   valvvaifiTWIWSEQKELQEKW  283
             + L VAI IT     +K L+E+W
Sbjct  1016  LGLTVAIAITKPMVRRKRLRERW  1038



>emb|CDH61324.1| duf1620-domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=982

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            Q ++T+  +  G++ I+T PA LEST+LVFAYG+D FFTQ +PS+ +D L++DFS
Sbjct  896  QMFLTYNREVFGIKRILTSPALLESTSLVFAYGLDTFFTQSSPSRQFDVLSEDFS  950



>emb|CEP08079.1| hypothetical protein [Parasitella parasitica]
Length=986

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +   G++ I+T P+ LEST LVFAYG+D FFT+ +PSK +D L++DFS
Sbjct  902  FLTYGLDVAGVKSIITSPSLLESTALVFAYGLDSFFTRSSPSKQFDVLSEDFS  954



>ref|XP_004333139.1| hypothetical protein ACA1_387250 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11126.1| hypothetical protein ACA1_387250 [Acanthamoeba castellanii str. 
Neff]
Length=1008

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -1

Query  507   GLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaif  328
             GLRGI T P  LEST+LVFA+GVDLF+T++ PS  +D L +DF Y  LL T++A+VV   
Sbjct  933   GLRGIQTAPTYLESTSLVFAWGVDLFYTRVTPSGAFDMLNEDFEYYPLLATVIAVVVLTV  992

Query  327   iTWIWSEQKELQEKWR  280
             +T      K+L+E W+
Sbjct  993   VTSFLVASKKLREAWQ  1008



>dbj|GAN10947.1| DUF1620-domain-containing protein [Mucor ambiguus]
Length=986

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +   G++ I+T P+ LEST LVFAYG+D FFT+ +PSK +D L++DFS
Sbjct  902  FLTYGLDVAGVKSIITSPSLLESTALVFAYGIDSFFTRSSPSKQFDVLSEDFS  954



>gb|EPB91074.1| hypothetical protein HMPREF1544_02143 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=985

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +   G++ I+T P+ LEST LVFAYG+D FFT+ +PSK +D L++DFS
Sbjct  901  FLTYGLDVAGVKSIITSPSLLESTALVFAYGIDSFFTRSSPSKQFDVLSEDFS  953



>ref|XP_005645637.1| DUF1620-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21093.1| DUF1620-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=484

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q + TH      LRGI + PA LEST    A G+DL+ T++ PSKT+D L +DF +ALL+
Sbjct  398  QLFATHDRLVANLRGIDSAPANLESTCFALARGLDLYLTRVQPSKTFDLLPEDFPFALLV  457

Query  360  ltivalvvaifiTWIWSEQKELQEKW  283
               + ++ A       SE+  L++KW
Sbjct  458  AITLTMIGASIALKYMSERASLKQKW  483



>ref|XP_007314994.1| hypothetical protein SERLADRAFT_446202 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO28795.1| hypothetical protein SERLADRAFT_446202 [Serpula lacrymans var. 
lacrymans S7.9]
Length=1009

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             V+H  +   +  IVT P+ LEST+LVF +G+DLFFT+ APS T+D L+++F+   L+LTI
Sbjct  925   VSHNYEVANVNRIVTAPSLLESTSLVFVHGLDLFFTRTAPSNTFDVLSENFNKVQLVLTI  984

Query  351   valvvaifiTWIWSEQKELQEKW  283
             V L  AI +T     +K L+E+W
Sbjct  985   VGLATAIIVTRPMMRRKRLRERW  1007



>gb|KDQ54694.1| hypothetical protein JAAARDRAFT_182191 [Jaapia argillacea MUCL 
33604]
Length=1029

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +    + I+T PA LEST+LVFAYG+D+FFT+++PS T+D L+++F+   L+LTI
Sbjct  945   LSHNYQVANTQRIITSPALLESTSLVFAYGLDMFFTRVSPSGTFDVLSENFNKLQLVLTI  1004

Query  351   valvvaifiTWIWSEQKELQEKW  283
              AL +AI IT     +K L+EKW
Sbjct  1005  GALALAIVITKPMVRRKRLREKW  1027



>gb|EGO03055.1| hypothetical protein SERLA73DRAFT_103134 [Serpula lacrymans var. 
lacrymans S7.3]
Length=1009

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             V+H  +   +  IVT P+ LEST+LVF +G+DLFFT+ APS T+D L+++F+   L+LTI
Sbjct  925   VSHNYEVANVNRIVTAPSLLESTSLVFVHGLDLFFTRTAPSNTFDVLSENFNKVQLVLTI  984

Query  351   valvvaifiTWIWSEQKELQEKW  283
             V L  AI +T     +K L+E+W
Sbjct  985   VGLATAIIVTRPMMRRKRLRERW  1007



>ref|XP_011168484.1| PREDICTED: ER membrane protein complex subunit 1-like [Solenopsis 
invicta]
Length=145

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  73   GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  114



>ref|XP_002632207.1| Hypothetical protein CBG07074 [Caenorhabditis briggsae]
Length=948

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST+LV AYG DLFFT+L PS T+D L DDF +
Sbjct  874  VRGIKTSPSGLESTSLVLAYGTDLFFTRLVPSGTFDILKDDFDH  917



>ref|XP_001664165.1| AAEL003785-PA [Aedes aegypti]
 gb|EAT44875.1| AAEL003785-PA [Aedes aegypti]
Length=917

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            ++GI T P+ LEST LVF +G+D+F T++APSKT+D L +DF Y L+ + ++ L    ++
Sbjct  843  IKGIHTAPSGLESTCLVFVHGLDIFVTRVAPSKTFDLLKEDFDYFLITVVLILLTSTSYV  902

Query  324  TWIWSEQKELQEKWR  280
              I++ +K +++ W+
Sbjct  903  VKIFASKKVIKQAWK  917



>ref|XP_001989854.1| GH19025 [Drosophila grimshawi]
 gb|EDV92916.1| GH19025 [Drosophila grimshawi]
Length=917

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            ++Y+ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y L+ 
Sbjct  831  ENYINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDYILIS  890

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            + +V L     I    S +K L++ W+
Sbjct  891  IVLVVLTSGSLIVRHLSSRKLLKQAWK  917



>ref|XP_008550454.1| PREDICTED: ER membrane protein complex subunit 1 [Microplitis 
demolitor]
Length=925

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVFA+G+DLF+T++APSKT+D L +DF Y
Sbjct  853  GIYTSPSGLESTCLVFAHGIDLFYTRVAPSKTFDVLKEDFDY  894



>ref|XP_003105800.1| hypothetical protein CRE_17862 [Caenorhabditis remanei]
 gb|EFO99208.1| hypothetical protein CRE_17862 [Caenorhabditis remanei]
Length=946

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST+LV AYG DLFFT+L PS T+D L DDF +
Sbjct  872  VRGIKTSPSGLESTSLVLAYGTDLFFTRLVPSGTFDILKDDFDH  915



>pir||T32814 hypothetical protein H17B01.4 - Caenorhabditis elegans
Length=997

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST+LV AYG DLFFT+L PS T+D L DDF +
Sbjct  923  VRGIKTSPSGLESTSLVLAYGTDLFFTRLVPSGTFDILKDDFDH  966



>gb|EGT52693.1| hypothetical protein CAEBREN_25452 [Caenorhabditis brenneri]
Length=952

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST+LV AYG DLFFT+L PS T+D L DDF +
Sbjct  878  VRGIKTSPSGLESTSLVLAYGTDLFFTRLVPSGTFDILKDDFDH  921



>ref|NP_493980.1| Protein EMC-1, isoform a [Caenorhabditis elegans]
 emb|CCD72387.1| EMC-1, isoform a [Caenorhabditis elegans]
Length=946

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST+LV AYG DLFFT+L PS T+D L DDF +
Sbjct  872  VRGIKTSPSGLESTSLVLAYGTDLFFTRLVPSGTFDILKDDFDH  915



>gb|KIM65686.1| hypothetical protein SCLCIDRAFT_444798 [Scleroderma citrinum 
Foug A]
Length=1033

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +   +R IVTVP++LEST+LV A G+DLF T++APS T+D L+++F+ A L+LTI
Sbjct  947   LSHKYEVANVRQIVTVPSRLESTSLVLALGLDLFLTRVAPSGTFDVLSENFNKAQLVLTI  1006

Query  351   valvvaifiTWIWSEQKELQEKW  283
               LVVA+ +      +K+L+E+W
Sbjct  1007  GGLVVAVLVVRPIVARKKLKERW  1029



>ref|XP_002170353.2| PREDICTED: ER membrane protein complex subunit 1-like [Hydra 
vulgaris]
Length=993

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            + ++ + +  E +RGI T  A LEST+LV AYG+DL+FT++ PS+ +D L +DF Y
Sbjct  907  KGFINYNMTVEKIRGIHTASAGLESTSLVLAYGLDLYFTRVMPSRMFDVLKEDFDY  962



>ref|XP_011453664.1| PREDICTED: ER membrane protein complex subunit 1-like [Crassostrea 
gigas]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  507  GLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             ++GI T PA LEST+LV +YG+DL+FT++ PSK +D L +DF Y
Sbjct  28   NVQGIHTSPAGLESTSLVLSYGLDLYFTRVQPSKMFDVLKEDFDY  72



>gb|EFX81955.1| hypothetical protein DAPPUDRAFT_211018 [Daphnia pulex]
Length=500

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -1

Query  507  GLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaif  328
             ++ I   P+ LEST +VFAYG+D+FFT + PS+T+D L DDF Y  + L +  L +A F
Sbjct  425  NIKKIHVTPSSLESTAMVFAYGLDIFFTHVTPSRTFDVLNDDFEYGFIALVLTGLTLASF  484

Query  327  iTWIWSEQKELQEKWR  280
            IT   + +K L++ W+
Sbjct  485  ITKRLASKKSLRQAWK  500



>ref|XP_004923563.1| PREDICTED: ER membrane protein complex subunit 1-like [Bombyx 
mori]
Length=913

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            L  I T P+ LEST+LV A G+DLF+T++APSKT+D L DDF Y L+ + + ALV+A + 
Sbjct  839  LTRIHTAPSGLESTSLVLATGLDLFYTRIAPSKTFDLLKDDFDYYLISVVLAALVLATYS  898

Query  324  TWIWSEQKELQEKWR  280
            T  ++ +K L+  W+
Sbjct  899  TKYFAARKMLKMAWK  913



>ref|XP_004345642.2| hypothetical protein CAOG_06052 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95619.1| hypothetical protein CAOG_006052 [Capsaspora owczarzaki ATCC 
30864]
Length=1020

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            LRGI T PA LES +LVFA+GVD+F T++ PSKT+D L +DF++
Sbjct  946  LRGIHTGPAALESASLVFAHGVDIFHTRVHPSKTFDVLNEDFNF  989



>gb|KDR78137.1| hypothetical protein GALMADRAFT_94668 [Galerina marginata CBS 
339.88]
Length=1011

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H      ++ IVT PA LEST+LVFA+G+D+F T++APS T+D L+++F+   L+
Sbjct  923   RRVLSHNYDVANVQKIVTSPALLESTSLVFAFGLDMFLTRVAPSNTFDVLSENFNKVQLV  982

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
              T+  L++AI IT    ++K L+EKW
Sbjct  983   FTVSGLLLAILITRPMVKRKGLREKW  1008



>ref|XP_011347663.1| PREDICTED: ER membrane protein complex subunit 1 isoform X4 [Cerapachys 
biroi]
 gb|EZA48852.1| hypothetical protein X777_12768 [Cerapachys biroi]
Length=923

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y
Sbjct  851  GIHTSPSGLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDY  892



>ref|XP_011347662.1| PREDICTED: ER membrane protein complex subunit 1 isoform X3 [Cerapachys 
biroi]
Length=930

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y
Sbjct  858  GIHTSPSGLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDY  899



>ref|XP_011347660.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Cerapachys 
biroi]
Length=941

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y
Sbjct  869  GIHTSPSGLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDY  910



>ref|XP_011347659.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Cerapachys 
biroi]
Length=948

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF YG+DLF+T++APSKT+D L +DF Y
Sbjct  876  GIHTSPSGLESTCLVFVYGLDLFYTRVAPSKTFDVLKEDFDY  917



>ref|XP_011303674.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Fopius 
arisanus]
Length=922

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVFA+G+DLF+T++APSKT+D L +DF Y
Sbjct  850  GIHTSPSGLESTCLVFAHGLDLFYTRVAPSKTFDVLKEDFDY  891



>ref|XP_001864835.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS40798.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=911

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            +RGI T P+ LES+ LVF +G+D+F T++APSKT+D L +DF Y ++   +V L    ++
Sbjct  837  MRGIHTAPSGLESSCLVFVHGLDIFVTRVAPSKTFDLLKEDFDYLMITTVLVLLTSVSYV  896

Query  324  TWIWSEQKELQEKWR  280
               ++ +K +++ W+
Sbjct  897  VKHFASKKAIKQAWK  911



>ref|XP_011054864.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Acromyrmex 
echinatior]
Length=921

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++T 
Sbjct  849  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYVTK  908

Query  318  IWSEQKELQEKWR  280
              + QK  ++ W+
Sbjct  909  KLASQKAQKQAWK  921



>ref|XP_011054863.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Acromyrmex 
echinatior]
Length=928

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++T 
Sbjct  856  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYVTK  915

Query  318  IWSEQKELQEKWR  280
              + QK  ++ W+
Sbjct  916  KLASQKAQKQAWK  928



>ref|XP_011303673.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Fopius 
arisanus]
Length=929

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVFA+G+DLF+T++APSKT+D L +DF Y
Sbjct  857  GIHTSPSGLESTCLVFAHGLDLFYTRVAPSKTFDVLKEDFDY  898



>ref|XP_007865560.1| DUF1620-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ55571.1| DUF1620-domain-containing protein [Gloeophyllum trabeum ATCC 
11539]
Length=1003

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             ++ ++H  +   ++ ++T PA LEST+LVFAYG+DLF T++ PS T+D L+++F+ A L+
Sbjct  916   RAVLSHNYQVANVQRVITSPALLESTSLVFAYGLDLFHTRVTPSGTFDVLSENFNKAQLV  975

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
              T+  L+ AI IT    ++K+L+E+W
Sbjct  976   FTVGGLLAAIIITKPMVQRKKLRERW  1001



>ref|XP_009048195.1| hypothetical protein LOTGIDRAFT_238345, partial [Lottia gigantea]
 gb|ESP01145.1| hypothetical protein LOTGIDRAFT_238345, partial [Lottia gigantea]
Length=991

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T PA LEST+L+F YG+DLFFT++ PSK +D L +DF Y
Sbjct  919  GIYTGPAGLESTSLIFTYGLDLFFTRVMPSKMFDVLKEDFDY  960



>ref|XP_011142308.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Harpegnathos 
saltator]
Length=943

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ +IT 
Sbjct  871  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYITK  930

Query  318  IWSEQKELQEKWR  280
              + QK  ++ W+
Sbjct  931  KLASQKAQKQAWK  943



>gb|EFN82684.1| Uncharacterized protein KIAA0090-like protein [Harpegnathos saltator]
Length=922

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ +IT 
Sbjct  850  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYITK  909

Query  318  IWSEQKELQEKWR  280
              + QK  ++ W+
Sbjct  910  KLASQKAQKQAWK  922



>ref|XP_011142310.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Harpegnathos 
saltator]
Length=936

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifiTW  319
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ +IT 
Sbjct  864  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYITK  923

Query  318  IWSEQKELQEKWR  280
              + QK  ++ W+
Sbjct  924  KLASQKAQKQAWK  936



>ref|XP_003385319.1| PREDICTED: ER membrane protein complex subunit 1-like [Amphimedon 
queenslandica]
Length=921

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +R IVT P  LEST+LVFAYG+DL+ T++ PSK +D L +DF Y
Sbjct  847  IRSIVTSPTGLESTSLVFAYGLDLYLTRVTPSKQFDVLAEDFDY  890



>emb|CCX06285.1| Similar to Uncharacterized protein KIAA0090 homolog; acc. no. 
Q6NRB9 [Pyronema omphalodes CBS 100304]
Length=954

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDF  379
            +S +TH  K  GL+ +VT P++LEST++VFAYG DLF T++APS  +D L   F
Sbjct  867  KSIITHKRKVMGLKKVVTTPSQLESTSIVFAYGGDLFGTRVAPSLAFDVLGKGF  920



>ref|XP_007393484.1| hypothetical protein PHACADRAFT_116839 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM58157.1| hypothetical protein PHACADRAFT_116839 [Phanerochaete carnosa 
HHB-10118-sp]
Length=1016

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
             +  ++H  +   +R I+T PA LEST+LVFA+G+DLF T++ PS T+D L+++F+ A L+
Sbjct  929   KRVLSHTYQVANVRAIITSPALLESTSLVFAHGLDLFSTRVTPSNTFDVLSENFNKAQLV  988

Query  360   ltivalvvaifiTWIWSEQKELQEKW  283
             LTI  L +AI IT      K L+E+W
Sbjct  989   LTISGLALAILITKPMVRNKRLRERW  1014



>ref|XP_002902249.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY56921.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=988

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ +T+    E L  I T  A+LESTTLVFA+G+D+F+ ++ P+K++D L  DF++ +L+
Sbjct  902  QAMLTYNRTVENLNSISTAAAELESTTLVFAHGLDMFYVRMTPAKSFDLLPSDFNHEMLI  961

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L  +  +   F T   +++K LQ  W+
Sbjct  962  LLCLTFLAVTFGTKALAQRKALQSAWK  988



>ref|XP_001621302.1| hypothetical protein NEMVEDRAFT_v1g145387 [Nematostella vectensis]
 gb|EDO29202.1| predicted protein, partial [Nematostella vectensis]
Length=400

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            Q+Y+ +      ++GI T P+ LEST LVF YG+DL++ Q+ PS+ +D L +DF Y
Sbjct  314  QAYINYNQTIMYIKGIHTAPSGLESTCLVFGYGLDLYWAQITPSRMFDVLKEDFDY  369



>ref|XP_008901756.1| hypothetical protein PPTG_08786 [Phytophthora parasitica INRA-310]
 gb|ETI52376.1| hypothetical protein F443_04467 [Phytophthora parasitica P1569]
 gb|ETL98822.1| hypothetical protein L917_04184 [Phytophthora parasitica]
 gb|ETN12710.1| hypothetical protein PPTG_08786 [Phytophthora parasitica INRA-310]
 gb|ETP50098.1| hypothetical protein F442_04499 [Phytophthora parasitica P10297]
Length=994

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ +T+    E L  I T  A+LESTTLVFA+G+D+F+ ++ P+K++D L  DF++ +L+
Sbjct  908  QAMLTYNRTVENLNSISTAAAELESTTLVFAHGLDMFYVRMTPAKSFDLLPSDFNHEMLI  967

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L  +  +   F     +++K LQ  W+
Sbjct  968  LLCLTFLAVTFGAKALAQRKALQTAWK  994



>ref|XP_008204908.1| PREDICTED: ER membrane protein complex subunit 1 [Nasonia vitripennis]
Length=925

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++
Sbjct  851  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLSALLISSYV  910

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  911  TKKLASQKVQKQAWK  925



>gb|ETM51987.1| hypothetical protein L914_04285 [Phytophthora parasitica]
Length=994

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ +T+    E L  I T  A+LESTTLVFA+G+D+F+ ++ P+K++D L  DF++ +L+
Sbjct  908  QAMLTYNRTVENLNSISTAAAELESTTLVFAHGLDMFYVRMTPAKSFDLLPSDFNHEMLI  967

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L  +  +   F     +++K LQ  W+
Sbjct  968  LLCLTFLAVTFGAKALAQRKALQTAWK  994



>gb|ETK92263.1| hypothetical protein L915_04340 [Phytophthora parasitica]
 gb|ETO81149.1| hypothetical protein F444_04487 [Phytophthora parasitica P1976]
Length=994

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ +T+    E L  I T  A+LESTTLVFA+G+D+F+ ++ P+K++D L  DF++ +L+
Sbjct  908  QAMLTYNRTVENLNSISTAAAELESTTLVFAHGLDMFYVRMTPAKSFDLLPSDFNHEMLI  967

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L  +  +   F     +++K LQ  W+
Sbjct  968  LLCLTFLAVTFGAKALAQRKALQTAWK  994



>ref|XP_001999872.1| GI22838 [Drosophila mojavensis]
 gb|EDW15333.1| GI22838 [Drosophila mojavensis]
Length=913

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            ++Y+ +      LR I T P+ LEST LV A G+D+F T++APSKT+D L +DF Y L+ 
Sbjct  827  ENYINYNQTVARLRNIYTAPSGLESTCLVVATGLDIFVTRVAPSKTFDLLKEDFDYILIS  886

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            + +V L     I    + +K L++ W+
Sbjct  887  IVLVVLTSGSLIVRHLASRKLLKQAWK  913



>ref|XP_011504565.1| PREDICTED: ER membrane protein complex subunit 1 [Ceratosolen 
solmsi marchali]
Length=930

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + ALV++ +I
Sbjct  856  ISGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALVISSYI  915

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  916  TKKLASQKLQKQAWK  930



>ref|XP_009522565.1| hypothetical protein PHYSODRAFT_328023 [Phytophthora sojae]
 gb|EGZ19848.1| hypothetical protein PHYSODRAFT_328023 [Phytophthora sojae]
Length=1114

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalll  361
            Q+ +T+    E L+ I T  A+LESTTLVFA+G+D+F+ ++ P+K++D L  DF++ +L+
Sbjct  912  QAMLTYNQTVENLQSISTAAAELESTTLVFAHGLDMFYVRMTPAKSFDLLPSDFNHEMLI  971

Query  360  ltivalvvaifiTWIWSEQKELQEKWR  280
            L  +A + A F+T   +++K LQ  W+
Sbjct  972  LLCLAFLGATFVTKALAQRKALQTAWK  998



>gb|KIH61400.1| g-patch domain protein [Ancylostoma duodenale]
Length=1590

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             +  V +     G+RGI T  + LEST+L+ AYG D+FFT+L PS T+D L DDF +
Sbjct  1495  EDMVNYNQTVHGVRGIKTAASGLESTSLMLAYGKDIFFTRLTPSGTFDILKDDFDH  1550



>ref|XP_003380081.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV60303.1| conserved hypothetical protein [Trichinella spiralis]
Length=941

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            +RGI T P+ +EST+LVF YG+DLFFT++ P+ T+D L +DF + L+ + ++ L  A   
Sbjct  867  VRGIHTAPSGMESTSLVFIYGLDLFFTRINPAGTFDILKEDFDHWLITVVLLGLTCAAVF  926

Query  324  TWIWSEQKELQEKW  283
            +   ++ KEL++ W
Sbjct  927  SRKLAKNKELKQAW  940



>ref|XP_008469500.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1 [Diaphorina citri]
Length=919

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +R I T P+ LEST  VFA+G+DLF+T++APSKT+D L +DF Y
Sbjct  845  IRDIHTAPSGLESTCFVFAHGLDLFYTRVAPSKTFDMLKEDFDY  888



>ref|XP_624458.2| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X3 [Apis mellifera]
Length=938

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++
Sbjct  864  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYV  923

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  924  TKKLASQKVQKQAWK  938



>ref|XP_006614761.1| PREDICTED: ER membrane protein complex subunit 1-like [Apis dorsata]
Length=939

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++
Sbjct  865  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYV  924

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  925  TKKLASQKVQKQAWK  939



>ref|XP_006967829.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR46172.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR99330.1| DUF1620-domain-containing protein [Trichoderma reesei RUT C-30]
Length=972

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++ +TH     G+RGIVT PA +EST+L+ AYG+D+F +Q+APS T+D L   F+
Sbjct  883  RNLLTHERDIVGVRGIVTTPAIVESTSLLLAYGIDVFGSQIAPSGTFDILDKGFN  937



>ref|XP_006562727.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X2 [Apis mellifera]
Length=949

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++
Sbjct  875  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYV  934

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  935  TKKLASQKVQKQAWK  949



>ref|XP_006562726.1| PREDICTED: ER membrane protein complex subunit 1-like isoform 
X1 [Apis mellifera]
Length=956

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ ++
Sbjct  882  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYV  941

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  942  TKKLASQKVQKQAWK  956



>ref|XP_007514832.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15072.1| predicted protein [Bathycoccus prasinos]
Length=1090

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  537   SYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             S+VT+      L+ +VT P  LEST L FA GVD+F+T+L PS+++D+L ++FSY
Sbjct  1005  SWVTNKNIVARLKDVVTAPTALESTVLCFARGVDVFYTRLHPSQSFDALDEEFSY  1059



>ref|XP_003694723.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein KIAA0090-like 
[Apis florea]
Length=938

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            + GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y L+++ + AL+++ +I
Sbjct  864  VSGIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDYYLIVIVLAALLISSYI  923

Query  324  TWIWSEQKELQEKWR  280
            T   + QK  ++ W+
Sbjct  924  TKKLASQKVQKQAWK  938



>gb|EIE91052.1| hypothetical protein RO3G_15763 [Rhizopus delemar RA 99-880]
Length=981

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +   G++ I+T P+ LEST+LVFAYG+D F+T+ +PS+ +D L++DFS
Sbjct  897  FLTYDLDVAGIQSIITSPSLLESTSLVFAYGLDTFYTRSSPSRQFDVLSEDFS  949



>ref|XP_001638961.1| predicted protein [Nematostella vectensis]
 gb|EDO46898.1| predicted protein [Nematostella vectensis]
Length=994

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            Q+Y+ +      ++GI T P+ LEST LVF YG+DL++ Q+ PS+ +D L +DF Y
Sbjct  908  QAYINYNQTIMYIKGIHTAPSGLESTCLVFGYGLDLYWAQITPSRMFDVLKEDFDY  963



>ref|XP_007365855.1| hypothetical protein DICSQDRAFT_155168 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF61410.1| hypothetical protein DICSQDRAFT_155168 [Dichomitus squalens LYAD-421 
SS1]
Length=1018

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +    + IVT PA LEST+LVFA+G+DLFFT++APS T+D L++ F+   L++TI
Sbjct  934   LSHHYQVAKTQKIVTSPALLESTSLVFAHGLDLFFTRIAPSNTFDVLSESFNKPQLVVTI  993

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L  AI +      +K+L+E+W
Sbjct  994   AGLAFAIVVVKPIVARKKLRERW  1016



>ref|XP_003741298.1| PREDICTED: uncharacterized protein KIAA0090 homolog [Metaseiulus 
occidentalis]
Length=865

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            QS + +      +RGI T P+ LEST LV AYG+DL++T++APS+ +D L D+F +
Sbjct  779  QSILNYNQSVARVRGIETAPSGLESTCLVLAYGLDLYYTRVAPSQNFDILKDNFEH  834



>emb|CCM05286.1| predicted protein [Fibroporia radiculosa]
Length=1675

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++H  +  G + I+T PA LEST+LVFAYG DLFFT++ PS T+D L+++F+
Sbjct  927  LSHDYQVVGTKHILTSPALLESTSLVFAYGQDLFFTRITPSNTFDLLSENFN  978



>gb|ETN68661.1| g-patch domain protein [Necator americanus]
Length=1139

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             +  V +     G+RGI T  + LEST+L+ AYG D+FFT+L PS T+D L DDF +
Sbjct  1053  EDMVNYNQTVHGVRGIKTAASGLESTSLMLAYGKDIFFTRLTPSGTFDILKDDFDH  1108



>gb|KHJ96160.1| g-patch domain protein [Oesophagostomum dentatum]
Length=1350

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             +  V +     G+RGI T  + LEST+L+ AYG D+FFT+L PS T+D L DDF +
Sbjct  1264  EDMVNYNQTVHGVRGIKTAASGLESTSLMLAYGKDIFFTRLTPSGTFDILKDDFDH  1319



>gb|ADY17769.1| UT01015p [Drosophila melanogaster]
Length=583

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  497  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  552



>ref|XP_002096611.1| GE25763 [Drosophila yakuba]
 gb|EDW96323.1| GE25763 [Drosophila yakuba]
Length=915

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  829  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  884



>ref|XP_003394767.1| PREDICTED: uncharacterized protein KIAA0090-like [Bombus terrestris]
Length=929

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  857  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  898



>ref|XP_003736887.1| GA15535, isoform B [Drosophila pseudoobscura pseudoobscura]
 gb|EIM52960.1| GA15535, isoform B [Drosophila pseudoobscura pseudoobscura]
Length=909

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  823  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  878



>ref|XP_003485666.1| PREDICTED: uncharacterized protein KIAA0090-like, partial [Bombus 
impatiens]
Length=937

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  865  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  906



>ref|NP_001287216.1| CG2943, isoform C [Drosophila melanogaster]
 ref|NP_001287217.1| CG2943, isoform D [Drosophila melanogaster]
 gb|AHN57215.1| CG2943, isoform C [Drosophila melanogaster]
 gb|AHN57216.1| CG2943, isoform D [Drosophila melanogaster]
Length=908

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  822  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  877



>ref|XP_002019570.1| GL12143 [Drosophila persimilis]
 gb|EDW38204.1| GL12143 [Drosophila persimilis]
Length=916

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  830  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  885



>ref|XP_001979234.1| GG24873 [Drosophila erecta]
 gb|EDV48192.1| GG24873 [Drosophila erecta]
Length=915

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  829  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  884



>ref|XP_001359799.2| GA15535, isoform A [Drosophila pseudoobscura pseudoobscura]
 gb|EAL28951.2| GA15535, isoform A [Drosophila pseudoobscura pseudoobscura]
Length=916

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  830  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  885



>ref|XP_002102532.1| GD19453 [Drosophila simulans]
 gb|EDX12035.1| GD19453 [Drosophila simulans]
Length=915

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  829  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  884



>ref|XP_008040432.1| DUF1620-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW56341.1| DUF1620-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=1007

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYallllti  352
             ++H  +    R +VT PA LEST+LVFAYG+DLF T++APS T+D L+++F+   L+ TI
Sbjct  923   LSHNYQVAKTRRVVTSPALLESTSLVFAYGLDLFSTRVAPSNTFDVLSENFNKVQLVFTI  982

Query  351   valvvaifiTWIWSEQKELQEKW  283
               L +AIFI      +K L+E+W
Sbjct  983   GGLALAIFIVKPMVARKRLRERW  1005



>ref|XP_011264128.1| PREDICTED: ER membrane protein complex subunit 1 isoform X2 [Camponotus 
floridanus]
 gb|EFN62996.1| Uncharacterized protein KIAA0090 [Camponotus floridanus]
Length=921

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  849  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  890



>gb|AAL13840.1| LD30573p [Drosophila melanogaster]
Length=521

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  435  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  490



>gb|KIL61586.1| hypothetical protein M378DRAFT_109215 [Amanita muscaria Koide 
BX008]
Length=1049

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  531   VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
             ++H  +   ++ I+T PA LEST+LVFAYG+DLF T+++PS T+D L++ F+
Sbjct  964   ISHNYEVANIQRIITAPALLESTSLVFAYGLDLFLTRVSPSGTFDVLSESFN  1015



>ref|XP_003705002.1| PREDICTED: uncharacterized protein KIAA0090-like [Megachile rotundata]
Length=929

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  857  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  898



>ref|XP_002038741.1| GM10448 [Drosophila sechellia]
 gb|EDW55278.1| GM10448 [Drosophila sechellia]
Length=915

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  829  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  884



>ref|NP_649747.1| CG2943, isoform A [Drosophila melanogaster]
 ref|NP_001287215.1| CG2943, isoform B [Drosophila melanogaster]
 gb|AAF54161.1| CG2943, isoform A [Drosophila melanogaster]
 gb|ABY21738.1| LD19064p [Drosophila melanogaster]
 gb|AHN57214.1| CG2943, isoform B [Drosophila melanogaster]
Length=915

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  829  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  884



>ref|XP_006732521.1| PREDICTED: ER membrane protein complex subunit 1 [Leptonychotes 
weddellii]
Length=75

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSYalllltivalvvaifi  325
            +RGI T P+ LEST LV AYG+D++ T++ PSK +D L DD+ Y L+   +  LV A  I
Sbjct  1    MRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMI  60

Query  324  TWIWSEQKELQEKWR  280
            T   ++ K L   WR
Sbjct  61   TKRLAQVKLLNRAWR  75



>gb|ETN63708.1| hypothetical protein AND_004576 [Anopheles darlingi]
Length=922

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            LRGI T P+ LEST LV  +G+DLF T+++PSKT+D L +DF Y
Sbjct  848  LRGIHTAPSGLESTCLVLVHGLDLFVTRVSPSKTFDLLKEDFDY  891



>ref|XP_011264127.1| PREDICTED: ER membrane protein complex subunit 1 isoform X1 [Camponotus 
floridanus]
Length=928

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  498  GIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            GI T P+ LEST LVF +G+DLF+T++APSKT+D L +DF Y
Sbjct  856  GIHTSPSGLESTCLVFVHGLDLFYTRVAPSKTFDVLKEDFDY  897



>ref|XP_001954241.1| GF16847 [Drosophila ananassae]
 gb|EDV42802.1| GF16847 [Drosophila ananassae]
Length=917

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S++ +      LR I T P+ LEST LV A G+DLF T++APSKT+D L +DF Y
Sbjct  831  ESHINYNQTVARLRNIYTAPSGLESTCLVVATGLDLFVTRVAPSKTFDLLKEDFDY  886



>gb|EIE91341.1| hypothetical protein RO3G_16052 [Rhizopus delemar RA 99-880]
Length=922

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +    ++ I+T P+ LEST+LVFAYG+D F+TQ +PS+ +D L+ DFS
Sbjct  838  FLTYDLYVANIQSIITSPSLLESTSLVFAYGLDTFYTQSSPSRQFDVLSKDFS  890



>gb|EPQ61850.1| hypothetical protein BGT96224_652 [Blumeria graminis f. sp. tritici 
96224]
Length=971

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            Q  +TH  +  G++ I+T P+ LEST+L+FAYG+D+F T++ PS+ +D L  DF+
Sbjct  883  QMVITHEREVMGIQNIITSPSVLESTSLIFAYGLDIFGTRVTPSQAFDILGKDFN  937



>gb|EYC44584.1| hypothetical protein Y032_0456g1777 [Ancylostoma ceylanicum]
Length=977

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +  V +     G+RGI T  + LEST+L+ AYG D+FFT+L PS T+D L DDF +
Sbjct  891  EDMVNYNQTVHGVRGIKTAASGLESTSLMLAYGKDIFFTRLTPSGTFDILKDDFDH  946



>gb|EYC44585.1| hypothetical protein Y032_0456g1777 [Ancylostoma ceylanicum]
Length=962

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +  V +     G+RGI T  + LEST+L+ AYG D+FFT+L PS T+D L DDF +
Sbjct  876  EDMVNYNQTVHGVRGIKTAASGLESTSLMLAYGKDIFFTRLTPSGTFDILKDDFDH  931



>ref|XP_009020824.1| hypothetical protein HELRODRAFT_82224, partial [Helobdella robusta]
 gb|ESO01112.1| hypothetical protein HELRODRAFT_82224, partial [Helobdella robusta]
Length=576

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +R I T P+ LEST+LVF +G+DLFFT++ PSK +D L +DF Y
Sbjct  502  IRHIKTAPSGLESTSLVFCFGLDLFFTRVTPSKMFDVLKEDFDY  545



>gb|KIJ47261.1| hypothetical protein M422DRAFT_66579 [Sphaerobolus stellatus 
SS14]
Length=810

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            V+H  +  G   IVT PA LEST+++F YG+DLF T++APS T+D L++ F+
Sbjct  725  VSHTYQVAGASHIVTSPALLESTSIIFVYGLDLFLTRVAPSNTFDILSESFN  776



>gb|KIJ24147.1| hypothetical protein M422DRAFT_56525 [Sphaerobolus stellatus 
SS14]
Length=762

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            V+H  +  G   IVT PA LEST+++F YG+DLF T++APS T+D L++ F+
Sbjct  677  VSHTYQVAGASHIVTSPALLESTSIIFVYGLDLFLTRVAPSNTFDILSESFN  728



>ref|XP_009169407.1| hypothetical protein T265_05991 [Opisthorchis viverrini]
 gb|KER26860.1| hypothetical protein T265_05991 [Opisthorchis viverrini]
Length=1035

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -1

Query  540   QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             Q+ +++     G+R I T    LEST+LVFAYG+DLF T+++PS TYD L +DF Y
Sbjct  949   QAVISYNQTIMGVRAIRTAATGLESTSLVFAYGLDLFCTRISPSLTYDLLKEDFDY  1004



>ref|XP_001595133.1| hypothetical protein SS1G_03221 [Sclerotinia sclerotiorum 1980]
 gb|EDO00748.1| hypothetical protein SS1G_03221 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=985

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            +TH  +  G++GI+T PA LEST+LVFAYG+D+F T++ PS  +D L   F+
Sbjct  889  ITHKREVLGIKGIITSPALLESTSLVFAYGIDVFGTRVTPSAAFDILGKAFN  940



>emb|CCU82868.1| DUF1620 domain-containing protein [Blumeria graminis f. sp. hordei 
DH14]
Length=971

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            Q  +TH  +  G++ ++T P+ LEST+L+FAYG+D+F T++ PS+ +D L  DF+
Sbjct  883  QMVITHEREVMGIQNVITSPSVLESTSLIFAYGLDIFGTRVTPSQAFDILGKDFN  937



>gb|EHK47718.1| hypothetical protein TRIATDRAFT_154130 [Trichoderma atroviride 
IMI 206040]
Length=971

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++ +TH     G+RGIV  PA +EST+LV AYG+D+F +Q+APS T+D L   F+
Sbjct  882  RNLLTHERDIVGVRGIVATPAVVESTSLVVAYGIDVFGSQVAPSGTFDILGKGFN  936



>gb|EMF13073.1| DUF1620-domain-containing protein [Sphaerulina musiva SO2202]
Length=931

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            Y+ H  +  G+  I+T PA +EST+LVFAYG+DLF T+L PS ++D L  DF+
Sbjct  845  YLNHKREVVGVWDIITSPALVESTSLVFAYGMDLFGTRLTPSSSFDVLGKDFN  897



>ref|XP_562511.3| AGAP003647-PA [Anopheles gambiae str. PEST]
 gb|EAL40608.3| AGAP003647-PA [Anopheles gambiae str. PEST]
Length=922

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST LV  +G+DLF T+++PSKT+D L +DF Y
Sbjct  848  IRGIHTAPSGLESTCLVLVHGLDLFVTRVSPSKTFDLLKEDFDY  891



>gb|KHJ32329.1| putative duf1620 domain-containing protein [Erysiphe necator]
Length=973

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  531  VTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            +TH  +  G++GI+T P  LEST+LVFAYG+D+F T++ PS  +D L + F+
Sbjct  888  ITHEREVAGVKGIITSPTLLESTSLVFAYGIDIFGTRVTPSLPFDILGNSFN  939



>ref|XP_004176591.1| PREDICTED: LOW QUALITY PROTEIN: ER membrane protein complex subunit 
1 [Taeniopygia guttata]
Length=1316

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  504   LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
             +RGI T P+ LEST LV AYG+D+F T++ PSK +D L DD+ Y
Sbjct  1242  MRGIYTAPSGLESTCLVVAYGLDIFQTRVCPSKQFDVLKDDYDY  1285



>ref|XP_001742198.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ92436.1| predicted protein [Monosiga brevicollis MX1]
Length=493

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -1

Query  540  QSYVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +S + +    E LR IVT P  LEST +V A+G D+F TQ +PSK YD L  DF +
Sbjct  407  RSILNYNHTVENLRTIVTAPTGLESTCIVVAFGADIFLTQHSPSKQYDRLNSDFDF  462



>emb|CEI93176.1| hypothetical protein RMCBS344292_07416 [Rhizopus microsporus]
Length=984

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  534  YVTHAVKAEGLRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFS  376
            ++T+ +   G++ I+T P+ LEST+LVF+YG+D F+++ +PS+ +D L++DFS
Sbjct  900  FLTYDLDVAGIQTIITSPSLLESTSLVFSYGLDTFYSRQSPSRQFDVLSEDFS  952



>ref|XP_005833007.1| hypothetical protein GUITHDRAFT_163084 [Guillardia theta CCMP2712]
 gb|EKX46027.1| hypothetical protein GUITHDRAFT_163084 [Guillardia theta CCMP2712]
Length=977

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            LR IV  PA++EST L+ A G D+FF+++ P+K +D L DDF+Y
Sbjct  903  LRKIVVAPARIESTCLMVAVGADVFFSRVTPAKAFDCLGDDFNY  946



>gb|KFB41320.1| AGAP003647-PA-like protein [Anopheles sinensis]
Length=906

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  504  LRGIVTVPAKLESTTLVFAYGVDLFFTQLAPSKTYDSLTDDFSY  373
            +RGI T P+ LEST LV  +G+DLF T+++PSKT+D L +DF Y
Sbjct  832  IRGIHTAPSGLESTCLVLVHGLDLFVTRVSPSKTFDLLKEDFDY  875



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645