BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004F02

Length=193
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                83.2    5e-17   Ipomoea batatas [batate]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  82.0    1e-16   Coffea canephora [robusta coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  82.0    1e-16   Coffea canephora [robusta coffee]
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4       82.0    1e-16   Coffea arabica [arabica coffee]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  82.0    1e-16   Coffea arabica [arabica coffee]
emb|CDP02827.1|  unnamed protein product                              82.0    2e-16   Coffea canephora [robusta coffee]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    3e-15   Nicotiana sylvestris
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase             78.2    4e-15   Nicotiana tabacum [American tobacco]
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    4e-15   Nicotiana tomentosiformis
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                    77.8    5e-15   Cynara cardunculus var. scolymus [artichoke]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.8    5e-15   Nicotiana tomentosiformis
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1            77.8    6e-15   Cynara cardunculus var. scolymus [artichoke]
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.0    1e-14   Nicotiana sylvestris
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    2e-14   Solanum tuberosum [potatoes]
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            76.3    2e-14   Cynara cardunculus var. scolymus [artichoke]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           76.3    2e-14   Cynara cardunculus var. scolymus [artichoke]
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    76.3    2e-14   Cynara cardunculus var. scolymus [artichoke]
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...  72.8    1e-13   Lonicera hypoglauca
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  72.0    7e-13   Platycodon grandiflorus [balloon-flower]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...  72.0    7e-13   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  72.0    7e-13   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  71.6    7e-13   Cynara cardunculus var. altilis [cultivated cardoon]
ref|NP_001275483.1|  HQT                                              71.2    1e-12   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein             71.2    1e-12   Solanum tuberosum [potatoes]
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase         69.7    5e-12   
gb|AGE10615.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...  67.4    7e-12   Lonicera macranthoides
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...  64.7    5e-11   Lonicera macranthoides
gb|AEK80405.1|  HQT                                                   66.6    5e-11   Lonicera japonica [Japanese honeysuckle]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...  66.6    5e-11   Lonicera japonica [Japanese honeysuckle]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  63.2    8e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.5    4e-08   Nicotiana tomentosiformis
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.5    4e-08   Nicotiana sylvestris
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.5    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.2    5e-08   Nelumbo nucifera [Indian lotus]
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  57.8    7e-08   Coffea canephora [robusta coffee]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...  57.8    7e-08   Coffea canephora [robusta coffee]
emb|CBI83579.1|  hydroxycinnamoyl transferase                         57.8    7e-08   Plectranthus scutellarioides
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora    57.8    7e-08   Coffea canephora [robusta coffee]
emb|CDO98242.1|  unnamed protein product                              57.8    8e-08   Coffea canephora [robusta coffee]
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  57.8    8e-08   Salvia miltiorrhiza [Chinese salvia]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  57.8    8e-08   Coffea canephora [robusta coffee]
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  57.4    8e-08   Coffea canephora [robusta coffee]
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  57.4    8e-08   Coffea arabica [arabica coffee]
gb|ADG46003.1|  hydroxycinnamoyl transferase                          57.4    8e-08   Salvia miltiorrhiza [Chinese salvia]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                         57.4    8e-08   Coffea arabica [arabica coffee]
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  57.4    9e-08   
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.4    1e-07   Nelumbo nucifera [Indian lotus]
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  57.4    1e-07   Erythroxylum coca [coca]
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  57.4    1e-07   
gb|KJB71596.1|  hypothetical protein B456_011G132100                  57.4    1e-07   Gossypium raimondii
ref|XP_006840118.1|  hypothetical protein AMTR_s00727p00010990        56.2    1e-07   
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    1e-07   Nicotiana sylvestris
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.4    1e-07   
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  57.0    1e-07   
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    1e-07   Nicotiana tomentosiformis
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    1e-07   Elaeis guineensis
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  57.0    1e-07   Nicotiana tomentosiformis
gb|AFR40350.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus trichocarpa [western balsam poplar]
gb|AFR40374.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus fremontii
gb|AFR40375.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus fremontii
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                   57.4    1e-07   Eucalyptus grandis [rose gum]
gb|AFR40387.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus nigra [black poplar]
gb|AFR40372.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus fremontii
gb|AFR40382.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.7    1e-07   Populus fremontii
gb|AEO00530.1|  hydroxycinnamoyl transferase                          56.6    1e-07   Nicotiana benthamiana
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.6    1e-07   Sesamum indicum [beniseed]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                 56.6    2e-07   Capsicum annuum
gb|AFR40386.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  54.3    2e-07   Populus fremontii
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  56.6    2e-07   Glechoma hederacea [gill-over-the-ground]
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  56.2    2e-07   Glechoma hederacea [gill-over-the-ground]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    2e-07   Oryza brachyantha
gb|KJB71577.1|  hypothetical protein B456_011G130700                  56.2    2e-07   Gossypium raimondii
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    2e-07   Phoenix dactylifera
emb|CAE01635.3|  OSJNBa0029H02.19                                     56.2    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ADB44897.1|  hydroxycinnamoyl transferase                          56.2    2e-07   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  55.8    3e-07   Ricinus communis
ref|NP_001053225.1|  Os04g0500700                                     56.2    3e-07   
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.8    3e-07   Citrus sinensis [apfelsine]
gb|ACF81845.1|  unknown                                               55.5    3e-07   Zea mays [maize]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.8    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007027318.1|  Uncharacterized protein TCM_022141               52.8    3e-07   
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.8    3e-07   Camelina sativa [gold-of-pleasure]
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1    55.8    3e-07   Avena sativa [cultivated oat]
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3    55.8    3e-07   Avena sativa [cultivated oat]
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.8    3e-07   Eucalyptus grandis [rose gum]
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  55.5    4e-07   Hibiscus cannabinus [bimli-jute]
ref|XP_007011893.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  55.5    4e-07   
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760        55.5    4e-07   Sorghum bicolor [broomcorn]
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg           55.5    4e-07   Capsella rubella
dbj|BAC78636.1|  hydroxyanthranilate hydroxycinnamoyltransferase 4    54.7    5e-07   Avena sativa [cultivated oat]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.5    5e-07   Populus euphratica
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1           55.5    5e-07   Zea mays [maize]
gb|EPS73563.1|  hypothetical protein M569_01193                       54.7    5e-07   Genlisea aurea
emb|CDY44162.1|  BnaC01g22120D                                        55.1    5e-07   Brassica napus [oilseed rape]
ref|NP_001132890.1|  LOC100194386                                     55.5    5e-07   Zea mays [maize]
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    5e-07   Populus euphratica
emb|CDY22880.1|  BnaA01g18180D                                        55.1    5e-07   Brassica napus [oilseed rape]
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    5e-07   Solanum lycopersicum
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    5e-07   Brassica rapa
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    5e-07   Solanum tuberosum [potatoes]
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    5e-07   Populus euphratica
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g           55.1    6e-07   
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  55.1    6e-07   Ipomoea batatas [batate]
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    6e-07   Camelina sativa [gold-of-pleasure]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...  55.1    6e-07   Panicum virgatum
gb|ACF85468.1|  unknown                                               53.9    6e-07   Zea mays [maize]
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    6e-07   Camelina sativa [gold-of-pleasure]
gb|KJB56505.1|  hypothetical protein B456_009G122600                  55.1    6e-07   Gossypium raimondii
gb|KJB56501.1|  hypothetical protein B456_009G122600                  55.1    6e-07   Gossypium raimondii
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           55.1    6e-07   Capsella rubella
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    6e-07   Eucalyptus grandis [rose gum]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...  55.1    6e-07   Populus tomentosa [Chinese white poplar]
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  55.1    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_006368492.1|  transferase family protein                       55.1    7e-07   Populus trichocarpa [western balsam poplar]
gb|EPS67512.1|  hypothetical protein M569_07262                       54.7    7e-07   Genlisea aurea
emb|CBI25231.3|  unnamed protein product                              54.7    7e-07   Vitis vinifera
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg           54.7    8e-07   Capsella rubella
ref|XP_002894568.1|  transferase family protein                       54.7    8e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    8e-07   Vitis vinifera
emb|CAN82918.1|  hypothetical protein VITISV_023290                   54.7    8e-07   Vitis vinifera
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    8e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  54.7    8e-07   Theobroma cacao [chocolate]
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  54.7    9e-07   Gossypium hirsutum [American cotton]
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    9e-07   Sesamum indicum [beniseed]
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.7    9e-07   Setaria italica
gb|KJB68257.1|  hypothetical protein B456_010G234800                  54.3    1e-06   Gossypium raimondii
gb|AFS68800.1|  hydroxycinnamoyl transferase                          54.3    1e-06   Lonicera japonica [Japanese honeysuckle]
gb|KJB68256.1|  hypothetical protein B456_010G234800                  54.3    1e-06   Gossypium raimondii
gb|KJB68219.1|  hypothetical protein B456_010G233000                  52.8    1e-06   Gossypium raimondii
dbj|BAH57209.1|  AT5G48930                                            53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...  53.9    1e-06   Garcinia mangostana [mangosteen]
gb|KJB68255.1|  hypothetical protein B456_010G234700                  54.3    1e-06   Gossypium raimondii
emb|CDY05770.1|  BnaC07g00330D                                        53.9    1e-06   
gb|KJB68229.1|  hypothetical protein B456_010G233600                  53.9    1e-06   Gossypium raimondii
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  54.3    1e-06   Setaria italica
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...  53.9    1e-06   Larix kaempferi [karamatsu]
gb|KJB68227.1|  hypothetical protein B456_010G233600                  53.9    1e-06   Gossypium raimondii
emb|CDY31956.1|  BnaA07g00390D                                        53.9    1e-06   Brassica napus [oilseed rape]
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg           53.9    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.9    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  53.9    2e-06   Panicum virgatum
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.9    2e-06   Eucalyptus grandis [rose gum]
gb|ABR17170.1|  unknown                                               53.5    2e-06   Picea sitchensis
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                  53.5    2e-06   Arabis alpina [alpine rockcress]
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.5    2e-06   
gb|KHN38057.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  52.8    2e-06   Glycine soja [wild soybean]
dbj|BAF49305.1|  putative acyltransferase                             53.5    2e-06   Clitoria ternatea
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...  53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61215.1|  anthranilate N-benzoyltransferase                     53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.5    2e-06   Camelina sativa [gold-of-pleasure]
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2    53.5    2e-06   Avena sativa [cultivated oat]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.5    2e-06   Camelina sativa [gold-of-pleasure]
gb|AEN02914.1|  HCT1                                                  52.8    3e-06   Populus nigra [black poplar]
gb|KDP41953.1|  hypothetical protein JCGZ_26971                       53.1    3e-06   Jatropha curcas
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    3e-06   Glycine max [soybeans]
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  53.1    3e-06   
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  53.1    3e-06   
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.8    3e-06   Brassica rapa
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g           52.4    3e-06   
gb|KDP38692.1|  hypothetical protein JCGZ_04045                       52.8    4e-06   Jatropha curcas
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.8    4e-06   Populus euphratica
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  52.8    4e-06   Gossypium arboreum [tree cotton]
gb|KJB54947.1|  hypothetical protein B456_009G055900                  52.4    4e-06   Gossypium raimondii
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  52.8    4e-06   
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  52.8    4e-06   
dbj|BAH66890.1|  alcohol acyl-transferase                             50.1    5e-06   Prunus mume [ume]
gb|KJB54946.1|  hypothetical protein B456_009G055900                  52.4    5e-06   Gossypium raimondii
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase       52.4    5e-06   Fagopyrum tataricum [Kangra buckwheat]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...  52.4    5e-06   Populus trichocarpa [western balsam poplar]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.4    5e-06   Cicer arietinum [garbanzo]
gb|KJB68258.1|  hypothetical protein B456_010G234900                  52.4    5e-06   Gossypium raimondii
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  52.4    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  52.4    5e-06   
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase         52.4    5e-06   Medicago truncatula
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...  51.6    5e-06   Leucaena leucocephala [cassie]
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  52.4    5e-06   Platycodon grandiflorus [balloon-flower]
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.4    6e-06   
dbj|BAF49306.1|  putative acyltransferase                             52.0    6e-06   Clitoria ternatea
gb|EAZ23787.1|  hypothetical protein OsJ_07497                        52.0    6e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  52.0    7e-06   Glycine soja [wild soybean]
ref|NP_001047408.1|  Os02g0611800                                     52.0    7e-06   
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  52.0    7e-06   Leucaena leucocephala [cassie]
dbj|BAJ95750.1|  predicted protein                                    52.0    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    7e-06   Glycine max [soybeans]
dbj|BAJ93247.1|  predicted protein                                    52.0    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    7e-06   Glycine max [soybeans]
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  52.0    7e-06   Glycine max [soybeans]
ref|NP_001145871.1|  uncharacterized protein LOC100279386             52.0    7e-06   
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640        52.0    8e-06   Sorghum bicolor [broomcorn]
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2           52.0    8e-06   Zea mays [maize]
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase         52.0    8e-06   Medicago truncatula
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  51.6    9e-06   Cynara cardunculus var. scolymus [artichoke]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  51.6    9e-06   Cynara cardunculus [cardoon]
gb|KJB68253.1|  hypothetical protein B456_010G234500                  51.6    9e-06   Gossypium raimondii
dbj|BAJ87836.1|  predicted protein                                    51.6    9e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK06288.1|  predicted protein                                    51.6    9e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           51.6    1e-05   Phaseolus vulgaris [French bean]
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    1e-05   Pyrus x bretschneideri [bai li]
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              51.2    1e-05   Trifolium pratense [peavine clover]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               51.2    1e-05   Trifolium pratense [peavine clover]
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  51.2    1e-05   
gb|EMS64908.1|  Anthranilate N-benzoyltransferase protein 1           50.8    1e-05   Triticum urartu
gb|EPS67739.1|  hypothetical protein M569_07035                       50.8    2e-05   Genlisea aurea
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...  50.8    2e-05   Pinus pinaster [cluster pine]
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            50.8    2e-05   Selaginella moellendorffii
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             50.8    2e-05   Selaginella moellendorffii
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.8    2e-05   Populus euphratica
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g           50.4    2e-05   Phaseolus vulgaris [French bean]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase               50.4    2e-05   Phaseolus vulgaris [French bean]
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase         50.4    2e-05   Medicago truncatula
gb|KEH28556.1|  shikimate/quinate hydroxycinnamoyltransferase         47.4    2e-05   Medicago truncatula
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  50.4    3e-05   Lonicera japonica [Japanese honeysuckle]
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  50.1    3e-05   Morus notabilis
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g           50.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    4e-05   Cucumis melo [Oriental melon]
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  50.1    4e-05   Fragaria vesca subsp. vesca
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    4e-05   Populus euphratica
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like     49.7    4e-05   Prunus mume [ume]
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  49.7    4e-05   
gb|AFK40022.1|  unknown                                               47.8    4e-05   Medicago truncatula
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  49.7    4e-05   Morus notabilis
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1           49.7    4e-05   
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  49.7    4e-05   
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    5e-05   Prunus mume [ume]
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           49.7    5e-05   Prunus persica
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    5e-05   Glycine max [soybeans]
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.7    5e-05   Prunus mume [ume]
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  49.7    5e-05   
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           49.7    5e-05   
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           49.7    5e-05   Prunus persica
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  49.7    5e-05   Glycine soja [wild soybean]
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1           49.7    5e-05   
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...  49.3    5e-05   Pinus radiata
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_007216286.1|  hypothetical protein PRUPE_ppa020471mg           48.9    6e-05   
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     49.3    6e-05   Pyrus x bretschneideri [bai li]
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  49.3    6e-05   
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           49.3    6e-05   Cucumis sativus [cucumbers]
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  49.3    6e-05   
ref|XP_007149783.1|  hypothetical protein PHAVU_005G0986001g          47.0    7e-05   Phaseolus vulgaris [French bean]
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  48.9    8e-05   Gossypium arboreum [tree cotton]
gb|KJB54981.1|  hypothetical protein B456_009G057200                  48.9    9e-05   Gossypium raimondii
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  48.9    9e-05   Glycine soja [wild soybean]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  48.9    9e-05   Malus domestica [apple tree]
gb|KJB71583.1|  hypothetical protein B456_011G130900                  48.5    1e-04   Gossypium raimondii
gb|KGN53929.1|  hypothetical protein Csa_4G190010                     46.2    1e-04   Cucumis sativus [cucumbers]
gb|EMS49406.1|  hypothetical protein TRIUR3_07831                     45.4    2e-04   Triticum urartu
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g           47.8    2e-04   Phaseolus vulgaris [French bean]
ref|XP_004964653.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  47.8    2e-04   Setaria italica
ref|XP_007149790.1|  hypothetical protein PHAVU_005G0989001g          46.6    3e-04   Phaseolus vulgaris [French bean]
gb|KJB54948.1|  hypothetical protein B456_009G055900                  47.4    3e-04   Gossypium raimondii
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g           47.4    3e-04   
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  47.0    3e-04   Tarenaya hassleriana [spider flower]
gb|EPS64937.1|  hypothetical protein M569_09840                       46.6    4e-04   Genlisea aurea
gb|ABI48360.1|  putative alcohol acyltransferase 1                    46.6    5e-04   Lavandula angustifolia [lavender]
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...  46.6    5e-04   Dianthus caryophyllus [carnation]
ref|XP_010229918.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  46.6    5e-04   Brachypodium distachyon [annual false brome]
gb|EEE65225.1|  hypothetical protein OsJ_20376                        45.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...  46.6    6e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001057003.1|  Os06g0185500                                     46.2    6e-04   
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  46.2    7e-04   Populus euphratica
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  46.2    7e-04   Elaeis guineensis
ref|XP_003564188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  46.2    7e-04   Brachypodium distachyon [annual false brome]
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  46.2    7e-04   Gossypium arboreum [tree cotton]
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  46.2    7e-04   Prunus mume [ume]
gb|EAY99941.1|  hypothetical protein OsI_21944                        45.8    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004166135.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  45.1    0.001   
gb|AEA36976.1|  rosmarinic acid synthase                              45.8    0.001   Lavandula angustifolia [lavender]
ref|XP_006656716.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  45.4    0.001   Oryza brachyantha



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSPNKDR+ SLAV LD +H PLF+  LY F
Sbjct  380  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  431



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP +ILYEGTV +LPSP KDR+ SLAV LD DH PLFQ  LY F
Sbjct  379  GWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP +ILYEGTV +LPSP KDR+ SLAV LD DH PLFQ  LY F
Sbjct  379  GWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQRFLYDF  430



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP +ILYEGTV +LPSP KDR+ SLAV LD DH PLFQ  LY F
Sbjct  379  GWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP +ILYEGTV +LPSP KDR+ SLAV LD DH PLFQ  LY F
Sbjct  379  GWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP +ILYEGTV +LPSP KDR+ SLAV LD DH PLFQ  LY F
Sbjct  433  GWGRPIHIGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  484



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSPN KDR+  LAV LD DH PLF+  LY+F
Sbjct  384  GWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSPN KDR+  LAV LD DH PLF+  LY+F
Sbjct  384  GWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSPN KDR+  LAV LD DH PLF+  LY+F
Sbjct  384  GWGRPIHMGPACILYEGTVYILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  ILYEGT+ +LPSPN DRS SLAV LD D  PLF+  LY F
Sbjct  381  GWGRPVFMGPACILYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  432



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSP+ D++  LAV LD DH PLF+  LY+F
Sbjct  383  GWGKPIHMGPACILYEGTVYILPSPSNDKNLRLAVCLDADHMPLFEKYLYEF  434



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  ILYEGT+ +LPSPN DRS SLAV LD D  PLF+  LY F
Sbjct  398  GWGRPVFMGPACILYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  449



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGTV ILPSP+ D++  LAV LD DH PLF+  LY F
Sbjct  385  GWGKPIHMGPACILYEGTVYILPSPSNDKNLRLAVCLDADHMPLFEKYLYDF  436



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGT+ I+PSPN KDR+  LAV LD DH PLF+  LY+F
Sbjct  383  GWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYLYEF  435



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ +LPSPN DRS SLAV LD +  PLF+  LY+F
Sbjct  392  GWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ +LPSPN DRS SLAV LD +  PLF+  LY+F
Sbjct  392  GWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ +LPSPN DRS SLAV LD +  PLF+  LY+F
Sbjct  392  GWGRPIFMGPACILYEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|AGE10604.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera hypoglauca]
Length=296

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PSP  DRS SLAV LD  H PLF+  LY+F
Sbjct  245  GWGRPIFMGPASILYEGTIYIIPSPTNDRSLSLAVCLDVGHMPLFKKYLYEF  296



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ ++PSP+ +RS SLA+ L+ DH PLF+  LY+F
Sbjct  392  GWGRPIFMGPASILYEGTIYVIPSPDNNRSVSLALCLEADHMPLFEKYLYEF  443



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PSP+ DRS SLAV LD DH  LF+  LY F
Sbjct  383  GWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PSP+ DRS SLAV LD DH  LF+  LY F
Sbjct  383  GWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PSP+ DRS SLAV LD DH  LF+  LY F
Sbjct  383  GWGRPIFMGPASILYEGTIYIIPSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLL  46
            GWG P+HMGP  ILYEGT+ I+PSPN KDR+  LAV LD DH PLF+  L
Sbjct  383  GWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLL  46
            GWG P+HMGP  ILYEGT+ I+PSPN KDR+  LAV LD DH PLF+  L
Sbjct  383  GWGRPIHMGPACILYEGTIYIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPN-KDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  ILYEGT+ I+PSPN KDR+  LAV LD  H  LF+  LY+ 
Sbjct  378  GWGRPIHMGPACILYEGTIYIIPSPNSKDRNLRLAVCLDAGHMSLFEKYLYEL  430



>gb|AGE10615.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=276

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  ILYEGT+ I+PSP  DRS  LAV LD  H PLF+  LY+
Sbjct  226  GWGRPIFMGPASILYEGTIYIIPSPTNDRSLLLAVCLDVGHMPLFKKYLYE  276



>gb|AGE10614.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=214

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  ILYEGT+ I+PS   DRS SLAV LD  H   F+  LY+
Sbjct  164  GWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYE  214



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PS   DRS SLAV LD  H   F+  LY+F
Sbjct  388  GWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  ILYEGT+ I+PS   DRS SLAV LD  H   F+  LY+F
Sbjct  388  GWGRPIFMGPASILYEGTIYIIPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++MGP  +L+EG   ILPSP +D S +LAV L  DH  LF+ + Y F
Sbjct  381  GWGRPIYMGPATVLHEGMAYILPSPAQDGSATLAVSLQSDHMQLFEKIFYDF  432



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY F
Sbjct  384  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY F
Sbjct  384  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P++MGP  I YEG   +LPSP  D S SLA+ L  +H  LFQ   Y
Sbjct  421  GWGRPIYMGPGAIAYEGLSFVLPSPTNDGSLSLAIALQSEHMKLFQKFFY  470



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I YEG   +LPSP  D + SLA+ L  DH  +FQ +LY F
Sbjct  384  GWGRPIFMGPGGIAYEGLAFLLPSPVNDGNLSLAISLQSDHMKVFQKILYDF  435



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  388  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  388  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  437



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ LLY+
Sbjct  376  GWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQ  426



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  434



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  DH  +F+ LLY+
Sbjct  376  GWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  DH  +F+ LLY+
Sbjct  376  GWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQADHMKVFEKLLYE  426



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LFQ  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLY  432



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ M P  I++EG V ILPSP KD S +L   L+  H  LF  LLY+F
Sbjct  386  GWGRPIFMRPANIVHEGKVYILPSPTKDGSVTLVTRLETSHMKLFGKLLYEF  437



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+GP ++  EG   ILPSP  D S  LA+ L  DH  +F+ +LY F
Sbjct  389  GWGRPIHVGPAVVYSEGLSYILPSPTNDGSVLLAISLQSDHMEVFRKILYDF  440



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+HMGP  +LYEGTV IL +P KD   S+ + L+ D    F+ LL+ F
Sbjct  382  GWGRPLHMGPASVLYEGTVYILKTPAKDGGLSVIIRLEDDILQRFETLLFDF  433



>ref|XP_007027324.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07826.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ M P  I++EG V ILPSP KD S +L   L+  H  LF  LLY+F
Sbjct  386  GWGRPIFMRPANIVHEGIVYILPSPTKDGSLTLVTRLETSHMKLFGKLLYEF  437



>gb|KJB71596.1| hypothetical protein B456_011G132100 [Gossypium raimondii]
Length=437

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++MGP  ++ EG + ILPSP  D S SLA  L+  H   F+ LLY+F
Sbjct  385  GWGCPIYMGPGNVVQEGKIYILPSPVNDGSLSLATRLETPHMKAFEKLLYEF  436



>ref|XP_006840118.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
 gb|ERN01793.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
Length=281

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   +LPSP+ D S SLA+ L  DH  LF+   Y
Sbjct  230  GWGRPVFMGPGGIAYEGLAFVLPSPSGDGSLSLAISLQADHMVLFKKYFY  279



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  DH  LF+  LY
Sbjct  381  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  +F+ LLY+
Sbjct  441  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  491



>ref|XP_007027325.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07827.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=393

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ M P  I++EG V +LPSP KD S +L   L+  H  LF  LLY+F
Sbjct  342  GWGCPIFMRPANIVHEGKVCMLPSPTKDGSLTLVTRLETSHMKLFGKLLYEF  393



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  DH  LF+  LY
Sbjct  381  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  430



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   +LPSP+ D S SLA+ L  +H   FQ L+Y+
Sbjct  383  GWGRPVFMGPGGIAYEGLAFVLPSPDGDGSLSLAISLQAEHMLRFQKLIYE  433



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  DH  LF+  LY
Sbjct  388  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLY  437



>gb|AFR40350.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40351.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40352.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40353.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40354.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40355.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40356.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40357.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40358.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40359.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40360.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40361.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40362.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40363.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40364.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=172

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  170



>gb|AFR40374.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40384.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=170

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  119  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  168



>gb|AFR40375.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40377.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40378.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40379.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40380.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40381.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40383.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40385.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=171

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  120  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  169



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  +F+ LLY+
Sbjct  446  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  496



>gb|AFR40387.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40388.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40389.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40390.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40391.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40392.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40393.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40394.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40395.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40396.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40397.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40398.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40399.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40400.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40401.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=172

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMELFEKFIY  170



>gb|AFR40372.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40373.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40376.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  170



>gb|AFR40382.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIY  170



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY
Sbjct  318  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  367



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ LLY
Sbjct  381  GWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLY  430



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY
Sbjct  384  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLY  433



>gb|AFR40386.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIY  170



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ LLY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQAEHMKLFEKLLY  432



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ LLY
Sbjct  379  GWGRPIFMGPGGIAYEGLSFVLPSPANDGSLSVAISLQAEHMKLFEKLLY  428



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   +LPS NKD S S+A+ L  +H   F+ L+++
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  439



>gb|KJB71577.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
 gb|KJB71579.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=436

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++MGP  ++ EG + +LPSP  D S +LA  L+  H  +F+ L+Y+F
Sbjct  385  GWGRPIYMGPGNVVQEGKIYVLPSPTNDGSLTLAARLEIPHMKVFEKLIYEF  436



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   +LPSP+ D S SLA+ L  +H   FQ L+Y
Sbjct  383  GWGRPVFMGPGGIAYEGLAFVLPSPDGDGSLSLAISLQAEHMLRFQKLIY  432



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   +LPS NKD S S+A+ L  +H   F+ L+++
Sbjct  408  GWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  458



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I+YEG   +LP+P KD S  LAV L  DH  LF+   Y F
Sbjct  387  GWGRPIFMGPGSIIYEGLAYVLPTPEKDGSRFLAVSLLPDHMTLFKKSFYDF  438



>ref|XP_009399564.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=444

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   +LPSP  D S S+A+ L  DH   FQ L+Y
Sbjct  393  GWGRPVFMGPGGIAYEGLAFVLPSPTGDGSLSVAISLQPDHMQKFQKLIY  442



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  +Y+
Sbjct  380  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSLSVAIALQSEHMKLFEKFIYE  430



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   +LPS NKD S S+A+ L  +H   F+ L+++
Sbjct  391  GWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  441



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PSP  D S S+A+ L  +H  LF+ L+Y
Sbjct  379  GWGRPIFMGPGGIAYEGLSFIIPSPTNDGSLSVAISLQTEHMKLFEKLIY  428



>gb|ACF81845.1| unknown [Zea mays]
 gb|AFW72296.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=319

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  268  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  319



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  I +EG   +LPSP  D S SLA+ L  +H  LF+   Y 
Sbjct  380  GWGRPIYMGPGAIAFEGLSFVLPSPTNDGSLSLAINLQSEHMKLFKKFFYN  430



>ref|XP_007027318.1| Uncharacterized protein TCM_022141 [Theobroma cacao]
 gb|EOY07820.1| Uncharacterized protein TCM_022141 [Theobroma cacao]
Length=93

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ M P  I++EG   ILPS NKD S +L   L+  H  LF  LLY+ 
Sbjct  42   GWGRPIFMRPANIVHEGKAYILPSSNKDGSLTLVTRLEISHMKLFGKLLYEL  93



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ +GP  I YEG   +LPSP  D S SLA+ L  +H  LF+  LY+
Sbjct  380  GWGRPIFVGPGAIAYEGLSFLLPSPTNDGSLSLAISLQSEHMKLFEKFLYE  430



>dbj|BAC78633.1| hydroxyanthranilate hydroxycinnamoyltransferase 1 [Avena sativa]
Length=441

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ +++ F
Sbjct  390  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  441



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ +++ F
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  440



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I YEG   ILPS   D S S+A+ L  +H  LF+  LY F
Sbjct  390  GWGRPIFMGPGGIAYEGLSFILPSSTSDGSLSVAISLQTEHMKLFEKFLYDF  441



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSPN D S S+A+ L  +H  +F+ L Y
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMKVFEKLFY  429



>ref|XP_007011893.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29512.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=375

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++M P  I  EG + ILPSP  D S  LA  L+  H  LF+ LLY+F
Sbjct  324  GWGRPIYMRPAKISQEGKICILPSPTGDGSLFLATCLEASHIELFEKLLYEF  375



>ref|XP_002452435.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
 pdb|4KE4|A Chain A, Elucidation Of The Structure And Reaction Mechanism 
Of Sorghum Bicolor Hydroxycinnamoyltransferase And Its Structural 
Relationship To Other Coa-dependent Transferases And Synthases
 pdb|4KEC|A Chain A, Sbhct-complex Form
 gb|EES05411.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
Length=448

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  397  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  448



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+++GP  I YEG   +LPSP  D S SLA+ L  +H  LF+  L++
Sbjct  379  GWGRPIYVGPGAIAYEGLSFVLPSPTNDGSLSLAIALQPEHMKLFEKFLFE  429



>dbj|BAC78636.1| hydroxyanthranilate hydroxycinnamoyltransferase 4 [Avena sativa]
Length=302

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP  I YEG   +LPS NKD S S+A+ L  +H   F+ L+
Sbjct  251  GWGRPVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLI  299



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  +  EG   IL SP  D S SL + L+  H PLF+  LY F
Sbjct  387  GWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  438



>gb|ACG29714.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
 gb|ACG30562.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=447

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  396  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  447



>gb|EPS73563.1| hypothetical protein M569_01193, partial [Genlisea aurea]
Length=305

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   ++PSP+ D S S+A+ L  DH   FQ L Y+
Sbjct  243  GWGRPVFMGPIGIGYEGLSYVIPSPDNDGSLSVAICLHKDHMVRFQKLFYQ  293



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP +I +EG   +LPSP  D S SL + L  +H  LF+  LY+
Sbjct  377  GWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|NP_001132890.1| LOC100194386 [Zea mays]
 ref|XP_008681252.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 ref|XP_008681253.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 gb|ACF81923.1| unknown [Zea mays]
 gb|ACF84236.1| unknown [Zea mays]
 gb|ACR38175.1| unknown [Zea mays]
 gb|AFW72298.1| anthranilate N-benzoyltransferase protein 1 isoform 1 [Zea mays]
 gb|AFW72299.1| anthranilate N-benzoyltransferase protein 1 isoform 2 [Zea mays]
 gb|AFW72300.1| anthranilate N-benzoyltransferase protein 1 isoform 3 [Zea mays]
 gb|AFW72301.1| anthranilate N-benzoyltransferase protein 1 isoform 4 [Zea mays]
Length=446

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  395  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  446



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  +  EG   IL SP  D S SL + L+  H PLF+  LY F
Sbjct  379  GWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP +I +EG   +LPSP  D S SL + L  +H  LF+  LY+
Sbjct  377  GWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY
Sbjct  384  GWGRPIFMGPGGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP +I +EG   +LPSP  D S SL + L  +H  LF+  LY+
Sbjct  377  GWGRPVFMGPSVIAFEGLSFVLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L  +H  LF+  LY
Sbjct  384  GWGRPIFMGPGGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLY  433



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  380  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  +  EG   IL SP  D S SL + L+  H PLF+  LY F
Sbjct  379  GWGRPVFMGPARVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY
Sbjct  380  GWGRPIFMGPGGIAYEGLSFMLPSPENDGSLSIAISLQEEHMKLFKEFLY  429



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I +EG   +LPSP  D S SLA+ L  +H  LF+  LY+
Sbjct  377  GWGRPLFMGPGAIAFEGLSFLLPSPTDDGSLSLAISLQSEHMKLFEKFLYE  427



>dbj|BAO20883.1| hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl transferase 
[Panicum virgatum]
Length=438

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N D S S+A+ L  +H   F+ L+Y+ 
Sbjct  387  GWGRPVSMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLIYEL  438



>gb|ACF85468.1| unknown [Zea mays]
 gb|AFW72295.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=257

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  206  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  257



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ +GP  I YEG   +LPSP  D S SLA+ L  +H  LF+  LY
Sbjct  380  GWGRPIFVGPGAIAYEGLSFLLPSPTNDGSLSLAIALQSEHMKLFEKFLY  429



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSPN D S S+A+ L  +H  +F+ L Y
Sbjct  353  GWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  402



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSPN D S S+A+ L  +H  +F+ L Y
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  429



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I +EG   +LPSP+ D S SL + L  +H  LF+  LY+
Sbjct  375  GWGRPIFMGPGAIAFEGLSFVLPSPSNDGSLSLVISLQSEHMKLFKKFLYE  425



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++MGP  I YEG   ILPSP  D S S+A+ L  +H   F+   Y F
Sbjct  389  GWGRPIYMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHVKPFEKFFYDF  440



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  380  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  DH   F  LLY
Sbjct  390  GWGRPIFMGPGGIGYEGLAFVLPSPTNDGSLSVAISLQSDHMKSFAKLLY  439



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPSP  D S S+A+ L   H  LF+  +Y
Sbjct  380  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIY  429



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I +EG   +LPSP+ D S S+A+ L  DH  +F  L Y+
Sbjct  397  GWGRPIFMGPGGIAFEGLSFVLPSPDNDGSLSVAISLQKDHLNVFHKLFYQ  447



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I  EG    LPSP  D S S+A+ L  DH  LFQ  LY+
Sbjct  355  GWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYE  405



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  432



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I  EG    LPSP  D S S+A+ L  DH  LFQ  LY+
Sbjct  378  GWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYE  428



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I  EG    LPSP  D S S+A+ L  DH  LFQ  LY+
Sbjct  378  GWGRPIFMGPGGIALEGLAFALPSPTNDGSLSIAISLQEDHMKLFQKYLYE  428



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ L+Y
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLIY  429



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSPN D S S+A+ L  +H  +F+ L Y
Sbjct  448  GWGRPIFMGPGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFY  497



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  ILYEG   +LPSP  D S S+AV L  +   +F+ L Y
Sbjct  382  GWGRPVFMGPGSILYEGLCVVLPSPTNDGSLSVAVSLQEEPMKVFEKLFY  431



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   +LPSP  D S SLA+ L  DH   F+ L+Y
Sbjct  389  GWGRPVFMGPGGIAYEGLAFLLPSPTGDGSLSLAISLRADHMLKFRKLIY  438



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N D S S+A+ L  +H   F+ L+Y+ 
Sbjct  388  GWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMVKFRKLIYEL  439



>gb|KJB68257.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=417

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  +++EG + ILPSP  D S SL   L   H  LF+  LY+
Sbjct  355  GWGRPIYMGPANVVHEGKIYILPSPTNDGSLSLVACLQTAHMKLFEKHLYE  405



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF   LY+
Sbjct  379  GWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFAKYLYE  429



>gb|KJB68256.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=445

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  +++EG + ILPSP  D S SL   L   H  LF+  LY+
Sbjct  383  GWGRPIYMGPANVVHEGKIYILPSPTNDGSLSLVACLQTAHMKLFEKHLYE  433



>gb|KJB68219.1| hypothetical protein B456_010G233000 [Gossypium raimondii]
Length=214

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H GP  + +EG V ILP+P  D S  +A  L   H   F+ LLY+F
Sbjct  163  GWGRPIHTGPADVSHEGKVLILPTPINDGSLLVATRLGISHMSCFEKLLYEF  214



>dbj|BAH57209.1| AT5G48930 [Arabidopsis thaliana]
Length=283

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  L++
Sbjct  232  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  282



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ILPS   D S S+A+ L  +H  LF+ LLY
Sbjct  316  GWGRPIFMGPGGIAYEGLSFILPSATIDGSMSVAIALQSEHMKLFEKLLY  365



>gb|KJB68255.1| hypothetical protein B456_010G234700, partial [Gossypium raimondii]
Length=463

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  +++EG + ILPSP  D S SL   L   H  LF+  LY+
Sbjct  401  GWGRPIYMGPANVVHEGKIYILPSPTDDGSLSLVACLQTAHMKLFEKHLYE  451



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>gb|KJB68229.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=423

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H GP  I++EG V +LP+P  D S  L   L+  H   F+ LLY+F
Sbjct  372  GWGRPIHTGPADIVHEGIVYLLPTPINDGSLLLVARLEISHMSCFEKLLYEF  423



>ref|XP_004953073.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=518

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ L+Y F
Sbjct  467  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  518



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPS  KD S S+A+ L  DH   F+ +LY+
Sbjct  382  GWGRPIFMGPGGIAYEGLAFILPSSTKDGSLSVALGLQPDHMVRFEKMLYE  432



>gb|KJB68227.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
 gb|KJB68228.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=422

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H GP  I++EG V +LP+P  D S  L   L+  H   F+ LLY+F
Sbjct  371  GWGRPIHTGPADIVHEGIVYLLPTPINDGSLLLVARLEISHMSCFEKLLYEF  422



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  LY+
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKYLYE  432



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   +LPSP  D S S+A+ L  DH   F+ L+Y
Sbjct  390  GWGRPVFMGPGGIAYEGLAFVLPSPTADGSLSVAISLQPDHMLEFRKLIY  439



>gb|AGM90558.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
2 [Panicum virgatum]
Length=446

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+  +Y F
Sbjct  395  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF  446



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P++MGP  I YEG   ILPSP  D S S+A+ L  +H   F+   Y
Sbjct  389  GWGRPIYMGPGRIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEKFFY  438



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ MGP  I YEG   ILPS  KD S S+A+ L  DH   F+ +LY+ 
Sbjct  382  GWGRPIFMGPGGIAYEGLAFILPSSAKDGSLSVALGLQPDHMVRFEKMLYEL  433



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+ LLY
Sbjct  373  GWGRPIFMGPGGIPYEGLSFVLPSPINDGSLSVAIALQTEHMKLFEKLLY  422



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  DH   F  LLY
Sbjct  390  GWGRPIFMGPGGIGYEGLAFVLPSPINDGSLSVAISLQSDHMKSFAKLLY  439



>gb|KHN38057.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=279

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  LF+  LY
Sbjct  228  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  277



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  D   LFQ LLY
Sbjct  382  GWGRPIFMGPGGIAYEGLSFIIPSSTNDASLSVAIALPSDQMKLFQELLY  431



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  L++
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  L++
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  L++
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS N+D S S+A+ L  +H   F+ +++ F
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKMIFDF  440



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF+  L++
Sbjct  380  GWGRPIFMGPGGIPYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>gb|AEN02914.1| HCT1 [Populus nigra]
Length=297

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  LF+  +Y
Sbjct  244  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFIY  293



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPS   D S S+A+ L  +H  LF+ L+Y+
Sbjct  380  GWGRPIFMGPGGIPYEGLSFILPSATNDGSLSVAIALQTEHMKLFEKLIYE  430



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  LF+  LY
Sbjct  378  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLY  427



>ref|XP_003580078.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010240077.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=443

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   ++PS +KD S S+A+ L  +H   F+ L+++
Sbjct  392  GWGRPVFMGPGGIAYEGLAFVIPSSSKDGSLSIAISLQAEHMEKFRKLIFE  442



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P++MGP  I YEG   ILPSP  D S S+A+ L  +H   F+   Y
Sbjct  389  GWGRPIYMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEKFFY  438



>ref|XP_007027320.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07822.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=699

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ + P  I++EG + ILPSP KD S +L   L+  H  LF  LLY+F
Sbjct  352  GWGRPIFVRPVNIVHEGKLYILPSPTKDGSLTLVTRLETSHMKLFGKLLYEF  403



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ++PSP  D S S+A+ L  +H  LF+  LY+
Sbjct  382  GWGRPIFMGPGGIPYEGLSFVVPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_002303858.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
 gb|EEE78837.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
Length=315

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  LF+  +Y
Sbjct  262  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  311



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GW  P+ MGP  +++EG   +LPSP  D S  L + L+ DH  LFQ   Y+
Sbjct  386  GWSRPIFMGPASVVFEGMGYVLPSPRNDGSLRLIICLETDHIQLFQAYFYE  436



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  LF+  +Y
Sbjct  380  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFMY  429



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P++MGP  ++ EG + +LPSP  D S +LA  L+  H  +F+ L+Y+ 
Sbjct  385  GWGRPIYMGPGNVVQEGKIYMLPSPANDGSLTLAARLEIPHMKVFEKLIYEI  436



>gb|KJB54947.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=417

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  I++EG + +LPSP  D S S+   L   H  LF+  LY+
Sbjct  355  GWGRPIYMGPANIVHEGKIYLLPSPTDDGSLSVVACLQTAHMKLFEKHLYE  405



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I++EG   +LPSP  D S S+A+ L   H   F+ LLY
Sbjct  396  GWGRPIFMGPGGIMFEGLAFMLPSPANDGSLSVAIGLQPQHMKAFEKLLY  445



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H+G   +++EG + I+PSP  D S SL V L+  H   F+  LY F
Sbjct  387  GWGRPMHVGLANVIHEGKICIVPSPVDDGSLSLVVCLETSHMKQFEKCLYDF  438



>dbj|BAH66890.1| alcohol acyl-transferase [Prunus mume]
Length=110

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   ++PS   D S S+A+ L  +H   F  LLY
Sbjct  59   GWGRPIFMGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  108



>gb|KJB54946.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  I++EG + +LPSP  D S S+   L   H  LF+  LY+
Sbjct  383  GWGRPIYMGPANIVHEGKIYLLPSPTDDGSLSVVACLQTAHMKLFEKHLYE  433



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPSP  D S SLA+ L  +H  LF   LY+
Sbjct  384  GWGRPIFMGPGGIPYEGLAYMLPSPVNDGSLSLAIALQPEHMKLFSKYLYE  434



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  LF+  +Y
Sbjct  380  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIY  429



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  +F+ LLY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  434



>gb|KJB68258.1| hypothetical protein B456_010G234900 [Gossypium raimondii]
Length=429

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  +++EG + ILPSP  D S SL   L   H  LF   LY+
Sbjct  367  GWGRPIYMGPANVVHEGKIYILPSPTDDGSLSLVACLQTAHMKLFGKHLYE  417



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S A+ L  DH   F  LLY
Sbjct  390  GWGRPIFMGPGGIGYEGLAFVLPSPTNDGSLSGAIPLQSDHMKSFAKLLY  439



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S SLA+ L  D   LFQ L Y
Sbjct  381  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S SLA+ L  D   LFQ L Y
Sbjct  381  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFY  430



>gb|AFR67331.1| hydroxycinnamoyl CoA shikimate hydroxycinnamoyl transferase, 
partial [Leucaena leucocephala]
Length=274

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPS   D S S+A+ L  +H  +F+ +LY+
Sbjct  223  GWGRPIFMGPGGIAYEGLSFILPSSGNDGSLSVAIALQPEHMKVFKEVLYE  273



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPS   D S S+A+ L  +H  LF   LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFVLPSTTNDGSLSIAISLQAEHMKLFSKFLY  432



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  +F+ LLY
Sbjct  398  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKELLY  447



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  +F+  LY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>gb|EAZ23787.1| hypothetical protein OsJ_07497 [Oryza sativa Japonica Group]
Length=463

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS + D S S+A+ L  +H   F+ +++ F
Sbjct  412  GWGRPVFMGPGGIAYEGLAFVLPSASGDGSLSVAISLQAEHMEKFRKMIFDF  463



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  +F+  LY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  434



>ref|NP_001047408.1| Os02g0611800 [Oryza sativa Japonica Group]
 dbj|BAD19683.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 3 [Oryza 
sativa Japonica Group]
 dbj|BAF09322.1| Os02g0611800 [Oryza sativa Japonica Group]
 gb|EAY86657.1| hypothetical protein OsI_08038 [Oryza sativa Indica Group]
 dbj|BAG96596.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS + D S S+A+ L  +H   F+ +++ F
Sbjct  391  GWGRPVFMGPGGIAYEGLAFVLPSASGDGSLSVAISLQAEHMEKFRKMIFDF  442



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   ILPS   D S S+A+ L  +H  +F+ +LY+
Sbjct  388  GWGRPIFMGPGGIAYEGLSFILPSSGNDGSLSVAIALQPEHMKVFKEVLYE  438



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP  I YEG   +LPS +KD S S+A+ L  +H   F+ L+
Sbjct  387  GWGRPVFMGPGGIAYEGLAFVLPSASKDGSLSIAISLQAEHMEKFRKLI  435



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  +F+  LY
Sbjct  387  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  436



>dbj|BAJ93247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP  I YEG   +LPS +KD S S+A+ L  +H   F+ L+
Sbjct  387  GWGRPVFMGPGGIAYEGLAFVLPSASKDGSLSIAISLQAEHMEKFRKLI  435



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  +F+  LY
Sbjct  411  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  460



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  DH  +F+  LY
Sbjct  414  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLY  463



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP  I YEG   +LPS N D S S+A+ L  +H   F+ L+
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLI  437



>ref|XP_002446745.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
 gb|EES11073.1| hypothetical protein SORBIDRAFT_06g021640 [Sorghum bicolor]
Length=441

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG PV MGP  I YEG   +LPS N D S S+A+ L  +H   F+ L+ +
Sbjct  390  GWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLICE  440



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP  I YEG   +LPS N D S S+A+ L  +H   F+ L+
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMEKFRKLI  437



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S SLA+ L  D   LFQ L Y
Sbjct  381  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIGLPPDQMKLFQELFY  430



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+ + L  +H  LF   LY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPSP  D S S+ + L  +H  LF   LY
Sbjct  385  GWGRPIFMGPGGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLY  434



>gb|KJB68253.1| hypothetical protein B456_010G234500 [Gossypium raimondii]
Length=445

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P++MGP  +++EG + IL SP  D S SL   L   H  LF+  LY+
Sbjct  383  GWGRPIYMGPANVVHEGKIYILSSPTDDGSLSLVACLQTAHMKLFEKHLYE  433



>dbj|BAJ87836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS ++D S S+A+ L  +H   F+ +++ F
Sbjct  389  GWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  440



>dbj|BAK06288.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS ++D S S+A+ L  +H   F+ +++ F
Sbjct  390  GWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  441



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   I+PS   D + S+A+ L  D   +FQ L Y F
Sbjct  405  GWGRPVFMGPGGIAYEGLSFIIPSSTNDGTMSVAIALPPDRMKVFQDLFYDF  456



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   +LPS   D S SLA+ L  +H   F  LLY
Sbjct  387  GWGQPIFMGPGGIAFEGLAFVLPSATNDGSLSLAISLQSEHMKSFSRLLY  436



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  +F+  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  +F+  LY
Sbjct  383  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLY  432



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I YEG   +LPS ++D S S+A+ L  +H   F+ +++ F
Sbjct  391  GWGRPVFMGPGGIAYEGLAFVLPSASRDGSLSVAISLQAEHMEKFRKMIFDF  442



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   I+PS   D S SLA+ L  +H   F  LLY
Sbjct  387  GWGRPIFMGPGGIAFEGLAFIIPSATNDGSLSLAISLQTEHMKSFSKLLY  436



>gb|EMS64908.1| Anthranilate N-benzoyltransferase protein 1 [Triticum urartu]
Length=370

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  + +EG   +LPS + D S S+A+ L  DH   F+ L++
Sbjct  319  GWGRPVFMGPGGVAFEGLAYVLPSAHNDGSLSIAISLQADHMKKFRQLIF  368



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   ++PSP  D S S+A+ L  DH   F+  LY
Sbjct  377  GWGKPVFMGPAGIGYEGLCYVIPSPADDGSLSVAICLLEDHVEAFRKSLY  426



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPS   D S S+A+ L  DH   F  +LY+
Sbjct  382  GWGRPIFMGPGGIAYEGLAFVLPSSANDGSLSVALGLQPDHMARFAKMLYE  432



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP +I +EG V +LPS   D S S+++ L  +H P F+ L+
Sbjct  398  GWGRPVFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  446



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG PV MGP +I +EG V +LPS   D S S+++ L  +H P F+ L+
Sbjct  400  GWGRPVFMGPAVIAFEGLVYVLPSGTGDGSLSISLGLQPEHMPRFEQLI  448



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV+M P    +EG   ILPSP  D + SL + L+ DH   FQ L Y++
Sbjct  384  GWGKPVYMRPAFA-FEGKGYILPSPTNDGTLSLTICLETDHLESFQKLFYEY  434



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   I+P+   D S S+A+ L  DH  +F+  LY
Sbjct  382  GWGRPVFMGPGGIAYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  I YEG   I+P+   D S S+A+ L  DH  +F+  LY
Sbjct  382  GWGRPVFMGPGGIAYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLY  431



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  +F+  LY
Sbjct  382  GWGRPIFMGPGGIAYEGLSFIIPSSANDGSLSVAIALQHEHMKVFKDFLY  431



>gb|KEH28556.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=78

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
             WG P  MGP  I  EG   ILPS   D S S+A+ L  +H  +F+ L+Y
Sbjct  27   AWGRPTFMGPGWIGCEGRCFILPSSTNDGSLSVAIALQHEHMEVFKELVY  76



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLF  58
            GWG P+ MGP  I YEG   +LPSP  D S S+A+ L  +H  LF
Sbjct  379  GWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLF  423



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG PV MGP  + +EG V +L SP +D S S+++ L  +H   F+ L+Y
Sbjct  395  GWGRPVFMGPGKVSFEGFVIVLRSPIEDGSLSISINLQQEHLKAFEKLIY  444



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P  MGP ++L+EG   I  SP+ D S  + + L+ +H  LF+   Y F
Sbjct  392  GWGRPSFMGPAVVLFEGMAYITRSPSNDGSFMIFICLESNHMELFKKFFYDF  443



>ref|XP_008466864.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis melo]
Length=280

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS + D S S+A+ L   H  +F+ L +
Sbjct  229  GWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  278



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   ++PS   D S S+A+ L  +H   F  LLY
Sbjct  386  GWGRPIFMGPGGIGYEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  435



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P  MGP ++L+EG   I  SP+ D S  + + L+ +H  LF+   Y F
Sbjct  392  GWGRPSFMGPAVVLFEGMAYITRSPSNDGSFMVFICLESNHMELFKEFFYDF  443



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   ++PS   D S S+A+ L  +H   F  LLY
Sbjct  387  GWGRPIFMGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>ref|XP_007033668.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 10 [Theobroma cacao]
 gb|EOY04594.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 10 [Theobroma cacao]
Length=410

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV+M P  +L EG V I  +P  D S S+   L+     LF  LLYKF
Sbjct  359  GWGRPVYMRPAKVLVEGLVYITRTPKNDGSLSVVTRLEASEMKLFGELLYKF  410



>gb|AFK40022.1| unknown [Medicago truncatula]
Length=178

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +H  + +  LY
Sbjct  127  GWGRPIFMGPGGIAYEGLSFIIPSSANDGSLSVAIALQHEHMKVLKDFLY  176



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG P+ MGP  I++EG   +LPSP  D S S+A+ L  +H   F  L+
Sbjct  388  GWGRPIFMGPGGIMFEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  436



>gb|EMT09803.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=520

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV MGP  I +EG   +LPS   D S  +A+ L+ DH   F+ L+++ 
Sbjct  469  GWGQPVFMGPGGIAFEGLAYVLPSVQNDGSLYIAISLEADHMKKFRNLIFEL  520



>ref|XP_007033659.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007033660.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033661.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033662.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033663.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033664.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033665.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033666.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033667.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04585.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY04586.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04587.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04588.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04589.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04590.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04591.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04592.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04593.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=433

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG PV+M P  +L EG V I  +P  D S S+   L+     LF  LLYKF
Sbjct  382  GWGRPVYMRPAKVLVEGLVYITRTPKNDGSLSVVTRLEASEMKLFGELLYKF  433



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  + YEG   +LPS   D S S+A+ L   H   F  LLY+
Sbjct  389  GWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYE  439



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   ++PS   D S S+A+ L  +H   F  LLY
Sbjct  387  GWGRPIFMGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLY  436



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S SLA+ L  +   +FQ L Y
Sbjct  387  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  + YEG   +LPS   D S S+A+ L   H   F  LLY+
Sbjct  389  GWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYE  439



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLL  46
            GWG P+ MGP  I++EG   +LPSP  D S S+A+ L  +H   F  L+
Sbjct  381  GWGRPIFMGPGGIMFEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLI  429



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  + YEG   +LPS   D S S+A+ L   H   F  LLY+
Sbjct  389  GWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYE  439



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  + YEG   +LPS   D S S+A+ L   H   F  LLY+
Sbjct  389  GWGRPIFMGPGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYE  439



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S SLA+ L  +   +FQ L Y
Sbjct  387  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFY  436



>gb|EMT08585.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=445

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  + +EG   +LPS + D S S+A+ L  DH   F+ L++
Sbjct  394  GWGRPMFMGPGGVAFEGLAYVLPSAHNDGSLSIAISLQADHMKKFRQLIF  443



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P+ MGP  I YEG   +LPS   D S S+A+ L  DH   F  +LY+
Sbjct  382  GWGRPIFMGPGGIAYEGLAFVLPSSVNDGSLSVALGLQPDHMVRFAKMLYE  432



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LPS   D S S+A+ L  +H  LF+ +L+
Sbjct  347  GWGRPIFMGPGGIPYEGLSFVLPSSANDGSLSVAIALQTEHMKLFEKILH  396



>ref|XP_007216286.1| hypothetical protein PRUPE_ppa020471mg [Prunus persica]
 gb|EMJ17485.1| hypothetical protein PRUPE_ppa020471mg [Prunus persica]
Length=287

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   +LP  + D S S+A+ L  +H   F  LLY
Sbjct  236  GWGRPIFMGPGGIGYEGLAVVLPGVSNDGSLSVAISLQSEHMKSFSKLLY  285



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   I+PS   D S S+A+ L  +H   F  LLY
Sbjct  387  GWGRPIFMGPGGIAFEGLSFIIPSATNDGSLSVAICLQTEHMKSFSKLLY  436



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS + D S S+A+ L   H  +F+ L +
Sbjct  379  GWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS + D S S+A+ L   H  +F+ L +
Sbjct  379  GWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS + D S S+A+ L   H  +F+ L +
Sbjct  379  GWGRPIFMGPGGIAYEGLSFIIPSASDDGSLSVAISLQNRHMKVFEKLFF  428



>ref|XP_007149783.1| hypothetical protein PHAVU_005G0986001g, partial [Phaseolus vulgaris]
 gb|ESW21777.1| hypothetical protein PHAVU_005G0986001g, partial [Phaseolus vulgaris]
Length=179

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ M P  I+YEG   I+PS   D S  LA+ L   H  LFQ   Y
Sbjct  128  GWGRPIFMRPGWIIYEGLAIIIPSSTNDGSLYLAMTLPPHHMKLFQEFFY  177



>gb|KHG08871.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=434

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+H GP   + EG V ILP+P  D S  +   L+  H    + LLY+F
Sbjct  383  GWGRPIHAGPANAIQEGMVYILPTPINDGSLLVVARLEISHMSCIEKLLYEF  434



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG P+ +GP  +  +G   ILPSP  D S S+   LD  H  +F  L Y+F
Sbjct  385  GWGRPIWLGPAKVSQDGKTYILPSPANDGSLSVMSCLDTSHMKIFGQLFYEF  436



>gb|KHN22398.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=540

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I YEG   I+PS   D S S+A+ L  +   +FQ L Y
Sbjct  489  GWGRPIFMGPGGIAYEGLSFIIPSSTNDGSMSVAIALPPEQMKVFQELFY  538



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLY  43
            GWG P+ MGP  I +EG   +LPS     S SLA+ L  +H   F  LLY
Sbjct  387  GWGQPIFMGPGGIAFEGLAFVLPSATNGGSLSLAICLQSEHMKSFSRLLY  436



>gb|KJB71583.1| hypothetical protein B456_011G130900 [Gossypium raimondii]
Length=375

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYKF  37
            GWG  ++MGP   ++EG + ILPSP  D S SL   L+      F+ LLY+F
Sbjct  324  GWGRTIYMGPGNDVHEGKIYILPSPVNDGSLSLVTRLEIPQMKAFEKLLYEF  375



>gb|KGN53929.1| hypothetical protein Csa_4G190010 [Cucumis sativus]
Length=131

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -2

Query  192  GWGTPVHMGPPLILYEGTVXILPSPNKDRSXSLAVXLDXDHXPLFQXLLYK  40
            GWG P ++GP ++ Y+G + I+P PN D    +A+ L   H   F+   Y+
Sbjct  79   GWGYPDYVGPSMLAYDGKMFIMPGPNNDGLIIVAIQLQMKHMEYFKKFFYE  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568578633280