BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004E16

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABR26184.1|  serine-glyoxylate aminotransferase                      103   4e-26   Oryza sativa Indica Group [Indian rice]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    106   9e-26   Gossypium raimondii
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       106   9e-26   Gossypium arboreum [tree cotton]
gb|AEA48973.1|  glyoxylate aminotransferase                             103   9e-26   Rosa roxburghii [chestnut rose]
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    106   1e-25   Oryza brachyantha
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     105   1e-25   Peperomia aff. pinoi JN-2011
gb|ABK24112.1|  unknown                                                 106   1e-25   Picea sitchensis
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             105   2e-25   Fritillaria agrestis
gb|ACN39798.1|  unknown                                                 105   2e-25   Picea sitchensis
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             105   2e-25   Phaseolus vulgaris [French bean]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    105   2e-25   Glycine max [soybeans]
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     105   2e-25   Peperomia schizandra
ref|NP_001237048.1|  enzymatic resistance protein                       105   2e-25   
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     105   2e-25   Peperomia schizandra
gb|ABR16109.1|  unknown                                                 105   2e-25   Picea sitchensis
gb|KJB54391.1|  hypothetical protein B456_009G074800                    103   2e-25   Gossypium raimondii
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                105   2e-25   Cucumis melo [Oriental melon]
emb|CAN84001.1|  hypothetical protein VITISV_007680                     105   3e-25   Vitis vinifera
gb|AAL47679.1|  aminotransferase 1                                      105   3e-25   Cucumis melo [Oriental melon]
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     105   3e-25   Vitis vinifera
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      105   3e-25   
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    105   3e-25   Cucumis sativus [cucumbers]
gb|ABF70331.1|  aminotransferase 1                                      105   3e-25   Cucumis sativus [cucumbers]
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                105   3e-25   Erythranthe guttata [common monkey flower]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     105   3e-25   Gossypium hirsutum [American cotton]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    105   3e-25   Cucumis sativus [cucumbers]
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       105   3e-25   Gossypium arboreum [tree cotton]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     105   3e-25   Nelumbo nucifera [Indian lotus]
gb|KJB54389.1|  hypothetical protein B456_009G074800                    105   3e-25   Gossypium raimondii
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                104   4e-25   Morus notabilis
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    100   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     104   4e-25   Glycine soja [wild soybean]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    104   4e-25   Glycine max [soybeans]
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           104   4e-25   Glycine max [soybeans]
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      104   5e-25   Spirodela polyrhiza
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    104   5e-25   Phaseolus vulgaris [French bean]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    104   6e-25   Sesamum indicum [beniseed]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     104   6e-25   Fragaria vesca subsp. vesca
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     103   6e-25   Peperomia klopfensteinii
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     104   6e-25   Peperomia rupiseda
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     104   7e-25   Nicotiana sylvestris
emb|CBI24214.3|  unnamed protein product                                103   7e-25   Vitis vinifera
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     104   7e-25   Nicotiana tomentosiformis
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    104   7e-25   Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            104   7e-25   Cucumis melo [Oriental melon]
ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    104   7e-25   Elaeis guineensis
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           104   7e-25   Cucumis melo [Oriental melon]
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     103   7e-25   Peperomia gigantea
gb|ABQ81922.1|  aminotransferase 2                                      104   7e-25   Cucumis sativus [cucumbers]
gb|ABQ81924.1|  aminotransferase 2                                      104   8e-25   Cucumis sativus [cucumbers]
gb|AAQ56193.1|  aminotransferase 2                                      104   8e-25   Cucumis melo [Oriental melon]
gb|KJB83533.1|  hypothetical protein B456_013G252200                    103   8e-25   Gossypium raimondii
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     103   9e-25   Sesamum indicum [beniseed]
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  103   9e-25   Citrus sinensis [apfelsine]
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     103   9e-25   Tarenaya hassleriana [spider flower]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         103   9e-25   Ricinus communis
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      103   1e-24   Genlisea aurea
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     103   1e-24   Eucalyptus grandis [rose gum]
ref|NP_001062170.1|  Os08g0502700                                       103   1e-24   
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             103   1e-24   
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     103   1e-24   Phoenix dactylifera
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             101   2e-24   
gb|ABK96624.1|  unknown                                                 103   2e-24   Populus trichocarpa x Populus deltoides
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  103   2e-24   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    103   2e-24   Citrus sinensis [apfelsine]
gb|ABQ81925.1|  aminotransferase 2                                      103   2e-24   Cucumis melo [Oriental melon]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     103   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     103   2e-24   Malus domestica [apple tree]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    103   2e-24   
gb|AAQ56192.1|  aminotransferase 1                                      102   2e-24   Cucumis melo [Oriental melon]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    102   2e-24   Setaria italica
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    102   2e-24   
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     102   2e-24   
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    102   2e-24   Solanum tuberosum [potatoes]
ref|NP_001265946.1|  Hop-interacting protein THI032                     102   2e-24   Solanum lycopersicum
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     102   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     102   3e-24   Prunus mume [ume]
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             101   3e-24   
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    102   3e-24   Glycine max [soybeans]
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     102   3e-24   Peperomia sp. JN-2011
gb|AFK37194.1|  unknown                                                 100   4e-24   Medicago truncatula
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia polycephala
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia parvifolia
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia elatior
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             102   4e-24   Populus trichocarpa [western balsam poplar]
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia sp. JN-2011
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    102   4e-24   Populus euphratica
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia cerrateae
ref|XP_002313371.1|  aminotransferase 2 family protein                  102   4e-24   
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia cerrateae
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia bracteata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     102   4e-24   Populus euphratica
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia radiatinervosa
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia parvisagittata
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia questionis
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia radiatinervosa
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia aff. gracillima JN-2011
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia parvisagittata
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia wernerrauhii
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     102   4e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia chutanka
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     102   4e-24   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia putlaensis
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia cerrateae
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia putlaensis
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    102   4e-24   
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia ayacuchoana
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     101   4e-24   Peperomia cerrateae
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia cavispicata
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia dolabella
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia exclamationis
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia pugnicaudex
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia jalcaensis
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia basiradicans
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia radiatinervosa
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             102   5e-24   Prunus persica
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia aff. ovatopeltata JN-2011
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia sp. JN-2011
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     101   5e-24   Peperomia sp. JN-2011
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          101   5e-24   Amborella trichopoda
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     101   6e-24   Peperomia aff. ovatopeltata JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     101   6e-24   Peperomia radiatinervosa
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             101   6e-24   Citrus clementina [clementine]
emb|CDP08481.1|  unnamed protein product                                101   7e-24   Coffea canephora [robusta coffee]
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                101   8e-24   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                101   9e-24   Medicago truncatula
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  101   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             100   1e-23   
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     100   1e-23   Brassica rapa
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    101   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    100   1e-23   Brassica rapa
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     100   1e-23   Peperomia parvisagittata
emb|CDX81443.1|  BnaC09g08540D                                          100   1e-23   
emb|CDY37208.1|  BnaA09g08290D                                          100   1e-23   Brassica napus [oilseed rape]
emb|CDX89604.1|  BnaC03g45180D                                          100   1e-23   
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             100   1e-23   
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    100   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    100   2e-23   Camelina sativa [gold-of-pleasure]
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     100   2e-23   Peperomia pseudoverruculosa
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    100   2e-23   Camelina sativa [gold-of-pleasure]
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     100   2e-23   Peperomia andina
gb|AEX09309.1|  alanine glyoxylate aminotransferase                   99.8    2e-23   Peperomia wernerrauhii
gb|AFK40703.1|  unknown                                                 100   2e-23   Medicago truncatula
gb|KDP35982.1|  hypothetical protein JCGZ_08377                       99.8    3e-23   Jatropha curcas
dbj|BAJ33858.1|  unnamed protein product                                100   3e-23   Eutrema halophilum
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase   99.4    5e-23   Elaeis guineensis
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080        99.0    5e-23   Sorghum bicolor [broomcorn]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase   99.8    6e-23   Brachypodium distachyon [annual false brome]
gb|AEX09270.1|  alanine glyoxylate aminotransferase                   98.6    7e-23   Peperomia verruculosa
gb|AEX09277.1|  alanine glyoxylate aminotransferase                   98.2    8e-23   Peperomia cyclaminoides
gb|AEX09307.1|  alanine glyoxylate aminotransferase                   98.2    8e-23   Peperomia verruculosa
gb|AEX09306.1|  alanine glyoxylate aminotransferase                   98.2    8e-23   Peperomia peruviana
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg           98.6    9e-23   Capsella rubella
gb|AEX09266.1|  alanine glyoxylate aminotransferase                   98.2    9e-23   Peperomia peruviana
gb|AEX09268.1|  alanine glyoxylate aminotransferase                   98.2    9e-23   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                   98.2    9e-23   Peperomia peruviana
gb|AEX09274.1|  alanine glyoxylate aminotransferase                   98.2    1e-22   Peperomia peruviana
gb|AEX09272.1|  alanine glyoxylate aminotransferase                   97.8    1e-22   Peperomia cyclaminoides
gb|AEX09281.1|  alanine glyoxylate aminotransferase                   97.8    1e-22   Peperomia cyclaminoides
gb|AEX09269.1|  alanine glyoxylate aminotransferase                   97.8    1e-22   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                   97.8    1e-22   Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                   97.8    1e-22   Peperomia peruviana
gb|AEX09259.1|  alanine glyoxylate aminotransferase                   97.4    1e-22   Peperomia bracteata
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349            95.9    2e-22   
gb|ACN36238.1|  unknown                                               97.1    2e-22   Zea mays [maize]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...  95.9    3e-22   
dbj|BAJ90006.1|  predicted protein                                    97.1    3e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001148339.1|  LOC100281949                                     96.7    4e-22   Zea mays [maize]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                   95.9    5e-22   Peperomia peruviana
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389            95.9    6e-22   
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                   95.1    7e-22   
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946            92.8    7e-22   
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                   95.9    8e-22   Triticum urartu
gb|AEX09260.1|  alanine glyoxylate aminotransferase                   94.7    1e-21   Peperomia aff. ovatopeltata JN-2011
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase              90.5    9e-20   Medicago truncatula
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...  87.0    1e-18   Cicer arietinum [garbanzo]
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase              85.5    4e-18   
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066           85.5    6e-18   Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964           84.3    1e-17   
gb|ABS86860.1|  alanine glyoxylate aminotransferase                   78.2    3e-16   Phaseolus vulgaris [French bean]
ref|XP_001755667.1|  predicted protein                                80.9    3e-16   
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...  80.1    5e-16   Mesorhizobium
gb|ABS86859.1|  alanine glyoxylate aminotransferase                   76.6    9e-16   Phaseolus vulgaris [French bean]
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279           79.3    1e-15   Selaginella moellendorffii
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                    79.3    1e-15   Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase              79.3    1e-15   Hyphomicrobium nitrativorans
ref|XP_001783551.1|  predicted protein                                79.3    1e-15   
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375           79.0    1e-15   Selaginella moellendorffii
ref|WP_026227793.1|  serine--glyoxylate aminotransferase              77.8    4e-15   Hoeflea sp. 108
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...  77.8    4e-15   Hyphomicrobium methylovorum
ref|WP_013217108.1|  serine--glyoxylate aminotransferase              77.0    8e-15   Hyphomicrobium denitrificans
ref|WP_017485211.1|  serine--glyoxylate aminotransferase              76.6    1e-14   Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase              76.6    1e-14   Methylorubrum populi
ref|WP_012253362.1|  serine--glyoxylate aminotransferase              76.6    1e-14   Methylobacteriaceae
ref|WP_003597639.1|  serine--glyoxylate aminotransferase              76.6    1e-14   Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase              76.6    1e-14   Methylorubrum extorquens
emb|CAD13310.1|  serine-glyoxylate aminotransferase                   75.9    1e-14   Methylorubrum extorquens DM4
ref|WP_040969922.1|  serine--glyoxylate aminotransferase              75.9    2e-14   Mesorhizobium sp. ORS 3324
ref|WP_015599474.1|  serine--glyoxylate aminotransferase              75.9    2e-14   Hyphomicrobium denitrificans
ref|WP_026175686.1|  serine--glyoxylate aminotransferase              75.1    3e-14   Methylobacterium sp. 88A
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...  75.1    4e-14   Methylocystaceae
ref|WP_036293367.1|  serine--glyoxylate aminotransferase              75.1    4e-14   Methylosinus
ref|WP_018267457.1|  serine--glyoxylate aminotransferase              74.7    4e-14   Methylosinus sp. LW4
ref|WP_020592928.1|  hypothetical protein                             74.7    4e-14   Kiloniella laminariae
gb|AID30749.1|  serine--glyoxylate aminotransferase                   73.2    5e-14   Mesorhizobium huakuii 7653R
ref|WP_042643125.1|  serine--glyoxylate aminotransferase              74.7    5e-14   Mesorhizobium sp. ORS 3359
ref|WP_027172630.1|  serine--glyoxylate aminotransferase              74.7    6e-14   Methylobacterium
ref|WP_026597137.1|  serine--glyoxylate aminotransferase              74.7    6e-14   Methylobacterium sp. 77
ref|WP_020188076.1|  hypothetical protein                             74.3    7e-14   Methylopila sp. 73B
ref|WP_019858769.1|  serine--glyoxylate aminotransferase              73.9    8e-14   Mesorhizobium loti
ref|WP_032930697.1|  serine--glyoxylate aminotransferase              73.9    1e-13   Mesorhizobium
ref|WP_010910076.1|  serine--glyoxylate aminotransferase              73.6    1e-13   Mesorhizobium japonicum
ref|XP_001763095.1|  predicted protein                                73.6    1e-13   
ref|WP_042673896.1|  serine--glyoxylate aminotransferase              73.6    1e-13   Methylobacterium sp. B34
ref|WP_007559580.1|  serine--glyoxylate aminotransferase              73.6    1e-13   Methylobacterium
ref|WP_026362994.1|  serine--glyoxylate aminotransferase              73.6    1e-13   Methylopila sp. M107
ref|WP_020092657.1|  serine--glyoxylate aminotransferase              73.6    1e-13   Methylobacterium
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...  73.6    1e-13   Mesorhizobium
ref|WP_023685219.1|  serine--glyoxylate aminotransferase              73.6    2e-13   Mesorhizobium sp. LSJC277A00
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...  73.6    2e-13   Methylobacterium
ref|WP_023698325.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Mesorhizobium sp. LSJC265A00
ref|WP_023827347.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Mesorhizobium sp. L103C131B0
ref|WP_023805485.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Mesorhizobium sp. L2C089B000
ref|WP_023714322.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Mesorhizobium sp. LSHC422A00
ref|WP_018329867.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Rhizobium giardinii
ref|WP_003613273.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Methylosinus
ref|WP_037283573.1|  serine--glyoxylate aminotransferase              73.2    2e-13   Rubellimicrobium mesophilum
gb|AGN53915.1|  glyoxylate aminotransferase                           70.5    2e-13   Silene latifolia
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...  73.2    2e-13   Hyphomicrobium
ref|WP_037460312.1|  serine--glyoxylate aminotransferase              71.2    2e-13   Sinorhizobium fredii
ref|WP_036284904.1|  serine--glyoxylate aminotransferase              72.8    2e-13   Methylocystis sp. ATCC 49242
ref|WP_037399704.1|  serine--glyoxylate aminotransferase              71.2    2e-13   Sinorhizobium fredii
ref|WP_043355705.1|  serine--glyoxylate aminotransferase              72.8    3e-13   Methylobacterium
ref|WP_027044922.1|  serine--glyoxylate aminotransferase              72.8    3e-13   Mesorhizobium sp. URHC0008
ref|WP_037429341.1|  serine--glyoxylate aminotransferase              71.2    3e-13   Sinorhizobium fredii
ref|WP_037437034.1|  serine--glyoxylate aminotransferase              71.2    3e-13   
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.8    3e-13   Methylobacterium
ref|WP_037447404.1|  serine--glyoxylate aminotransferase              71.2    3e-13   Sinorhizobium fredii
ref|WP_040580464.1|  serine--glyoxylate aminotransferase              72.8    3e-13   
ref|WP_023829410.1|  serine--glyoxylate aminotransferase              72.4    3e-13   Mesorhizobium sp. L103C120A0
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    3e-13   Mesorhizobium
ref|WP_027146511.1|  serine--glyoxylate aminotransferase              72.4    3e-13   Mesorhizobium sp. WSM3626
ref|WP_015317366.1|  serine--glyoxylate aminotransferase              72.4    3e-13   Mesorhizobium australicum
gb|AIQ91949.1|  Aminotransferase class V                              72.8    3e-13   Methylobacterium oryzae CBMB20
ref|WP_023763335.1|  serine--glyoxylate aminotransferase              72.4    4e-13   Mesorhizobium sp. LNHC232B00
ref|WP_028755163.1|  serine--glyoxylate aminotransferase              72.4    4e-13   Rhizobium leucaenae
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    4e-13   Mesorhizobium
ref|WP_013894918.1|  serine--glyoxylate aminotransferase              72.4    4e-13   Mesorhizobium opportunistum
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    4e-13   Mesorhizobium
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    4e-13   Mesorhizobium
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...  72.4    4e-13   Mesorhizobium
ref|WP_036260471.1|  serine--glyoxylate aminotransferase              72.4    4e-13   Methylocapsa aurea
ref|WP_023822176.1|  serine--glyoxylate aminotransferase              72.4    4e-13   Mesorhizobium sp. L2C054A000
ref|WP_023700366.1|  serine--glyoxylate aminotransferase              72.0    4e-13   Mesorhizobium sp. LSJC264A00
ref|WP_023670792.1|  serine--glyoxylate aminotransferase              72.0    4e-13   Mesorhizobium sp. LSJC285A00
ref|WP_023779196.1|  serine--glyoxylate aminotransferase              72.0    4e-13   Mesorhizobium sp. LNHC221B00
ref|WP_041007618.1|  serine--glyoxylate aminotransferase              72.0    4e-13   Mesorhizobium plurifarium
ref|WP_010687105.1|  Aminotransferase class V                         72.0    4e-13   Methylobacterium mesophilicum
ref|WP_034858116.1|  serine--glyoxylate aminotransferase              72.0    4e-13   Ensifer sojae
ref|WP_041011880.1|  serine--glyoxylate aminotransferase              72.0    5e-13   Mesorhizobium plurifarium
ref|WP_027061369.1|  serine--glyoxylate aminotransferase              72.0    5e-13   Mesorhizobium loti
ref|WP_026616975.1|  serine--glyoxylate aminotransferase              72.0    5e-13   Sinorhizobium/Ensifer group
ref|WP_040981991.1|  serine--glyoxylate aminotransferase              72.0    5e-13   Mesorhizobium plurifarium
ref|WP_041003840.1|  serine--glyoxylate aminotransferase              72.0    5e-13   Mesorhizobium sp. SOD10
ref|WP_026608295.1|  serine--glyoxylate aminotransferase              72.0    6e-13   Methylocapsa acidiphila
ref|WP_027051273.1|  serine--glyoxylate aminotransferase              71.6    6e-13   Mesorhizobium erdmanii
gb|AGN53895.1|  glyoxylate aminotransferase                           68.9    7e-13   Silene latifolia
ref|WP_023741624.1|  serine--glyoxylate aminotransferase              71.6    7e-13   Mesorhizobium sp. LNJC395A00
ref|WP_018238561.1|  serine--glyoxylate aminotransferase              71.6    7e-13   Ensifer sp. BR816
ref|WP_037384071.1|  serine--glyoxylate aminotransferase              71.6    7e-13   Sinorhizobium americanum
ref|WP_037416404.1|  serine--glyoxylate aminotransferase              71.2    8e-13   Sinorhizobium sp. CCBAU 05631
ref|WP_027029542.1|  serine--glyoxylate aminotransferase              71.2    8e-13   Mesorhizobium loti
gb|AGN53914.1|  glyoxylate aminotransferase                           68.6    8e-13   Silene latifolia
ref|WP_020085137.1|  serine--glyoxylate aminotransferase              71.2    8e-13   
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase              71.2    8e-13   
ref|WP_014890662.1|  serine--glyoxylate aminotransferase              71.2    9e-13   
ref|WP_006203221.1|  serine--glyoxylate aminotransferase              71.2    9e-13   
ref|WP_018405893.1|  serine--glyoxylate aminotransferase              71.2    9e-13   
ref|WP_023782620.1|  serine--glyoxylate aminotransferase              71.2    1e-12   
ref|WP_029648781.1|  serine--glyoxylate aminotransferase              71.2    1e-12   
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...  71.2    1e-12   
ref|WP_016921634.1|  serine--glyoxylate aminotransferase              71.2    1e-12   
ref|WP_014329402.1|  serine--glyoxylate aminotransferase              70.9    1e-12   
gb|AGN53916.1|  glyoxylate aminotransferase                           68.2    1e-12   
ref|WP_040961132.1|  serine--glyoxylate aminotransferase              70.9    1e-12   
gb|AGN53917.1|  glyoxylate aminotransferase                           68.2    1e-12   
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...  70.9    1e-12   
ref|WP_023818017.1|  serine--glyoxylate aminotransferase              70.9    1e-12   
ref|WP_026622911.1|  serine--glyoxylate aminotransferase              70.5    2e-12   
gb|AGN53923.1|  glyoxylate aminotransferase                           67.8    2e-12   
gb|AGN53897.1|  glyoxylate aminotransferase                           67.8    2e-12   
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                  70.1    2e-12   
gb|AGN53921.1|  glyoxylate aminotransferase                           67.8    2e-12   
ref|WP_023690293.1|  serine--glyoxylate aminotransferase              70.1    2e-12   
ref|XP_005648727.1|  serine glyoxylate aminotransferase               70.1    3e-12   
ref|WP_043870950.1|  serine--glyoxylate aminotransferase              70.1    3e-12   
ref|WP_012590731.1|  serine--glyoxylate aminotransferase              69.7    3e-12   
gb|AGN54050.1|  glyoxylate aminotransferase                           67.0    3e-12   
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                      69.7    4e-12   
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                   69.7    4e-12   
gb|AGN53906.1|  glyoxylate aminotransferase                           67.0    4e-12   
ref|WP_031597721.1|  serine--glyoxylate aminotransferase              69.3    4e-12   
ref|WP_038511699.1|  serine--glyoxylate aminotransferase              69.3    4e-12   
gb|AGN53900.1|  glyoxylate aminotransferase                           66.6    4e-12   
ref|WP_011630756.1|  serine--glyoxylate aminotransferase              69.3    4e-12   
ref|WP_023833857.1|  serine--glyoxylate aminotransferase              69.3    5e-12   
ref|WP_012709136.1|  serine--glyoxylate aminotransferase              68.9    5e-12   
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                   68.9    6e-12   
gb|AGN54049.1|  glyoxylate aminotransferase                           66.2    8e-12   
ref|WP_003535479.1|  serine--glyoxylate aminotransferase              68.6    8e-12   
ref|WP_010960683.1|  serine--glyoxylate aminotransferase              68.2    1e-11   
ref|WP_035525480.1|  serine--glyoxylate aminotransferase              68.2    1e-11   
ref|WP_027168976.1|  serine--glyoxylate aminotransferase              68.2    1e-11   
ref|WP_015933415.1|  serine--glyoxylate aminotransferase              68.2    1e-11   
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                      68.2    1e-11   
ref|WP_038515723.1|  serine--glyoxylate aminotransferase              67.8    2e-11   
ref|WP_012405153.1|  serine--glyoxylate aminotransferase              67.8    2e-11   
ref|WP_026190999.1|  serine--glyoxylate aminotransferase              67.8    2e-11   
ref|WP_012336184.1|  serine--glyoxylate aminotransferase              67.8    2e-11   
ref|WP_027999163.1|  serine--glyoxylate aminotransferase              67.4    2e-11   
ref|WP_042306504.1|  serine--glyoxylate aminotransferase              67.4    2e-11   
ref|WP_007585769.1|  serine--glyoxylate aminotransferase              67.0    3e-11   
ref|WP_035994918.1|  serine--glyoxylate aminotransferase              67.0    3e-11   
ref|WP_007742731.1|  serine--glyoxylate aminotransferase              67.0    3e-11   
ref|WP_026610206.1|  serine--glyoxylate aminotransferase              67.0    3e-11   
ref|WP_037131645.1|  serine--glyoxylate aminotransferase              67.0    3e-11   
ref|WP_020058450.1|  hypothetical protein                             66.6    4e-11   
ref|WP_008058631.1|  serine--glyoxylate aminotransferase              66.6    4e-11   
ref|WP_028367172.1|  serine--glyoxylate aminotransferase              66.6    4e-11   
ref|WP_014955398.1|  serine--glyoxylate aminotransferase              66.6    4e-11   
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...  66.6    5e-11   
ref|WP_027163728.1|  serine--glyoxylate aminotransferase              66.2    6e-11   
ref|WP_043774228.1|  serine--glyoxylate aminotransferase              66.2    6e-11   
ref|WP_014762956.1|  serine--glyoxylate aminotransferase              66.2    6e-11   
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase               65.9    8e-11   
ref|WP_028212654.1|  serine--glyoxylate aminotransferase              65.9    8e-11   
ref|WP_035937801.1|  serine--glyoxylate aminotransferase              65.9    1e-10   
gb|KIZ03753.1|  serine--glyoxylate transaminase                       65.5    1e-10   
ref|WP_028223486.1|  serine--glyoxylate aminotransferase              65.5    1e-10   
ref|WP_026850920.1|  serine--glyoxylate aminotransferase              65.1    2e-10   
ref|WP_018410273.1|  serine--glyoxylate aminotransferase              64.7    2e-10   
ref|WP_036271184.1|  serine--glyoxylate aminotransferase              64.7    2e-10   
ref|WP_043847105.1|  serine--glyoxylate aminotransferase              64.7    2e-10   
ref|XP_005709273.1|  serine--glyoxylate transaminase                  64.7    2e-10   
ref|WP_043363897.1|  serine--glyoxylate aminotransferase              64.3    3e-10   
ref|WP_029644281.1|  serine--glyoxylate aminotransferase              64.3    3e-10   
gb|AAW29978.1|  serine:glyoxylate aminotransferase                    61.6    3e-10   
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980            64.3    3e-10   
ref|WP_036274731.1|  serine--glyoxylate aminotransferase              63.9    4e-10   
ref|WP_033156535.1|  serine--glyoxylate aminotransferase              63.9    4e-10   
ref|WP_026604426.1|  serine--glyoxylate aminotransferase              63.9    4e-10   
ref|WP_020482091.1|  serine--glyoxylate aminotransferase              63.9    4e-10   
ref|WP_037133426.1|  serine--glyoxylate aminotransferase              63.5    5e-10   
ref|WP_015895604.1|  serine--glyoxylate aminotransferase              63.2    6e-10   
ref|WP_022947294.1|  serine--glyoxylate aminotransferase              63.2    7e-10   
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614            63.2    9e-10   
ref|WP_013529882.1|  serine--glyoxylate aminotransferase              62.8    1e-09   
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase              62.4    1e-09   
ref|WP_024505109.1|  serine--glyoxylate aminotransferase              62.8    1e-09   
ref|WP_041930245.1|  serine--glyoxylate aminotransferase              62.4    1e-09   
gb|ABM96214.1|  serine-glyoxylate aminotransferase                    62.4    1e-09   
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...  62.4    1e-09   
ref|XP_001702107.1|  serine glyoxylate aminotransferase               62.4    2e-09   
ref|XP_001702106.1|  serine glyoxylate aminotransferase               62.4    2e-09   
ref|WP_015314900.1|  serine--glyoxylate aminotransferase              62.0    2e-09   
ref|WP_011455723.1|  serine--glyoxylate aminotransferase              62.0    2e-09   
ref|WP_037380858.1|  serine--glyoxylate aminotransferase              62.0    2e-09   
ref|WP_014989411.1|  serine--glyoxylate aminotransferase              61.6    2e-09   
ref|WP_026622392.1|  serine--glyoxylate aminotransferase              61.2    4e-09   
ref|WP_014762541.1|  serine--glyoxylate aminotransferase              61.2    4e-09   
ref|WP_018238011.1|  serine--glyoxylate aminotransferase              61.2    4e-09   
ref|WP_029964417.1|  serine--glyoxylate aminotransferase              60.8    4e-09   
ref|WP_015888023.1|  serine--glyoxylate aminotransferase              60.8    4e-09   
ref|WP_036253086.1|  serine--glyoxylate aminotransferase              60.8    4e-09   
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...  60.8    4e-09   
ref|WP_010968118.1|  serine--glyoxylate aminotransferase              60.8    5e-09   
ref|WP_023666824.1|  serine--glyoxylate aminotransferase              60.8    5e-09   
ref|WP_005670252.1|  serine-glyoxylate aminotransferase               58.5    6e-09   
ref|WP_027288003.1|  serine--glyoxylate aminotransferase              60.5    6e-09   
ref|WP_019867322.1|  serine--glyoxylate aminotransferase              60.5    7e-09   
ref|WP_034483968.1|  serine--glyoxylate aminotransferase              60.1    7e-09   
ref|WP_027156802.1|  serine--glyoxylate aminotransferase              60.1    1e-08   
ref|WP_037197032.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_037471319.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_034505845.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_018001111.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_037401694.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_040962653.1|  serine--glyoxylate aminotransferase              59.7    1e-08   
ref|WP_013046086.1|  serine--glyoxylate aminotransferase              59.3    2e-08   
ref|WP_036753911.1|  serine--glyoxylate aminotransferase              59.3    2e-08   
ref|WP_017840623.1|  serine--glyoxylate aminotransferase              59.3    2e-08   
ref|WP_014149643.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_015494023.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_037257951.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_013819317.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_028097617.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_037057439.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_028716825.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_028712351.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_024844788.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_010395294.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_026223456.1|  serine--glyoxylate aminotransferase              58.9    2e-08   
ref|WP_009827863.1|  serine--glyoxylate aminotransferase              58.5    3e-08   
ref|WP_024351906.1|  serine--glyoxylate aminotransferase              58.5    3e-08   
ref|WP_009211467.1|  serine--glyoxylate aminotransferase              58.5    3e-08   
ref|WP_009812827.1|  serine--glyoxylate aminotransferase              58.2    4e-08   
ref|WP_029357831.1|  serine--glyoxylate aminotransferase              58.2    4e-08   
ref|WP_020094516.1|  MULTISPECIES: serine--glyoxylate aminotransf...  58.2    4e-08   
ref|WP_010686651.1|  serine--glyoxylate transaminase                  58.2    4e-08   
ref|WP_036741500.1|  serine--glyoxylate aminotransferase              58.2    4e-08   
gb|ETX29328.1|  serine--glyoxylate aminotransferase                   57.8    5e-08   
ref|WP_043769007.1|  serine--glyoxylate aminotransferase              57.8    5e-08   
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...  57.8    5e-08   
ref|WP_011750154.1|  serine--glyoxylate aminotransferase              57.8    5e-08   
ref|WP_036191573.1|  serine--glyoxylate aminotransferase              57.8    6e-08   
ref|WP_030092530.1|  serine--glyoxylate aminotransferase              57.8    6e-08   
ref|WP_024809176.1|  serine--glyoxylate aminotransferase              57.4    8e-08   
ref|WP_011241925.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_010548951.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_009834866.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_015498822.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_031437003.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_006890572.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_007205927.1|  serine--glyoxylate aminotransferase              57.0    1e-07   
ref|WP_011540013.1|  serine--glyoxylate aminotransferase              56.6    1e-07   
ref|WP_039689193.1|  serine--glyoxylate aminotransferase              56.6    2e-07   
ref|WP_006311601.1|  serine--glyoxylate aminotransferase              56.6    2e-07   
ref|WP_028035328.1|  serine--glyoxylate aminotransferase              56.2    2e-07   
ref|WP_009178240.1|  serine--glyoxylate aminotransferase              56.2    2e-07   
ref|WP_029167381.1|  hypothetical protein                             54.3    2e-07   
ref|WP_029016266.1|  serine--glyoxylate aminotransferase              56.2    2e-07   
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...  56.2    2e-07   
ref|WP_031434945.1|  serine--glyoxylate aminotransferase              56.2    2e-07   
ref|WP_008888199.1|  serine--glyoxylate aminotransferase              56.2    2e-07   
ref|WP_038147781.1|  serine--glyoxylate aminotransferase              55.8    2e-07   
ref|WP_027262558.1|  serine--glyoxylate aminotransferase              55.8    3e-07   
ref|WP_040450969.1|  serine--glyoxylate aminotransferase              55.8    3e-07   
gb|EEE42985.1|  aminotransferase, class V superfamily                 55.8    3e-07   
ref|WP_006005059.1|  serine--glyoxylate aminotransferase              55.5    3e-07   
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...  55.5    3e-07   
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...  55.5    4e-07   
ref|WP_020096326.1|  serine--glyoxylate aminotransferase              55.5    4e-07   
ref|WP_039615629.1|  serine--glyoxylate aminotransferase              55.5    4e-07   
ref|WP_020180326.1|  serine--glyoxylate aminotransferase              55.5    4e-07   
ref|WP_020950386.1|  serine-glyoxylate transaminase                   55.1    4e-07   
gb|KJF70525.1|  serine--glyoxylate aminotransferase                   55.1    5e-07   
ref|WP_039537917.1|  serine--glyoxylate aminotransferase              55.1    5e-07   
ref|XP_005539023.1|  serine-glyoxylate aminotransferase               55.1    5e-07   
ref|WP_041545642.1|  serine--glyoxylate aminotransferase              55.1    5e-07   
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme          55.1    5e-07   
ref|WP_007815045.1|  serine--glyoxylate aminotransferase              55.1    6e-07   
ref|WP_023665384.1|  serine--glyoxylate aminotransferase              54.7    6e-07   
ref|WP_039003054.1|  serine--glyoxylate aminotransferase              54.7    6e-07   
ref|WP_019956443.1|  serine--glyoxylate aminotransferase              54.7    6e-07   
ref|WP_006935547.1|  serine--glyoxylate aminotransferase              54.7    7e-07   
ref|WP_007817284.1|  serine--glyoxylate aminotransferase              54.7    8e-07   
ref|WP_039621788.1|  serine--glyoxylate aminotransferase              54.3    8e-07   
ref|WP_028719065.1|  serine--glyoxylate aminotransferase              54.3    8e-07   
ref|WP_028957602.1|  serine--glyoxylate aminotransferase              54.3    8e-07   
ref|WP_039195772.1|  serine--glyoxylate aminotransferase              54.3    8e-07   
ref|WP_037263007.1|  serine--glyoxylate aminotransferase              54.3    9e-07   
ref|WP_037293454.1|  serine--glyoxylate aminotransferase              54.3    9e-07   
gb|EBA13502.1|  Serine--glyoxylate transaminase                       54.3    9e-07   
ref|WP_037279938.1|  serine--glyoxylate aminotransferase              54.3    1e-06   
ref|WP_035846013.1|  serine--glyoxylate aminotransferase              54.3    1e-06   
ref|WP_036178803.1|  serine--glyoxylate aminotransferase              54.3    1e-06   
ref|WP_010441851.1|  serine--glyoxylate aminotransferase              54.3    1e-06   
ref|WP_017971680.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_039166767.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_037094842.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_012177563.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_024298006.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_023496630.1|  serine--glyoxylate aminotransferase SgaA         53.9    1e-06   
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...  53.9    1e-06   
ref|WP_037249159.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_040618186.1|  serine--glyoxylate aminotransferase              53.9    1e-06   
ref|WP_007427777.1|  serine--glyoxylate aminotransferase              53.5    1e-06   
ref|WP_014869675.1|  serine--glyoxylate aminotransferase              53.5    2e-06   
ref|WP_008558487.1|  serine--glyoxylate aminotransferase              53.5    2e-06   
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...  53.1    2e-06   
ref|WP_013634864.1|  serine--glyoxylate aminotransferase              53.1    2e-06   
gb|EAP76585.1|  probable serine-glyoxylate aminotransferase           53.1    2e-06   
ref|WP_042251598.1|  serine--glyoxylate aminotransferase              53.1    3e-06   
ref|WP_007424903.1|  serine--glyoxylate aminotransferase              52.8    3e-06   
ref|WP_024092553.1|  serine--glyoxylate aminotransferase              52.8    3e-06   
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...  52.8    3e-06   
ref|WP_039135088.1|  serine--glyoxylate aminotransferase              52.8    3e-06   
ref|WP_037929134.1|  serine--glyoxylate aminotransferase              52.8    3e-06   
ref|WP_027233841.1|  serine--glyoxylate aminotransferase              52.8    3e-06   
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein    52.8    3e-06   
ref|WP_027260136.1|  serine--glyoxylate aminotransferase              52.8    4e-06   
ref|WP_008757940.1|  serine--glyoxylate aminotransferase              52.8    4e-06   
ref|WP_007803860.1|  serine--glyoxylate aminotransferase              52.8    4e-06   



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   103 bits (257),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  39   AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFR  98

Query  7    IG  2
            IG
Sbjct  99   IG  100



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   106 bits (264),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIVKRAW RYN+SLGLGLNKVAGKVFR
Sbjct  193  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFR  252

Query  7    IG  2
            IG
Sbjct  253  IG  254



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   106 bits (265),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDSSEIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   103 bits (256),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  55   AVEAWGLKNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFR  114

Query  7    IG  2
            IG
Sbjct  115  IG  116



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   106 bits (265),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVPSYIDSSEIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  289  AVEAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VV+PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   106 bits (264),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VV+P YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VV+P YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   105 bits (262),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VV+P YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIVKRAW RYN+SLGLGLNKVAGKVFR
Sbjct  102  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFR  161

Query  7    IG  2
            IG
Sbjct  162  IG  163



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  281  AVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  340

Query  7    IG  2
            IG
Sbjct  341  IG  342



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  246  AVDAWGLKNCTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  305

Query  7    IG  2
            IG
Sbjct  306  IG  307



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   105 bits (261),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDSSEIVKR W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   105 bits (261),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIVKRAW RYN+SLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   105 bits (261),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIVKRAW RYN+SLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   100 bits (249),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  11   AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFR  70

Query  7    IG  2
            IG
Sbjct  71   IG  72



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   104 bits (260),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDSSEIV+RAW R+NLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC +KEEW SDTV  VVVPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A QAWGLKNC QKEEW SDTV  VVVPS IDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVQAWGLKNCTQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   104 bits (259),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   104 bits (259),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  261  AVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  320

Query  7    IG  2
            IG
Sbjct  321  IG  322



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+E+V+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  229  AVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  288

Query  7    IG  2
            IG
Sbjct  289  IG  290



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   104 bits (259),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDSSEIVKR W RYNLSLGLGLNKVAGKVFR
Sbjct  229  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNKVAGKVFR  288

Query  7    IG  2
            IG
Sbjct  289  IG  290



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VV+PSYIDS+EIV++AW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   103 bits (258),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPS+I+SSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   103 bits (258),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A QAWGLKNC QKEEW SDTV  VVVP +IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVQAWGLKNCTQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   103 bits (258),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV  V+VP YIDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLNNCTQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  ++VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   103 bits (258),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YI+SSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   103 bits (257),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  289  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   103 bits (256),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+E+V+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  131  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  190

Query  7    IG  2
            IG
Sbjct  191  IG  192



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPS+I+SSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPS+I+SSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP Y+DS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  V+VP YIDS+EIVKRAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  V+VP YIDS+EIVKRAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   103 bits (256),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  324  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFR  383

Query  7    IG  2
            IG
Sbjct  384  IG  385



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVF 
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFS  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   102 bits (255),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  289  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   102 bits (255),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  V+VP +IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  V+VP +IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP +I+SSEIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP +I+SSEIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   102 bits (254),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVPSYI+S+++VKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   102 bits (254),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  V+VP YIDS+EIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   101 bits (252),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  198  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  257

Query  7    IG  2
            IG
Sbjct  258  IG  259



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   102 bits (254),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP+YIDS+EIV+RAW R NLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   100 bits (250),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YID +EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  125  AVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFR  184

Query  7    IG  2
            IG
Sbjct  185  IG  186



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP YIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  244  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  303

Query  7    IG  2
            IG
Sbjct  304  IG  305



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VVVP +IDS+E+VKRAW RYN+SLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  VVVP YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  242  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  301

Query  7    IG  2
            IG
Sbjct  302  IG  303



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  233  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  292

Query  7    IG  2
            IG
Sbjct  293  IG  294



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  232  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  291

Query  7    IG  2
            IG
Sbjct  292  IG  293



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  241  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  7    IG  2
            IG
Sbjct  301  IG  302



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  241  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  7    IG  2
            IG
Sbjct  301  IG  302



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q EEW SDTV  V+VP YIDS+EIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   101 bits (251),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  230  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  289

Query  7    IG  2
            IG
Sbjct  290  IG  291



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   101 bits (252),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  VV+P+ IDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  233  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  292

Query  7    IG  2
            IG
Sbjct  293  IG  294



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   101 bits (251),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  242  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  301

Query  7    IG  2
            IG
Sbjct  302  IG  303



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   101 bits (252),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP +I+SSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   101 bits (251),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP  IDSSEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   101 bits (251),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YID +EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   101 bits (251),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YID +EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  VVVP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  VVVP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  VVVP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   100 bits (249),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  VVVP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP +I+SS++VKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYIDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP +ID SEIV+RAW RYNLSLGLGLNK+AGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNKIAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PSYI+S+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score = 99.8 bits (247),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SD V  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q+EEW SDTV  VVVP YID +EIV+RAW R+NLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW SDTV  V+VP  IDS+EIV+R W RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  VVVP  IDS+EIVKRAW RYNLSLGLGLNKVAGKVFR
Sbjct  325  AVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFR  384

Query  7    IG  2
            IG
Sbjct  385  IG  386



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QK+EW SDTV  VVVP YIDS+++V+R W RYNLSLGLGLNKVAGKVFR
Sbjct  289  AVEAWGLKNCTQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  VVVP YIDS+EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  289  AVEAWGLKNCCQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  VVVP YIDS+EIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  348  AVEAWGLKNCTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFR  407

Query  7    IG  2
            IG
Sbjct  408  IG  409



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PS IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PS IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PS IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  242  AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  301

Query  7    IG  2
            IG
Sbjct  302  IG  303



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S+TV  V+VP  ID SE+V+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVEAWGLKNCTQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score = 98.2 bits (243),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  253  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  312

Query  7    IG  2
            IG
Sbjct  313  IG  314



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PS IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  241  AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  7    IG  2
            IG
Sbjct  301  IG  302



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  SDTV  V++PS IDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  233  AVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  292

Query  7    IG  2
            IG
Sbjct  293  IG  294



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  232  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  291

Query  7    IG  2
            IG
Sbjct  292  IG  293



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  241  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  300

Query  7    IG  2
            IG
Sbjct  301  IG  302



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  236  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  295

Query  7    IG  2
            IG
Sbjct  296  IG  297



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +A GLKNC QKEE  SDTV  V++PSYIDS+EIV+RAW RYNLSLGLGLNKVAGKVFR
Sbjct  242  AVEARGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNKVAGKVFR  301

Query  7    IG  2
            IG
Sbjct  302  IG  303



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV  VVVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  149  AVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  208

Query  7    IG  2
            IG
Sbjct  209  IG  210



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV   VVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  215  AVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  274

Query  7    IG  2
            IG
Sbjct  275  IG  276



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV  VVVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  149  AVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  208

Query  7    IG  2
            IG
Sbjct  209  IG  210



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLKNC +KEE  SDTV  VVVP YIDSSEIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV   VVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  290  AVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  349

Query  7    IG  2
            IG
Sbjct  350  IG  351



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score = 95.9 bits (237),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEE  S+TV  V++P YIDS+EIV+RAW RYNLSLGLGLNKV GKVFR
Sbjct  232  AVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNKVXGKVFR  291

Query  7    IG  2
            IG
Sbjct  292  IG  293



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SDTV   VVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  290  AVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  349

Query  7    IG  2
            IG
Sbjct  350  IG  351



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score = 95.1 bits (235),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLKNC  KEE  SDTV  VVVP YIDSSEIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  177  AVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFR  236

Query  7    IG  2
            IG
Sbjct  237  IG  238



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score = 92.8 bits (229),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL NC QKEEW SD V  VVVP  IDS+E+V+ AW RYNLSLGLGLNKVAGKVFR
Sbjct  46   AVEAWGLSNCCQKEEWFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFR  105

Query  7    IG  2
            IG
Sbjct  106  IG  107



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 51/62 (82%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLKNC  KEE  SDTV  VVVP YIDSSEIVK AW RYNLSLGLGLNKVAGKVFR
Sbjct  288  AVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  QAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFRIG  2
            +AWGLKNC  KEE  SDTV  V++PSYIDS+EIV+RAW R NLSLGLGLNKVAGKVFRIG
Sbjct  255  EAWGLKNCTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIG  314



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC QKEEW S +V  +VVP  IDS EIV RAW RYNLSLG GLNKVAGKVFR
Sbjct  288  AVEAWGLKNCCQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLKNC Q +E  SD+V  VVVP+ IDS EIV RAW +YNLSLG+GLNKVAGKVFR
Sbjct  288  AVEAWGLKNCCQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = -3

Query  187  AXQAWGLKNC-XQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVF  11
            A +AWGLKNC  Q+EEW S +V  ++VP  ID+ EIV RAW RYNLSLG GLNKVAGKVF
Sbjct  236  AVEAWGLKNCCQQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVF  295

Query  10   RIG  2
            RIG
Sbjct  296  RIG  298



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ EW SDTV  VVVP YI+S ++VK AW +YNLSLG+GLNKVAGKVFR
Sbjct  288  AVAAWGLKLCTKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ EW SDTV  VVVP Y++S ++VK AW +YNLSLG+GLNKVAGKVFR
Sbjct  288  AVAAWGLKLCTKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLG  44
            A +AWGLKNC QKEEW SDTV  V+VPSYIDS+EIV+RAW RYNLSLG
Sbjct  102  AVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL  C Q  +W SDTV  VVVPS+I+S++IVK A+ +YNLSLG+GLNKVAGKVFR
Sbjct  289  AVKAWGLTLCTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|WP_024925735.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 ref|XP_005974896.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pantholops 
hodgsonii]
Length=396

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  + VP  IDS+E+VKRA+ +Y  SLG+GLNKVAGKVFR
Sbjct  282  AVDAWGLKLCAKERKWHSDTVSAIHVPEGIDSAEVVKRAYHKYQTSLGVGLNKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLG  44
            A +AWGLKNC +KEEW SDTV  VVVPSYIDS+EIV+RAW RYNLSLG
Sbjct  102  AVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL+ C +  E  SDTV  VVVPSY++S+++V+ AW +YNLS+G+GLNKVAGKVFR
Sbjct  288  AVKAWGLELCVKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFR
Sbjct  286  AVDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFR  345

Query  7    IG  2
            IG
Sbjct  346  IG  347



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFR
Sbjct  283  AVDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFR  342

Query  7    IG  2
            IG
Sbjct  343  IG  344



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL  C +  +W SDTV  VVVPS+I+S++IVK A+ +YNLSLG+GLNKVAGKVFR
Sbjct  289  AVRAWGLTLCTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLNKVAGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL+ C +  E  SDTV  VVVPSY++S+++V+ AW +YNLS+G+GLNKVAGKVFR
Sbjct  288  AVKAWGLELCIKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNKVAGKVFR  347

Query  7    IG  2
            IG
Sbjct  348  IG  349



>ref|WP_026227793.1| serine--glyoxylate aminotransferase [Hoeflea sp. 108]
Length=396

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP  IDS+E+V+RA+  Y  SLG+GLNKVAGKVFR
Sbjct  282  AVDAWGLKVCAKEAKWNSDTVSAIVVPEGIDSAEVVRRAYHGYQTSLGVGLNKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>sp|O08374.2|SGAA_HYPME RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Hyphomicrobium methylovorum]
 dbj|BAA19919.1| serine-glyoxylate aminotransferase [Hyphomicrobium methylovorum]
Length=405

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  IDS+ I K A+ RYN S GLGLNKVAGKVFR
Sbjct  284  AVDAWGLKLCAKEPKWYSDTVSAILVPEGIDSNAITKTAYYRYNTSFGLGLNKVAGKVFR  343

Query  7    IG  2
            IG
Sbjct  344  IG  345



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -3

Query  178  AWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFRIG  2
            AWGLK C ++ +W SDTV  ++VP  +DS+ + K A+ RYN SLGLGLNKVAGKVFRIG
Sbjct  287  AWGLKLCAKEPKWYSDTVSAILVPEGVDSNAVTKTAYYRYNTSLGLGLNKVAGKVFRIG  345



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  EW SDTV  ++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  269  AVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFR  328

Query  7    IG  2
            IG
Sbjct  329  IG  330



>ref|WP_040969922.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3324]
 emb|CDX12804.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3324]
Length=396

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS+++VKRA+  Y  SLG GLNKVAGKVFR
Sbjct  282  AVDAWGLKLCAKAPQWHSDTVSAILVPEGIDSADVVKRAYRAYQTSLGGGLNKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_015599474.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|AGK59459.1| class V aminotransferase [Hyphomicrobium denitrificans 1NES1]
Length=406

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  181  QAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFRIG  2
             AWGLK C ++ +W SDTV  V+VP   DS+ + K A+ RYN SLGLGLNKVAGKVFRIG
Sbjct  287  HAWGLKLCAKEPKWHSDTVSAVLVPEGFDSNVVTKTAYYRYNTSLGLGLNKVAGKVFRIG  346



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  ID++ I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKEAKWNSDTVTAILVPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D++++++ A+ RYNL+LG GLNKVAGKVFR
Sbjct  287  AVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFR  346

Query  7    IG  2
            IG
Sbjct  347  IG  348



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D++++++ A+ RYNL+LG GLNKVAGKVFR
Sbjct  287  AVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFR  346

Query  7    IG  2
            IG
Sbjct  347  IG  348



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D++++++ A+ RYNL+LG GLNKVAGKVFR
Sbjct  287  AVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFR  346

Query  7    IG  2
            IG
Sbjct  347  IG  348



>ref|WP_020592928.1| hypothetical protein [Kiloniella laminariae]
Length=388

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGLK C QK +W SDTV  ++VP  I+  E++KRA+  +NLSLG GL ++AGK+FR
Sbjct  282  AVRAWGLKTCAQKAQWQSDTVTAIMVPEQINGQELIKRAYNDFNLSLGAGLARMAGKLFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>gb|AID30749.1| serine--glyoxylate aminotransferase [Mesorhizobium huakuii 7653R]
Length=249

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS++IVKRA+  Y  SLG GLNKV GKVFR
Sbjct  135  AVDAWGLKLCAKAPKWHSDTVSAILVPEGIDSADIVKRAYRTYQTSLGGGLNKVMGKVFR  194

Query  7    IG  2
            IG
Sbjct  195  IG  196



>ref|WP_042643125.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
 emb|CDX37204.1| Serine--glyoxylate aminotransferase [Mesorhizobium sp. ORS3359]
Length=396

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS+ +VKRA+  Y  SLG GLNKVAGKVFR
Sbjct  282  AVDAWGLKLCAKAPQWHSDTVSAILVPEGIDSANVVKRAYGAYQTSLGGGLNKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFR
Sbjct  292  AVAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_020188076.1| hypothetical protein [Methylopila sp. 73B]
Length=402

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +   W SDTV  ++ P  ID+++I++ A+ RYNL+LG GL+KVAG+VFR
Sbjct  285  AVDAWGLKLCAKSPRWHSDTVSAILAPEGIDAAKIIRHAYDRYNLALGAGLSKVAGRVFR  344

Query  7    IG  2
            IG
Sbjct  345  IG  346



>ref|WP_019858769.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS++IVKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPEGIDSADIVKRAYRTYQTSLGGGLNKVMGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_032930697.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
Length=396

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS++IVKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPEGIDSADIVKRAYRTYQTSLGGGLNKVMGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_010910076.1| serine--glyoxylate aminotransferase [Mesorhizobium loti]
 dbj|BAB48723.1| probable serine-glyoxylate aminotransferase [Mesorhizobium loti 
MAFF303099]
Length=396

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  + VP  IDS +IVKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAIQVPEGIDSGDIVKRAYRTYQTSLGGGLNKVMGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A +AWGL  C +K +W S  V  VVVPS +DS++++K AW +YNLSLGLGL +V GKVFR
Sbjct  289  AVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFR  348

Query  7    IG  2
            IG
Sbjct  349  IG  350



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_026362994.1| serine--glyoxylate aminotransferase [Methylopila sp. M107]
Length=402

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +   W SDTV  ++ P  ID+++I+  A+ RYNL+LG GL+KVAGKVFR
Sbjct  285  AIDAWGLKLCAKSPRWHSDTVSAILAPEGIDAAKIIATAYNRYNLALGAGLSKVAGKVFR  344

Query  7    IG  2
            IG
Sbjct  345  IG  346



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_023746858.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESY32439.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC391B00]
 gb|ESY41674.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LNJC384A00]
Length=396

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKTPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_023685219.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC277A00]
 gb|ESW64168.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC277A00]
Length=396

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKTPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_023698325.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC265A00]
 gb|ESX07643.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC265A00]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_023827347.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C131B0]
 gb|ESZ54884.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C131B0]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_023805485.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C089B000]
 gb|ESZ07011.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C089B000]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_023714322.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC422A00]
 gb|ESX62065.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC422A00]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTSLGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_018329867.1| serine--glyoxylate aminotransferase [Rhizobium giardinii]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D +E++K A+  YN SLG GL+KVAGKVFR
Sbjct  282  AVSAWGLKLCASEPKWYSDTVSAIRLPEGVDGAEVIKHAYRTYNTSLGSGLSKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP   D++++++ A+ RYNL+LG GL+KVAGKVFR
Sbjct  287  AVAAWGLKPCAKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSKVAGKVFR  346

Query  7    IG  2
            IG
Sbjct  347  IG  348



>ref|WP_037283573.1| serine--glyoxylate aminotransferase [Rubellimicrobium mesophilum]
 gb|EYD78102.1| Serine--glyoxylate aminotransferase [Rubellimicrobium mesophilum 
DSM 19309]
Length=396

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A QAWGL+ C ++  W SDTV  +VVP  +D++ +++RA+  YN SLG GL+KVAGKVFR
Sbjct  282  AVQAWGLRLCAKEPRWQSDTVSAIVVPEGVDATRVIRRAYEAYNTSLGSGLSKVAGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYN  56
            A +AWGLKNC QKEEW SDTV  VV+P YIDS+EIVKRAW RYN
Sbjct  98   AVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKRAWKRYN  141



>ref|WP_013949995.1| MULTISPECIES: serine--glyoxylate aminotransferase [Hyphomicrobium]
 emb|CCB67605.1| serine-glyoxylate aminotransferase [Hyphomicrobium sp. MC1]
Length=406

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  ++VP   D++ ++K A+ RYN SLG GLNKVAGKVFR
Sbjct  285  AVDAWGLKLCAKEPKWHSDTVSAILVPEGADANAVLKTAYYRYNTSLGTGLNKVAGKVFR  344

Query  7    IG  2
            IG
Sbjct  345  IG  346



>ref|WP_037460312.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=264

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D  E+++ A+  YN SLG GL+KVAGKVFR
Sbjct  150  AVSAWGLKLCATEPKWHSDTVSAIRLPEGVDGVEVIRHAYRTYNTSLGSGLSKVAGKVFR  209

Query  7    IG  2
            IG
Sbjct  210  IG  211



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D++++++ A+ RYNL+LG GL++VAGKVFR
Sbjct  287  AVAAWGLKTCAKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVAGKVFR  346

Query  7    IG  2
            IG
Sbjct  347  IG  348



>ref|WP_037399704.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=272

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D  E+++ A+  YN SLG GL+KVAGKVFR
Sbjct  158  AVSAWGLKLCATEPKWHSDTVSAIRLPEGVDGVEVIRHAYRTYNTSLGSGLSKVAGKVFR  217

Query  7    IG  2
            IG
Sbjct  218  IG  219



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_027044922.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. URHC0008]
Length=396

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS +IVKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPEGIDSGDIVKRAYQTYRTSLGGGLNKVFGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_037429341.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=263

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D  E+++ A+  YN SLG GL+KVAGKVFR
Sbjct  149  AVSAWGLKLCATEPKWHSDTVSAIRLPEGVDGVEVIRHAYRTYNTSLGSGLSKVAGKVFR  208

Query  7    IG  2
            IG
Sbjct  209  IG  210



>ref|WP_037437034.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=257

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D  E+++ A+  YN SLG GL+KVAGKVFR
Sbjct  143  AVSAWGLKLCATEPKWHSDTVSAIRLPEGVDGVEVIRHAYRTYNTSLGSGLSKVAGKVFR  202

Query  7    IG  2
            IG
Sbjct  203  IG  204



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  292  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFR  351

Query  7    IG  2
            IG
Sbjct  352  IG  353



>ref|WP_037447404.1| serine--glyoxylate aminotransferase, partial [Sinorhizobium fredii]
Length=273

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C  + +W SDTV  + +P  +D  E+++ A+  YN SLG GL+KVAGKVFR
Sbjct  159  AVSAWGLKLCATEPKWHSDTVSAIRLPEGVDGVEVIRHAYRTYNTSLGSGLSKVAGKVFR  218

Query  7    IG  2
            IG
Sbjct  219  IG  220



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLKNC  + +W SDTV  +VVP   + ++++  A+ RYNL+LG GL KVAGKVFR
Sbjct  290  AVSAWGLKNCATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAKVAGKVFR  349

Query  7    IG  2
            IG
Sbjct  350  IG  351



>ref|WP_023829410.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
 gb|ESZ58200.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L103C120A0]
Length=396

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  +LG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKASKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTALGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_023690974.1| MULTISPECIES: serine--glyoxylate aminotransferase [Mesorhizobium]
 gb|ESX05556.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSJC268A00]
 gb|ESX83696.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. LSHC412B00]
 gb|ESZ16765.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. L2C085B000]
Length=396

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  +DS ++VKRA+ +Y  +LG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKASKWHSDTVSAILVPDGVDSGDVVKRAYQKYQTALGGGLNKVIGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_027146511.1| serine--glyoxylate aminotransferase [Mesorhizobium sp. WSM3626]
Length=396

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS ++VKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AVDAWGLKLCAKAPKWHSDTVSAILVPDGIDSGDVVKRAYQAYQTSLGGGLNKVFGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>ref|WP_015317366.1| serine--glyoxylate aminotransferase [Mesorhizobium australicum]
 gb|AGB45946.1| serine-pyruvate aminotransferase/archaeal aspartate aminotransferase 
[Mesorhizobium australicum WSM2073]
Length=396

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C +  +W SDTV  ++VP  IDS ++VKRA+  Y  SLG GLNKV GKVFR
Sbjct  282  AADAWGLKLCARAPKWHSDTVSAILVPDGIDSGDVVKRAYQAYQTSLGGGLNKVFGKVFR  341

Query  7    IG  2
            IG
Sbjct  342  IG  343



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  187  AXQAWGLKNCXQKEEWXSDTvxvvvVPSYIDSSEIVKRAWXRYNLSLGLGLNKVAGKVFR  8
            A  AWGLK C ++ +W SDTV  +VVP   D+++++  A+ RYNLSLG GL+KVAGKVFR
Sbjct  333  AVAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFR  392

Query  7    IG  2
            IG
Sbjct  393  IG  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570351139820