BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004E02

Length=336
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF37798.1|  hypothetical protein                                 83.6    5e-20   Ipomoea trifida
ref|XP_008227403.1|  PREDICTED: histone deacetylase 9 isoform X2      73.2    3e-15   
emb|CDP06960.1|  unnamed protein product                              72.0    4e-15   Coffea canephora [robusta coffee]
ref|XP_010243527.1|  PREDICTED: histone deacetylase 9                 76.3    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_008458610.1|  PREDICTED: histone deacetylase 9 isoform X4      70.9    8e-15   Cucumis melo [Oriental melon]
ref|XP_004160104.1|  PREDICTED: histone deacetylase 9-like            70.9    8e-15   
ref|XP_009364273.1|  PREDICTED: histone deacetylase 9                 73.9    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_008458611.1|  PREDICTED: histone deacetylase 17 isoform X5     70.9    1e-14   
ref|XP_010093211.1|  Histone deacetylase 9                            70.5    1e-14   Morus notabilis
ref|XP_008458609.1|  PREDICTED: histone deacetylase 9 isoform X3      70.9    1e-14   Cucumis melo [Oriental melon]
ref|XP_008458605.1|  PREDICTED: histone deacetylase 9 isoform X1      70.9    1e-14   Cucumis melo [Oriental melon]
ref|XP_011005321.1|  PREDICTED: histone deacetylase 9 isoform X2      73.9    1e-14   Populus euphratica
ref|XP_004145792.1|  PREDICTED: histone deacetylase 9-like            70.9    1e-14   Cucumis sativus [cucumbers]
ref|XP_008458608.1|  PREDICTED: histone deacetylase 9 isoform X2      70.9    1e-14   Cucumis melo [Oriental melon]
ref|XP_011005320.1|  PREDICTED: histone deacetylase 9 isoform X1      73.9    1e-14   Populus euphratica
gb|KJB35350.1|  hypothetical protein B456_006G110500                  74.7    2e-14   Gossypium raimondii
gb|KDO51343.1|  hypothetical protein CISIN_1g0130382mg                72.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_011005322.1|  PREDICTED: histone deacetylase 9 isoform X3      73.9    2e-14   Populus euphratica
ref|XP_006471388.1|  PREDICTED: histone deacetylase 9-like            72.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_006424306.1|  hypothetical protein CICLE_v10029823mg           72.0    2e-14   Citrus clementina [clementine]
ref|XP_002300554.1|  histone deacetylase-related family protein       72.4    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006592310.1|  PREDICTED: histone deacetylase 9 isoform X2      70.9    2e-14   Glycine max [soybeans]
gb|KDP34706.1|  hypothetical protein JCGZ_10911                       72.4    2e-14   Jatropha curcas
ref|XP_007142469.1|  hypothetical protein PHAVU_008G283200g           72.4    2e-14   Phaseolus vulgaris [French bean]
gb|KCW50786.1|  hypothetical protein EUGRSUZ_J00456                   73.9    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010031477.1|  PREDICTED: histone deacetylase 9 isoform X1      73.9    2e-14   Eucalyptus grandis [rose gum]
gb|KHG07653.1|  Histone deacetylase 9 -like protein                   71.6    2e-14   Gossypium arboreum [tree cotton]
ref|XP_007132395.1|  hypothetical protein PHAVU_011G091100g           72.4    2e-14   Phaseolus vulgaris [French bean]
emb|CAN75079.1|  hypothetical protein VITISV_007579                   72.4    3e-14   Vitis vinifera
ref|XP_010651716.1|  PREDICTED: histone deacetylase 9                 72.4    3e-14   Vitis vinifera
ref|XP_003538135.1|  PREDICTED: histone deacetylase 9-like isofor...  71.6    3e-14   Glycine max [soybeans]
gb|KHN38656.1|  Histone deacetylase 9                                 71.6    3e-14   Glycine soja [wild soybean]
ref|XP_004506146.1|  PREDICTED: histone deacetylase 9-like            72.0    4e-14   Cicer arietinum [garbanzo]
gb|KHN21123.1|  Histone deacetylase 9                                 71.2    4e-14   Glycine soja [wild soybean]
ref|XP_009364877.1|  PREDICTED: histone deacetylase 9-like            72.0    4e-14   Pyrus x bretschneideri [bai li]
ref|XP_006591090.1|  PREDICTED: histone deacetylase 9-like isofor...  71.6    4e-14   
ref|XP_010242655.1|  PREDICTED: putative histone deacetylase 10       71.6    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003539814.1|  PREDICTED: histone deacetylase 9 isoform X1      70.5    6e-14   Glycine max [soybeans]
ref|XP_010661436.1|  PREDICTED: histone deacetylase 9 isoform X2      71.2    7e-14   Vitis vinifera
ref|XP_008788401.1|  PREDICTED: histone deacetylase 17 isoform X3     72.4    7e-14   Phoenix dactylifera
ref|XP_007205234.1|  hypothetical protein PRUPE_ppa006053mg           71.6    7e-14   Prunus persica
ref|XP_007015904.1|  Histone deacetylase 9 isoform 1                  70.9    8e-14   Theobroma cacao [chocolate]
ref|XP_008227393.1|  PREDICTED: histone deacetylase 9 isoform X1      70.1    8e-14   Prunus mume [ume]
ref|XP_008349785.1|  PREDICTED: histone deacetylase 9                 70.5    8e-14   Malus domestica [apple tree]
ref|XP_007015910.1|  Histone deacetylase 9 isoform 7                  70.9    9e-14   
ref|XP_009404813.1|  PREDICTED: histone deacetylase 9 isoform X2      70.5    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010031478.1|  PREDICTED: histone deacetylase 9 isoform X2      74.3    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010940301.1|  PREDICTED: histone deacetylase 9                 71.6    1e-13   Elaeis guineensis
ref|XP_008788384.1|  PREDICTED: histone deacetylase 9 isoform X1      72.0    1e-13   Phoenix dactylifera
gb|ACU20217.1|  unknown                                               70.5    2e-13   Glycine max [soybeans]
ref|XP_002266492.1|  PREDICTED: histone deacetylase 9 isoform X1      71.2    2e-13   Vitis vinifera
emb|CAN77816.1|  hypothetical protein VITISV_020659                   71.2    2e-13   Vitis vinifera
ref|XP_009605994.1|  PREDICTED: histone deacetylase 9                 71.2    2e-13   Nicotiana tomentosiformis
ref|XP_002529076.1|  histone deacetylase 1, 2 ,3, putative            69.3    2e-13   Ricinus communis
ref|XP_009404814.1|  PREDICTED: histone deacetylase 9 isoform X3      70.5    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404815.1|  PREDICTED: histone deacetylase 9 isoform X4      70.1    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404812.1|  PREDICTED: histone deacetylase 9 isoform X1      70.1    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004251031.1|  PREDICTED: histone deacetylase 9                 71.2    4e-13   Solanum lycopersicum
ref|XP_006419115.1|  hypothetical protein EUTSA_v10002540mg           67.4    5e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006279377.1|  hypothetical protein CARUB_v10007995mg           66.6    7e-13   Capsella rubella
gb|KEH29890.1|  histone deacetylase family protein                    67.8    7e-13   Medicago truncatula
ref|XP_004300044.1|  PREDICTED: histone deacetylase 9                 67.4    7e-13   Fragaria vesca subsp. vesca
ref|XP_003606237.1|  Histone deacetylase                              67.8    8e-13   Medicago truncatula
ref|XP_010692976.1|  PREDICTED: histone deacetylase 9 isoform X4      66.6    8e-13   
ref|XP_010692974.1|  PREDICTED: histone deacetylase 9 isoform X2      66.2    8e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006349095.1|  PREDICTED: histone deacetylase 9-like            69.7    1e-12   Solanum tuberosum [potatoes]
ref|XP_010692973.1|  PREDICTED: histone deacetylase 9 isoform X1      66.2    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692975.1|  PREDICTED: histone deacetylase 17 isoform X3     65.9    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008668621.1|  PREDICTED: histone deacetylase isoform X1        66.6    2e-12   Zea mays [maize]
ref|XP_010503116.1|  PREDICTED: histone deacetylase 9-like            65.5    2e-12   Camelina sativa [gold-of-pleasure]
emb|CDY08684.1|  BnaC03g54980D                                        63.5    2e-12   Brassica napus [oilseed rape]
ref|XP_009150313.1|  PREDICTED: histone deacetylase 9                 63.5    2e-12   
ref|XP_010514792.1|  PREDICTED: histone deacetylase 9                 64.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002877352.1|  hypothetical protein ARALYDRAFT_347545           64.3    4e-12   
emb|CAB72470.1|  putative protein                                     63.9    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190054.2|  histone deacetylase 9                               63.9    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACR37742.1|  unknown                                               66.2    5e-12   Zea mays [maize]
ref|NP_190035.1|  histone deacetylase 17                              64.7    5e-12   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA37954.1|  TPA: histone deacetylase                             66.2    5e-12   
ref|NP_001105077.1|  histone deacetylase                              66.2    5e-12   Zea mays [maize]
tpg|DAA37953.1|  TPA: histone deacetylase, mRNA                       66.2    5e-12   
ref|NP_190052.1|  histone deacetylase 10                              64.3    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425885.1|  PREDICTED: histone deacetylase 9 isoform X1      64.7    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006851552.1|  hypothetical protein AMTR_s00040p00182290        67.4    8e-12   
ref|XP_010425886.1|  PREDICTED: histone deacetylase 17 isoform X2     64.3    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006652253.1|  PREDICTED: histone deacetylase 9-like            66.2    2e-11   Oryza brachyantha
ref|XP_010541291.1|  PREDICTED: histone deacetylase 9 isoform X1      61.6    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_001774667.1|  class I RPD3 type histone deacetylase protein    67.0    2e-11   
gb|EYU36088.1|  hypothetical protein MIMGU_mgv1a006831mg              64.3    2e-11   Erythranthe guttata [common monkey flower]
gb|AAS79608.1|  putative histone deacetylase                          69.3    3e-11   Ipomoea trifida
ref|XP_010541292.1|  PREDICTED: histone deacetylase 9 isoform X2      61.6    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_002446401.1|  hypothetical protein SORBIDRAFT_06g015420        66.2    4e-11   Sorghum bicolor [broomcorn]
ref|XP_011090014.1|  PREDICTED: histone deacetylase 17 isoform X2     62.8    4e-11   Sesamum indicum [beniseed]
ref|XP_011090013.1|  PREDICTED: histone deacetylase 9 isoform X1      62.8    5e-11   Sesamum indicum [beniseed]
tpg|DAA37952.1|  TPA: hypothetical protein ZEAMMB73_714519            64.3    6e-11   
gb|EMT12816.1|  Histone deacetylase 9                                 65.1    6e-11   
ref|XP_003579685.1|  PREDICTED: histone deacetylase 9 isoform X1      65.9    6e-11   Brachypodium distachyon [annual false brome]
ref|XP_004975539.1|  PREDICTED: histone deacetylase 9-like isofor...  64.3    6e-11   
emb|CAE04901.1|  OSJNBa0042I15.23                                     63.9    9e-11   Oryza sativa Japonica Group [Japonica rice]
gb|ACD50313.1|  histone deacetylase RPD3/HDA1 class I isoform 1       65.1    1e-10   Hordeum vulgare [barley]
emb|CAH66503.1|  H0321H01.12                                          63.9    1e-10   Oryza sativa [red rice]
ref|NP_001052725.1|  Os04g0409600                                     63.9    1e-10   
ref|XP_004975538.1|  PREDICTED: histone deacetylase 9-like isofor...  64.3    1e-10   Setaria italica
ref|XP_002966032.1|  hypothetical protein SELMODRAFT_84957            60.1    4e-10   
ref|XP_002971460.1|  hypothetical protein SELMODRAFT_172161           59.7    5e-10   
ref|XP_008373732.1|  PREDICTED: LOW QUALITY PROTEIN: putative his...  54.3    7e-09   
gb|KCW50787.1|  hypothetical protein EUGRSUZ_J00456                   54.7    1e-08   Eucalyptus grandis [rose gum]
ref|XP_007015905.1|  Histone deacetylase 9 isoform 2                  52.0    3e-08   
gb|EPS60094.1|  histone deacetylase                                   52.0    8e-08   Genlisea aurea
gb|EYU36089.1|  hypothetical protein MIMGU_mgv1a006831mg              48.9    7e-07   Erythranthe guttata [common monkey flower]



>dbj|BAF37798.1| hypothetical protein [Ipomoea trifida]
Length=496

 Score = 83.6 bits (205),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            PSVQMQEVPP FYIPDFDEDTQN DERLDQHTQDKQIQRDDEYYEGDNDNDHSMDDA
Sbjct  440  PSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEGDNDNDHSMDDA  496


 Score = 40.4 bits (93),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 18/23 (78%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K+HVLENL YIQHAP
Sbjct  418  SKSYLGTIKTHVLENLRYIQHAP  440



>ref|XP_008227403.1| PREDICTED: histone deacetylase 9 isoform X2 [Prunus mume]
Length=343

 Score = 73.2 bits (178),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P+VQMQEVPP FYIPDFDED QN DER+DQHT+DK IQR
Sbjct  287  PNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHIQR  325


 Score = 34.7 bits (78),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K+ VLENL  IQHAP
Sbjct  265  SKSYISTIKTQVLENLRCIQHAP  287



>emb|CDP06960.1| unnamed protein product [Coffea canephora]
Length=430

 Score = 72.0 bits (175),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            P VQMQEVPP FY+PDFDED QN DER+DQHTQDKQIQRDDEYY+GDNDNDH+M+D
Sbjct  374  PGVQMQEVPPDFYLPDFDEDEQNPDERMDQHTQDKQIQRDDEYYDGDNDNDHNMED  429


 Score = 35.4 bits (80),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K +VLENL YIQHAP
Sbjct  352  SKSYLGTIKMNVLENLRYIQHAP  374



>ref|XP_010243527.1| PREDICTED: histone deacetylase 9 [Nelumbo nucifera]
Length=430

 Score = 76.3 bits (186),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQRDDEYYEGDNDND SMDDA
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKQIQRDDEYYEGDNDNDQSMDDA  430


 Score = 30.8 bits (68),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  V ENL  IQHAP
Sbjct  352  SKSYLGTIKMQVFENLRCIQHAP  374



>ref|XP_008458610.1| PREDICTED: histone deacetylase 9 isoform X4 [Cucumis melo]
Length=382

 Score = 70.9 bits (172),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  326  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  364


 Score = 35.4 bits (80),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  304  TKSYLSTIKTQVLENLRFIQHAP  326



>ref|XP_004160104.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus]
Length=248

 Score = 70.9 bits (172),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  192  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  230


 Score = 35.4 bits (80),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  170  TKSYLSTIKTQVLENLRFIQHAP  192



>ref|XP_009364273.1| PREDICTED: histone deacetylase 9 [Pyrus x bretschneideri]
Length=430

 Score = 73.9 bits (180),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQEVPP FYIPDFDED QN DERLDQHTQDK IQRDDEYYEGDNDNDH+M+D
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERLDQHTQDKNIQRDDEYYEGDNDNDHNMED  429


 Score = 32.3 bits (72),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKIQVLENLRCIQHAP  374



>ref|XP_008458611.1| PREDICTED: histone deacetylase 17 isoform X5 [Cucumis melo]
Length=183

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  127  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  165


 Score = 35.4 bits (80),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  105  TKSYLSTIKTQVLENLRFIQHAP  127



>ref|XP_010093211.1| Histone deacetylase 9 [Morus notabilis]
 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis]
Length=429

 Score = 70.5 bits (171),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQH +DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHARDKQIQR  412


 Score = 35.4 bits (80),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 17/23 (74%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL YIQHAP
Sbjct  352  SKSYLGTIKVQVLENLRYIQHAP  374



>ref|XP_008458609.1| PREDICTED: histone deacetylase 9 isoform X3 [Cucumis melo]
Length=405

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  349  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  387


 Score = 34.7 bits (78),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  327  TKSYLSTIKTQVLENLRFIQHAP  349



>ref|XP_008458605.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
 ref|XP_008458606.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
Length=430

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  374  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  412


 Score = 34.7 bits (78),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  352  TKSYLSTIKTQVLENLRFIQHAP  374



>ref|XP_011005321.1| PREDICTED: histone deacetylase 9 isoform X2 [Populus euphratica]
Length=433

 Score = 73.9 bits (180),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  378  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  416


 Score = 31.6 bits (70),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VL+NL  IQHAP
Sbjct  356  SKSYLSTIKMQVLDNLRCIQHAP  378



>ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus]
 gb|KGN46931.1| hypothetical protein Csa_6G151680 [Cucumis sativus]
Length=430

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  374  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  412


 Score = 34.7 bits (78),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  352  TKSYLSTIKTQVLENLRFIQHAP  374



>ref|XP_008458608.1| PREDICTED: histone deacetylase 9 isoform X2 [Cucumis melo]
Length=413

 Score = 70.9 bits (172),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+++HTQDKQIQR
Sbjct  357  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  395


 Score = 34.7 bits (78),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SYL T K+ VLENL +IQHAP
Sbjct  335  TKSYLSTIKTQVLENLRFIQHAP  357



>ref|XP_011005320.1| PREDICTED: histone deacetylase 9 isoform X1 [Populus euphratica]
Length=458

 Score = 73.9 bits (180),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  403  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  441


 Score = 31.6 bits (70),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VL+NL  IQHAP
Sbjct  381  SKSYLSTIKMQVLDNLRCIQHAP  403



>gb|KJB35350.1| hypothetical protein B456_006G110500 [Gossypium raimondii]
Length=240

 Score = 74.7 bits (182),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMD  104
            P VQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQRDDEYY+GDNDNDH+MD
Sbjct  185  PGVQMQEVPPDFYIPDFDEDEQNADERMDQHTQDKQIQRDDEYYDGDNDNDHNMD  239


 Score = 30.8 bits (68),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T    VLENL  IQHAP
Sbjct  163  SKSYLKTITMQVLENLRSIQHAP  185



>gb|KDO51343.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51344.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51345.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
Length=220

 Score = 72.0 bits (175),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDKQIQR
Sbjct  165  PSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  203


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  143  SKSYLSTIKMQVLENLRSIQHAP  165



>ref|XP_011005322.1| PREDICTED: histone deacetylase 9 isoform X3 [Populus euphratica]
Length=429

 Score = 73.9 bits (180),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 31.2 bits (69),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VL+NL  IQHAP
Sbjct  352  SKSYLSTIKMQVLDNLRCIQHAP  374



>ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis]
Length=429

 Score = 72.0 bits (175),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRSIQHAP  374



>ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
 gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
Length=429

 Score = 72.0 bits (175),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRSIQHAP  374



>ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa]
 gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa]
Length=429

 Score = 72.4 bits (176),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP F+IPDFDED QN DER+DQHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 32.7 bits (73),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_006592310.1| PREDICTED: histone deacetylase 9 isoform X2 [Glycine max]
Length=352

 Score = 70.9 bits (172),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDK IQR
Sbjct  297  PSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  335


 Score = 34.3 bits (77),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  275  SKSYLSTIKMQVLENLRCIQHAP  297



>gb|KDP34706.1| hypothetical protein JCGZ_10911 [Jatropha curcas]
Length=430

 Score = 72.4 bits (176),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKHIQR  412


 Score = 32.7 bits (73),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_007142469.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
 gb|ESW14463.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
Length=429

 Score = 72.4 bits (176),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDK+IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRIQR  412


 Score = 32.7 bits (73),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>gb|KCW50786.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=430

 Score = 73.9 bits (180),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 30.8 bits (68),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL   K  VLENL  IQHAP
Sbjct  352  SKSYLSAIKVQVLENLRNIQHAP  374



>ref|XP_010031477.1| PREDICTED: histone deacetylase 9 isoform X1 [Eucalyptus grandis]
 gb|KCW50785.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=432

 Score = 73.9 bits (180),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  376  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  414


 Score = 30.8 bits (68),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL   K  VLENL  IQHAP
Sbjct  354  SKSYLSAIKVQVLENLRNIQHAP  376



>gb|KHG07653.1| Histone deacetylase 9 -like protein [Gossypium arboreum]
Length=240

 Score = 71.6 bits (174),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMD  104
            P VQMQEVPP FYIPDFDED  N DER+DQHTQDKQIQRDDEYY+GDNDNDH+MD
Sbjct  185  PGVQMQEVPPDFYIPDFDEDEHNPDERMDQHTQDKQIQRDDEYYDGDNDNDHNMD  239


 Score = 33.1 bits (74),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  163  SKSYLSTIKMQVLENLRSIQHAP  185



>ref|XP_007132395.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
 gb|ESW04389.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
Length=429

 Score = 72.4 bits (176),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDK+IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRIQR  412


 Score = 32.3 bits (72),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKIQVLENLRCIQHAP  374



>emb|CAN75079.1| hypothetical protein VITISV_007579 [Vitis vinifera]
Length=393

 Score = 72.4 bits (176),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHT+DKQIQR
Sbjct  337  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQIQR  375


 Score = 32.3 bits (72),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  315  SKSYLGTIKQQVLENLRCIQHAP  337



>ref|XP_010651716.1| PREDICTED: histone deacetylase 9 [Vitis vinifera]
 emb|CBI17064.3| unnamed protein product [Vitis vinifera]
Length=430

 Score = 72.4 bits (176),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHT+DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQIQR  412


 Score = 32.3 bits (72),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLGTIKQQVLENLRCIQHAP  374



>ref|XP_003538135.1| PREDICTED: histone deacetylase 9-like isoform X1 [Glycine max]
Length=429

 Score = 71.6 bits (174),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DERLDQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  412


 Score = 32.7 bits (73),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>gb|KHN38656.1| Histone deacetylase 9 [Glycine soja]
Length=429

 Score = 71.6 bits (174),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DERLDQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  412


 Score = 32.7 bits (73),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer arietinum]
Length=430

 Score = 72.0 bits (175),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDK IQRDDEYYEGDNDNDH MD A
Sbjct  374  PSVQMQEVPPDFYIPEFDEDLQNPDERIDQHTQDKHIQRDDEYYEGDNDNDHQMDIA  430


 Score = 32.3 bits (72),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>gb|KHN21123.1| Histone deacetylase 9 [Glycine soja]
Length=477

 Score = 71.2 bits (173),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDK IQR
Sbjct  422  PSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  460


 Score = 33.1 bits (74),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  400  SKSYLSTIKMQVLENLRCIQHAP  422



>ref|XP_009364877.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
 ref|XP_009339956.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
Length=429

 Score = 72.0 bits (175),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DERL+QHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERLNQHTQDKNIQR  412


 Score = 32.3 bits (72),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKIQVLENLRCIQHAP  374



>ref|XP_006591090.1| PREDICTED: histone deacetylase 9-like isoform X2 [Glycine max]
Length=421

 Score = 71.6 bits (174),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DERLDQHTQDK IQR
Sbjct  366  PSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  404


 Score = 32.7 bits (73),  Expect(2) = 4e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  344  SKSYLSTIKMQVLENLRCIQHAP  366



>ref|XP_010242655.1| PREDICTED: putative histone deacetylase 10 [Nelumbo nucifera]
Length=145

 Score = 71.6 bits (174),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  90   PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKQIQR  128


 Score = 32.3 bits (72),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  68   SKSYLGTIKMQVLENLRCIQHAP  90



>ref|XP_003539814.1| PREDICTED: histone deacetylase 9 isoform X1 [Glycine max]
Length=429

 Score = 70.5 bits (171),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  412


 Score = 32.7 bits (73),  Expect(2) = 6e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_010661436.1| PREDICTED: histone deacetylase 9 isoform X2 [Vitis vinifera]
Length=241

 Score = 71.2 bits (173),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHT+D+QIQR
Sbjct  185  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  223


 Score = 32.3 bits (72),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  163  SKSYIGTIKMQVLENLRCIQHAP  185



>ref|XP_008788401.1| PREDICTED: histone deacetylase 17 isoform X3 [Phoenix dactylifera]
Length=241

 Score = 72.4 bits (176),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+ QHTQDKQIQR
Sbjct  184  PSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQR  222


 Score = 31.2 bits (69),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  162  SKSYLSTIKVQVLESLRCIQHAP  184



>ref|XP_007205234.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
 gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
Length=430

 Score = 71.6 bits (174),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P+VQMQEVPP FYIPDFDED QN DER+DQHTQDK IQR
Sbjct  374  PNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTQDKHIQR  412


 Score = 31.6 bits (70),  Expect(2) = 7e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  352  SKSYISTIKMQVLENLRCIQHAP  374



>ref|XP_007015904.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
 gb|EOY33523.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
Length=429

 Score = 70.9 bits (172),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP F+IPDFDED QN DER+DQHTQDKQIQR
Sbjct  374  PGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  412


 Score = 32.3 bits (72),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  352  SKSYISTIKMQVLENLRCIQHAP  374



>ref|XP_008227393.1| PREDICTED: histone deacetylase 9 isoform X1 [Prunus mume]
Length=430

 Score = 70.1 bits (170),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P+VQMQEVPP FYIPDFDED QN DER+DQHT+DK IQR
Sbjct  374  PNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHIQR  412


 Score = 32.7 bits (73),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K+ VLENL  IQHAP
Sbjct  352  SKSYISTIKTQVLENLRCIQHAP  374



>ref|XP_008349785.1| PREDICTED: histone deacetylase 9 [Malus domestica]
Length=430

 Score = 70.5 bits (171),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DERLDQ+TQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERLDQNTQDKHIQR  412


 Score = 32.3 bits (72),  Expect(2) = 8e-14, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKIQVLENLRCIQHAP  374



>ref|XP_007015910.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
 gb|EOY33529.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
Length=406

 Score = 70.9 bits (172),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP F+IPDFDED QN DER+DQHTQDKQIQR
Sbjct  368  PGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  406


 Score = 32.0 bits (71),  Expect(2) = 9e-14, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  346  SKSYISTIKMQVLENLRCIQHAP  368



>ref|XP_009404813.1| PREDICTED: histone deacetylase 9 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 70.5 bits (171),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVPP FYIP+FDED QN DER+DQHT DKQIQRDDEY+EGDNDNDH+M+D 
Sbjct  297  PGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGDNDNDHNMEDG  353


 Score = 32.0 bits (71),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  275  SKSYLSTIKVQVLESLRCIQHAP  297



>ref|XP_010031478.1| PREDICTED: histone deacetylase 9 isoform X2 [Eucalyptus grandis]
Length=243

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHTQDKQIQR
Sbjct  187  PSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  225



>ref|XP_010940301.1| PREDICTED: histone deacetylase 9 [Elaeis guineensis]
Length=431

 Score = 71.6 bits (174),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVPP FYIPDFDED QN DER+ QHTQDKQIQRDDEYY+GDNDNDH+M+D 
Sbjct  374  PGVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQRDDEYYDGDNDNDHNMEDG  430


 Score = 30.8 bits (68),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  352  SKSYLSTIKVQVLESLRCIQHAP  374



>ref|XP_008788384.1| PREDICTED: histone deacetylase 9 isoform X1 [Phoenix dactylifera]
Length=431

 Score = 72.0 bits (175),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+ QHTQDKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQR  412


 Score = 30.4 bits (67),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  352  SKSYLSTIKVQVLESLRCIQHAP  374



>gb|ACU20217.1| unknown [Glycine max]
Length=429

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIP+FDED QN DER+DQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  412


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLEN   IQHAP
Sbjct  352  SKSYLSTIKMQVLENFRCIQHAP  374



>ref|XP_002266492.1| PREDICTED: histone deacetylase 9 isoform X1 [Vitis vinifera]
 emb|CBI16725.3| unnamed protein product [Vitis vinifera]
Length=430

 Score = 71.2 bits (173),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHT+D+QIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  412


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  352  SKSYIGTIKMQVLENLRCIQHAP  374



>emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera]
Length=430

 Score = 71.2 bits (173),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQHT+D+QIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  412


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  352  SKSYIGTIKMQVLENLRCIQHAP  374



>ref|XP_009605994.1| PREDICTED: histone deacetylase 9 [Nicotiana tomentosiformis]
 ref|XP_009788798.1| PREDICTED: histone deacetylase 9 isoform X1 [Nicotiana sylvestris]
 ref|XP_009788799.1| PREDICTED: histone deacetylase 9 isoform X2 [Nicotiana sylvestris]
Length=430

 Score = 71.2 bits (173),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED QN DER+DQHTQDK IQR
Sbjct  374  PGVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKHIQR  412


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  V+ENL  IQHAP
Sbjct  352  SKSYIGTIKMQVMENLRCIQHAP  374



>ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis]
 gb|EEF33320.1| histone deacetylase 1, 2, 3, putative [Ricinus communis]
Length=429

 Score = 69.3 bits (168),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMD  104
            PSVQ+QEVPP FY+PDFDED QN DER++QHTQDK IQRDDEYYEGDND+DH+MD
Sbjct  374  PSVQLQEVPPDFYVPDFDEDEQNPDERVNQHTQDKHIQRDDEYYEGDNDHDHNMD  428


 Score = 32.7 bits (73),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_009404814.1| PREDICTED: histone deacetylase 9 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=324

 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVPP FYIP+FDED QN DER+DQHT DKQIQRDDEY+EGDNDNDH+M+D 
Sbjct  267  PGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGDNDNDHNMEDG  323


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  245  SKSYLSTIKVQVLESLRCIQHAP  267



>ref|XP_009404815.1| PREDICTED: histone deacetylase 9 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 70.1 bits (170),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVPP FYIP+FDED QN DER+DQHT DKQIQRDDEY+EGDNDNDH+M+D 
Sbjct  349  PGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGDNDNDHNMEDG  405


 Score = 30.8 bits (68),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  327  SKSYLSTIKVQVLESLRCIQHAP  349



>ref|XP_009404812.1| PREDICTED: histone deacetylase 9 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=431

 Score = 70.1 bits (170),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVPP FYIP+FDED QN DER+DQHT DKQIQRDDEY+EGDNDNDH+M+D 
Sbjct  374  PGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGDNDNDHNMEDG  430


 Score = 30.8 bits (68),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLE+L  IQHAP
Sbjct  352  SKSYLSTIKVQVLESLRCIQHAP  374



>ref|XP_004251031.1| PREDICTED: histone deacetylase 9 [Solanum lycopersicum]
Length=430

 Score = 71.2 bits (173),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER++QHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVNQHTQDKHIQR  412


 Score = 29.6 bits (65),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  V+ENL  +QHAP
Sbjct  352  SKSYIGTIKMQVMENLRCLQHAP  374



>ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
 gb|ESQ37551.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
Length=426

 Score = 67.4 bits (163),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  352  TKSYISSIKVQILENLRYIQHAP  374



>ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
 gb|EOA12275.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
Length=426

 Score = 66.6 bits (161),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN DER+DQ ++DKQ+QR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQVQR  412


 Score = 33.1 bits (74),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  352  TKSYISSIKVQILENLRYIQHAP  374



>gb|KEH29890.1| histone deacetylase family protein [Medicago truncatula]
Length=405

 Score = 67.8 bits (164),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPD DED QN DER DQHTQDK IQR
Sbjct  349  PSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHIQR  387


 Score = 32.0 bits (71),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  V+ENL  IQHAP
Sbjct  327  SKSYLSTIKMQVMENLRCIQHAP  349



>ref|XP_004300044.1| PREDICTED: histone deacetylase 9 [Fragaria vesca subsp. vesca]
Length=430

 Score = 67.4 bits (163),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            PSVQ+ EVPP FYIPDFDED QN DER+ QHTQDK IQRDDEYYEGDNDNDH+M+D 
Sbjct  374  PSVQLHEVPPDFYIPDFDEDEQNPDERVHQHTQDKHIQRDDEYYEGDNDNDHNMEDT  430


 Score = 32.3 bits (72),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLSTIKMQVLENLRCIQHAP  374



>ref|XP_003606237.1| Histone deacetylase [Medicago truncatula]
 gb|AES88434.1| histone deacetylase family protein [Medicago truncatula]
Length=430

 Score = 67.8 bits (164),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPD DED QN DER DQHTQDK IQR
Sbjct  374  PSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHIQR  412


 Score = 32.0 bits (71),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  V+ENL  IQHAP
Sbjct  352  SKSYLSTIKMQVMENLRCIQHAP  374



>ref|XP_010692976.1| PREDICTED: histone deacetylase 9 isoform X4 [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score = 66.6 bits (161),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQEVPP FY+PDFDED +N DER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  185  PSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  239


 Score = 33.1 bits (74),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  163  SKSYLTTIKMQVLENLRCIQHAP  185



>ref|XP_010692974.1| PREDICTED: histone deacetylase 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=403

 Score = 66.2 bits (160),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQEVPP FY+PDFDED +N DER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  348  PSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  402


 Score = 33.5 bits (75),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  326  SKSYLTTIKMQVLENLRCIQHAP  348



>ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum]
Length=430

 Score = 69.7 bits (169),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP F+IPDFDED QN DER++QHTQDK IQR
Sbjct  374  PSVQMQEVPPDFFIPDFDEDEQNPDERVNQHTQDKHIQR  412


 Score = 29.6 bits (65),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  V+ENL  +QHAP
Sbjct  352  SKSYIGTIKMQVMENLRCLQHAP  374



>ref|XP_010692973.1| PREDICTED: histone deacetylase 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=429

 Score = 66.2 bits (160),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQEVPP FY+PDFDED +N DER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  374  PSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  428


 Score = 32.7 bits (73),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  352  SKSYLTTIKMQVLENLRCIQHAP  374



>ref|XP_010692975.1| PREDICTED: histone deacetylase 17 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=168

 Score = 65.9 bits (159),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQEVPP FY+PDFDED +N DER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  113  PSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  167


 Score = 33.1 bits (74),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  91   SKSYLTTIKMQVLENLRCIQHAP  113



>ref|XP_008668621.1| PREDICTED: histone deacetylase isoform X1 [Zea mays]
Length=363

 Score = 66.6 bits (161),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  307  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  345


 Score = 32.3 bits (72),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L YIQHAP
Sbjct  285  SKTYLSSIKVQVMESLRYIQHAP  307



>ref|XP_010503116.1| PREDICTED: histone deacetylase 9-like [Camelina sativa]
Length=426

 Score = 65.5 bits (158),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNRDVRVDQRSRDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  352  TKSYISSIKVQILENLRYIQHAP  374



>emb|CDY08684.1| BnaC03g54980D [Brassica napus]
Length=401

 Score = 63.5 bits (153),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED +N D R+DQ ++DKQIQR
Sbjct  349  PSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQIQR  387


 Score = 34.7 bits (78),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ T K+ +L+NL YIQHAP
Sbjct  327  TKSYISTIKAQILDNLRYIQHAP  349



>ref|XP_009150313.1| PREDICTED: histone deacetylase 9 [Brassica rapa]
 emb|CDX99186.1| BnaA06g18770D [Brassica napus]
Length=426

 Score = 63.5 bits (153),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED +N D R+DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQIQR  412


 Score = 34.7 bits (78),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ T K+ +L+NL YIQHAP
Sbjct  352  TKSYISTIKAQILDNLRYIQHAP  374



>ref|XP_010514792.1| PREDICTED: histone deacetylase 9 [Camelina sativa]
Length=426

 Score = 64.7 bits (156),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 3e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  352  TKSYISSIKVQILENLRYIQHAP  374



>ref|XP_002877352.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53611.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
Length=1443

 Score = 64.3 bits (155),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268   PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
             PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQ+QR
Sbjct  1391  PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQVQR  1429


 Score = 32.7 bits (73),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335   SXSYLXTXKSHVLENLXYIQHAP  267
             + SY+ + K  +LENL YIQHAP
Sbjct  1369  TKSYISSIKVQILENLRYIQHAP  1391



>emb|CAB72470.1| putative protein [Arabidopsis thaliana]
Length=419

 Score = 63.9 bits (154),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R DQ ++DKQIQR
Sbjct  367  PSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQIQR  405


 Score = 33.5 bits (75),  Expect(2) = 4e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  345  TKSYISSIKVQILENLRYIQHAP  367



>ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana]
 sp|Q8H0W2.1|HDA9_ARATH RecName: Full=Histone deacetylase 9 [Arabidopsis thaliana]
 gb|AAN72014.1| putative protein [Arabidopsis thaliana]
 gb|AAP31920.1| At3g44680 [Arabidopsis thaliana]
 gb|AEE77930.1| histone deacetylase 9 [Arabidopsis thaliana]
Length=426

 Score = 63.9 bits (154),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQIQR  412


 Score = 33.1 bits (74),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  352  TKSYISSIKVQILENLRYIQHAP  374



>gb|ACR37742.1| unknown [Zea mays]
Length=405

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  349  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  387


 Score = 30.8 bits (68),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L YIQHAP
Sbjct  327  SKTYLSSIKVQVMESLRYIQHAP  349



>ref|NP_190035.1| histone deacetylase 17 [Arabidopsis thaliana]
 sp|Q9LXN8.1|HDA17_ARATH RecName: Full=Histone deacetylase 17 [Arabidopsis thaliana]
 emb|CAB88531.1| putative protein [Arabidopsis thaliana]
 gb|AEE77907.1| histone deacetylase 17 [Arabidopsis thaliana]
Length=158

 Score = 64.7 bits (156),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  106  PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  144


 Score = 32.3 bits (72),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  84   TKSYISSIKVQILENLRYIQHAP  106



>tpg|DAA37954.1| TPA: histone deacetylase [Zea mays]
Length=427

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  371  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  409


 Score = 30.8 bits (68),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L YIQHAP
Sbjct  349  SKTYLSSIKVQVMESLRYIQHAP  371



>ref|NP_001105077.1| histone deacetylase [Zea mays]
 gb|AAL33655.1|AF440228_1 histone deacetylase [Zea mays]
 gb|ACF83162.1| unknown [Zea mays]
 gb|ACG38577.1| histone deacetylase [Zea mays]
Length=430

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  374  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412


 Score = 30.8 bits (68),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L YIQHAP
Sbjct  352  SKTYLSSIKVQVMESLRYIQHAP  374



>tpg|DAA37953.1| TPA: histone deacetylase, mRNA [Zea mays]
Length=432

 Score = 66.2 bits (160),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  376  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  414


 Score = 30.4 bits (67),  Expect(2) = 5e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L YIQHAP
Sbjct  354  SKTYLSSIKVQVMESLRYIQHAP  376



>ref|NP_190052.1| histone deacetylase 10 [Arabidopsis thaliana]
 sp|Q9M1N8.1|HDA10_ARATH RecName: Full=Putative histone deacetylase 10 [Arabidopsis thaliana]
 emb|CAB72468.1| putative protein [Arabidopsis thaliana]
 gb|AEE77927.1| histone deacetylase 10 [Arabidopsis thaliana]
Length=142

 Score = 64.3 bits (155),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  90   PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  128


 Score = 32.3 bits (72),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  68   TKSYISSIKVQILENLRYIQHAP  90



>ref|XP_010425885.1| PREDICTED: histone deacetylase 9 isoform X1 [Camelina sativa]
Length=426

 Score = 64.7 bits (156),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  374  PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  412


 Score = 31.6 bits (70),  Expect(2) = 7e-12, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL +IQHAP
Sbjct  352  TKSYISSIKVQILENLRFIQHAP  374



>ref|XP_006851552.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
 gb|ERN13133.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
Length=432

 Score = 67.4 bits (163),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQMQEVP  FYIPD DED QN DER+DQHT+DKQIQR+DEYY+GDNDNDH+M+DA
Sbjct  375  PGVQMQEVPRDFYIPDSDEDEQNPDERVDQHTEDKQIQREDEYYDGDNDNDHTMEDA  431


 Score = 28.9 bits (63),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL + K  V+E+L  IQHAP
Sbjct  353  SKSYLSSIKVQVMESLRCIQHAP  375



>ref|XP_010425886.1| PREDICTED: histone deacetylase 17 isoform X2 [Camelina sativa]
Length=156

 Score = 64.3 bits (155),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  104  PSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  142


 Score = 31.2 bits (69),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL +IQHAP
Sbjct  82   TKSYISSIKVQILENLRFIQHAP  104



>ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza brachyantha]
Length=430

 Score = 66.2 bits (160),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  374  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412


 Score = 28.9 bits (63),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL + K  V+E+L  IQHAP
Sbjct  352  SKSYLSSIKVQVMESLRAIQHAP  374



>ref|XP_010541291.1| PREDICTED: histone deacetylase 9 isoform X1 [Tarenaya hassleriana]
Length=426

 Score = 61.6 bits (148),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDF+ED QN D R+DQ  +DK IQR
Sbjct  375  PSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKHIQR  413


 Score = 33.5 bits (75),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  353  TKSYISSIKVQILENLRYIQHAP  375



>ref|XP_001774667.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
 gb|EDQ60482.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
Length=431

 Score = 67.0 bits (162),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQM EVPP  YIP+FDED  N DER+DQHTQDK IQR
Sbjct  375  PSVQMHEVPPDTYIPEFDEDELNPDERMDQHTQDKHIQR  413


 Score = 28.1 bits (61),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = -2

Query  329  SYLXTXKSHVLENLXYIQHAP  267
            +YL T K  V+ENL  I HAP
Sbjct  355  TYLSTIKQQVMENLRRIAHAP  375



>gb|EYU36088.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=430

 Score = 64.3 bits (155),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  N D+R+++H QDKQ+QR
Sbjct  374  PGVQMQEVPPDFYIPDFDEDQHNPDQRVNRHAQDKQVQR  412


 Score = 30.4 bits (67),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T +  V ENL  IQHAP
Sbjct  352  SKSYLNTIRQQVCENLSAIQHAP  374



>gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida]
Length=438

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 53/63 (84%), Gaps = 2/63 (3%)
 Frame = -3

Query  286  DTSSMLPSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSM  107
            D S  +P   +  VPP FYIPDFDEDTQN DERLDQHTQDKQIQRDDEYYEGDNDNDHSM
Sbjct  378  DYSLKIPGGHI--VPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEGDNDNDHSM  435

Query  106  DDA  98
            DDA
Sbjct  436  DDA  438



>ref|XP_010541292.1| PREDICTED: histone deacetylase 9 isoform X2 [Tarenaya hassleriana]
Length=237

 Score = 61.6 bits (148),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            PSVQMQEVPP FYIPDF+ED QN D R+DQ  +DK IQR
Sbjct  186  PSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKHIQR  224


 Score = 32.7 bits (73),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + SY+ + K  +LENL YIQHAP
Sbjct  164  TKSYISSIKVQILENLRYIQHAP  186



>ref|XP_002446401.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
 gb|EES10729.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
Length=430

 Score = 66.2 bits (160),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  374  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412


 Score = 27.3 bits (59),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  352  SKTYLSSIKVQVMESLRSIQHAP  374



>ref|XP_011090014.1| PREDICTED: histone deacetylase 17 isoform X2 [Sesamum indicum]
Length=252

 Score = 62.8 bits (151),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQM EVPP FYIPDFDED  N DER+++H QDK IQRDDEYYEGDNDND +MDD+
Sbjct  196  PGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHIQRDDEYYEGDNDNDQTMDDS  252


 Score = 30.8 bits (68),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T +  V ENL  IQHAP
Sbjct  174  SKSYLNTIRQQVCENLSSIQHAP  196



>ref|XP_011090013.1| PREDICTED: histone deacetylase 9 isoform X1 [Sesamum indicum]
Length=430

 Score = 62.8 bits (151),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQM EVPP FYIPDFDED  N DER+++H QDK IQR
Sbjct  374  PGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHIQR  412


 Score = 30.8 bits (68),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T +  V ENL  IQHAP
Sbjct  352  SKSYLNTIRQQVCENLSSIQHAP  374



>tpg|DAA37952.1| TPA: hypothetical protein ZEAMMB73_714519 [Zea mays]
Length=84

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQI R
Sbjct  28   PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  66



>gb|EMT12816.1| Histone deacetylase 9 [Aegilops tauschii]
Length=381

 Score = 65.1 bits (157),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FY+PDFDED  + DER+DQHTQDKQ+ R
Sbjct  325  PGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQVHR  363


 Score = 28.1 bits (61),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  303  SKTYLSSIKVQVMESLRAIQHAP  325



>ref|XP_003579685.1| PREDICTED: histone deacetylase 9 isoform X1 [Brachypodium distachyon]
Length=430

 Score = 65.9 bits (159),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQHTQDKQ+ R
Sbjct  374  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQVHR  412


 Score = 27.7 bits (60),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  352  SKTYLSSIKVQVMESLRAIQHAP  374



>ref|XP_004975539.1| PREDICTED: histone deacetylase 9-like isoform X2 [Setaria italica]
Length=364

 Score = 64.3 bits (155),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQH QDKQI R
Sbjct  308  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQIHR  346


 Score = 28.9 bits (63),  Expect(2) = 6e-11, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  286  SKTYLSSIKVQVMESLRSIQHAP  308



>emb|CAE04901.1| OSJNBa0042I15.23 [Oryza sativa Japonica Group]
Length=254

 Score = 63.9 bits (154),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPD DED  + DER+DQHTQDKQI R
Sbjct  198  PGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQIHR  236


 Score = 28.9 bits (63),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL + K  V+E+L  IQHAP
Sbjct  176  SKSYLSSIKVQVMESLRAIQHAP  198



>gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [Hordeum vulgare]
Length=430

 Score = 65.1 bits (157),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FY+PDFDED  + DER+DQHTQDKQ+ R
Sbjct  374  PGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQVHR  412


 Score = 27.7 bits (60),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  352  SKTYLSSIKVQVMESLRAIQHAP  374



>emb|CAH66503.1| H0321H01.12 [Oryza sativa Indica Group]
 gb|EEC77239.1| hypothetical protein OsI_15792 [Oryza sativa Indica Group]
 gb|EEE60951.1| hypothetical protein OsJ_14708 [Oryza sativa Japonica Group]
Length=430

 Score = 63.9 bits (154),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPD DED  + DER+DQHTQDKQI R
Sbjct  374  PGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQIHR  412


 Score = 28.9 bits (63),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL + K  V+E+L  IQHAP
Sbjct  352  SKSYLSSIKVQVMESLRAIQHAP  374



>ref|NP_001052725.1| Os04g0409600 [Oryza sativa Japonica Group]
 dbj|BAF14639.1| Os04g0409600, partial [Oryza sativa Japonica Group]
Length=309

 Score = 63.9 bits (154),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPD DED  + DER+DQHTQDKQI R
Sbjct  253  PGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQIHR  291


 Score = 28.9 bits (63),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL + K  V+E+L  IQHAP
Sbjct  231  SKSYLSSIKVQVMESLRAIQHAP  253



>ref|XP_004975538.1| PREDICTED: histone deacetylase 9-like isoform X1 [Setaria italica]
Length=430

 Score = 64.3 bits (155),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQMQEVPP FYIPDFDED  + DER+DQH QDKQI R
Sbjct  374  PGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQIHR  412


 Score = 27.7 bits (60),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S +YL + K  V+E+L  IQHAP
Sbjct  352  SKTYLSSIKVQVMESLRSIQHAP  374



>ref|XP_002966032.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
 gb|EFJ33452.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
Length=432

 Score = 60.1 bits (144),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQM EVPP  Y PDFDE+  N DERLDQHTQDK +QR
Sbjct  377  PGVQMHEVPPDTYFPDFDEEDFNPDERLDQHTQDKSVQR  415


 Score = 30.4 bits (67),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + +YL   K  VLENL +IQHAP
Sbjct  355  TKAYLSAIKMQVLENLRHIQHAP  377



>ref|XP_002971460.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
 gb|EFJ27209.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
Length=432

 Score = 59.7 bits (143),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQHTQDKQIQR  152
            P VQM EVPP  Y PDFDE   N DERLDQHTQDK +QR
Sbjct  377  PGVQMHEVPPDTYFPDFDEGDFNPDERLDQHTQDKSVQR  415


 Score = 30.4 bits (67),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 13/23 (57%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            + +YL   K  VLENL +IQHAP
Sbjct  355  TKAYLSAIKMQVLENLRHIQHAP  377



>ref|XP_008373732.1| PREDICTED: LOW QUALITY PROTEIN: putative histone deacetylase 
10 [Malus domestica]
Length=130

 Score = 54.3 bits (129),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -3

Query  268  PSVQMQE--VPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDD  101
            PSVQMQ+  VPP FYIPDFDED QN    L +HTQDK IQRDDEYYEGDNDNDH+M+D
Sbjct  72   PSVQMQKRXVPPDFYIPDFDEDEQNPYVILPEHTQDKHIQRDDEYYEGDNDNDHNMED  129


 Score = 32.0 bits (71),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T K  VLENL  IQHAP
Sbjct  50   SKSYLSTIKIQVLENLGCIQHAP  72



>gb|KCW50787.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=406

 Score = 54.7 bits (130),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQ  179
            PSVQMQEVPP FYIPDFDED QN DER+D+
Sbjct  376  PSVQMQEVPPDFYIPDFDEDEQNPDERMDR  405


 Score = 31.2 bits (69),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL   K  VLENL  IQHAP
Sbjct  354  SKSYLSAIKVQVLENLRNIQHAP  376



>ref|XP_007015905.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
 gb|EOY33524.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
Length=404

 Score = 52.0 bits (123),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQ  179
            P VQMQEVPP F+IPDFDED QN DER+D+
Sbjct  374  PGVQMQEVPPDFFIPDFDEDEQNPDERMDR  403


 Score = 32.3 bits (72),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SY+ T K  VLENL  IQHAP
Sbjct  352  SKSYISTIKMQVLENLRCIQHAP  374



>gb|EPS60094.1| histone deacetylase, partial [Genlisea aurea]
Length=105

 Score = 52.0 bits (123),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = -3

Query  268  PSVQMQE--VPPXFYIPDFDEDTQNXDERLDQHTQDKQIQRddeyyegdndnDHSMDDA  98
            P VQM E  VPP FYIPD DED QN +ER+ +  +DK I+RDDEYY+ +NDNDH+MDD+
Sbjct  47   PGVQMHEARVPPDFYIPDSDEDEQNPEERVTREMRDKNIRRDDEYYDDENDNDHAMDDS  105


 Score = 30.8 bits (68),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T +  V ENL  IQHAP
Sbjct  25   SKSYLNTIRQQVCENLNSIQHAP  47



>gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=404

 Score = 48.9 bits (115),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  268  PSVQMQEVPPXFYIPDFDEDTQNXDERLDQ  179
            P VQMQEVPP FYIPDFDED  N D+R+++
Sbjct  374  PGVQMQEVPPDFYIPDFDEDQHNPDQRVNR  403


 Score = 30.8 bits (68),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = -2

Query  335  SXSYLXTXKSHVLENLXYIQHAP  267
            S SYL T +  V ENL  IQHAP
Sbjct  352  SKSYLNTIRQQVCENLSAIQHAP  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560672394880