BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004D07

Length=189
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB55201.1|  hypothetical protein B456_009G068400                  77.4    5e-15   Gossypium raimondii
ref|XP_010102859.1|  Zinc finger protein                              77.0    7e-15   Morus notabilis
gb|KJB55204.1|  hypothetical protein B456_009G068400                  76.3    7e-15   Gossypium raimondii
gb|KHG19598.1|  Zinc finger protein                                   77.0    9e-15   Gossypium arboreum [tree cotton]
gb|EPS72142.1|  hypothetical protein M569_02614                       76.3    1e-14   Genlisea aurea
gb|KDP33442.1|  hypothetical protein JCGZ_07013                       76.6    1e-14   Jatropha curcas
gb|KJB06567.1|  hypothetical protein B456_001G001500                  75.9    1e-14   Gossypium raimondii
gb|KJB06566.1|  hypothetical protein B456_001G001500                  75.5    2e-14   Gossypium raimondii
ref|XP_008466318.1|  PREDICTED: zinc finger protein 622               75.1    3e-14   Cucumis melo [Oriental melon]
ref|XP_004166762.1|  PREDICTED: zinc finger protein 622-like          72.8    4e-14   
ref|XP_007011582.1|  Zinc finger protein 622 isoform 1                74.7    6e-14   
ref|XP_004136315.1|  PREDICTED: zinc finger protein 622-like          73.9    8e-14   Cucumis sativus [cucumbers]
gb|KHG15735.1|  Zinc finger protein                                   73.9    9e-14   Gossypium arboreum [tree cotton]
emb|CBI20772.3|  unnamed protein product                              73.6    1e-13   Vitis vinifera
ref|XP_009406616.1|  PREDICTED: zinc finger protein 622-like          73.9    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006483575.1|  PREDICTED: zinc finger protein 622-like          71.6    1e-13   
ref|XP_002282746.1|  PREDICTED: zinc finger protein 622               73.6    1e-13   Vitis vinifera
ref|XP_011082078.1|  PREDICTED: zinc finger protein 622               72.8    2e-13   Sesamum indicum [beniseed]
ref|XP_009769243.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...  72.4    4e-13   Nicotiana sylvestris
emb|CAN62771.1|  hypothetical protein VITISV_027109                   71.6    5e-13   Vitis vinifera
ref|XP_009800477.1|  PREDICTED: zinc finger protein 622-like          72.0    5e-13   Nicotiana sylvestris
ref|XP_009616044.1|  PREDICTED: zinc finger protein 622               72.0    6e-13   Nicotiana tomentosiformis
gb|KDO67270.1|  hypothetical protein CISIN_1g015261mg                 71.6    6e-13   Citrus sinensis [apfelsine]
ref|XP_004291236.1|  PREDICTED: zinc finger protein 622               71.2    8e-13   Fragaria vesca subsp. vesca
ref|XP_006450152.1|  hypothetical protein CICLE_v10008476mg           71.2    9e-13   Citrus clementina [clementine]
ref|XP_006483736.1|  PREDICTED: zinc finger protein 622-like          71.2    9e-13   
emb|CDP12454.1|  unnamed protein product                              70.9    1e-12   Coffea canephora [robusta coffee]
ref|XP_010914164.1|  PREDICTED: zinc finger protein 622-like          70.1    2e-12   Elaeis guineensis
ref|XP_004253056.1|  PREDICTED: zinc finger protein 622               69.7    4e-12   Solanum lycopersicum
gb|KJB06568.1|  hypothetical protein B456_001G001500                  69.3    4e-12   Gossypium raimondii
ref|XP_006342459.1|  PREDICTED: zinc finger protein 622-like          69.3    4e-12   Solanum tuberosum [potatoes]
ref|XP_002527963.1|  transcription factor, putative                   69.3    5e-12   Ricinus communis
gb|EMT04737.1|  Zinc finger protein 622                               68.6    7e-12   
gb|ABK25050.1|  unknown                                               68.6    1e-11   Picea sitchensis
dbj|BAK05098.1|  predicted protein                                    67.8    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010265409.1|  PREDICTED: zinc finger protein 622               67.8    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010668047.1|  PREDICTED: zinc finger protein 622               67.4    2e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22071.1|  hypothetical protein MIMGU_mgv1a007393mg              67.4    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_003563458.1|  PREDICTED: zinc finger protein 622               67.0    3e-11   Brachypodium distachyon [annual false brome]
ref|XP_008347704.1|  PREDICTED: zinc finger protein 622-like          66.6    4e-11   
ref|XP_008794317.1|  PREDICTED: zinc finger protein 622-like          66.6    4e-11   Phoenix dactylifera
ref|XP_003550141.1|  PREDICTED: zinc finger protein 622-like          66.6    4e-11   Glycine max [soybeans]
ref|XP_007161307.1|  hypothetical protein PHAVU_001G058800g           66.6    4e-11   Phaseolus vulgaris [French bean]
ref|XP_009618306.1|  PREDICTED: zinc finger protein 622-like          66.6    4e-11   Nicotiana tomentosiformis
ref|XP_004498584.1|  PREDICTED: zinc finger protein 622-like          66.6    4e-11   Cicer arietinum [garbanzo]
gb|KEH39759.1|  C2H2-type zinc finger protein                         66.6    4e-11   Medicago truncatula
gb|EEC81236.1|  hypothetical protein OsI_24290                        66.2    5e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_003538078.1|  PREDICTED: zinc finger protein 622-like          66.6    5e-11   Glycine max [soybeans]
ref|XP_009338830.1|  PREDICTED: zinc finger protein 622-like          66.2    6e-11   Pyrus x bretschneideri [bai li]
ref|XP_003538077.1|  PREDICTED: zinc finger protein 622-like isof...  66.2    7e-11   Glycine max [soybeans]
ref|XP_006656412.1|  PREDICTED: zinc finger protein 622-like          65.9    7e-11   Oryza brachyantha
ref|XP_008378248.1|  PREDICTED: zinc finger protein 622-like          65.9    7e-11   
ref|XP_003550140.1|  PREDICTED: zinc finger protein 622-like isof...  65.9    8e-11   Glycine max [soybeans]
ref|XP_006845651.1|  hypothetical protein AMTR_s00019p00227240        65.9    8e-11   Amborella trichopoda
ref|XP_006591049.1|  PREDICTED: zinc finger protein 622-like isof...  65.5    9e-11   Glycine max [soybeans]
ref|XP_009363611.1|  PREDICTED: zinc finger protein 622-like          65.9    9e-11   Pyrus x bretschneideri [bai li]
ref|NP_001280881.1|  zinc finger protein 622                          65.9    9e-11   Malus domestica [apple tree]
dbj|BAD94371.1|  hypothetical protein with zinc finger                63.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058435.1|  Os06g0693500                                     65.5    1e-10   
ref|XP_009368013.1|  PREDICTED: zinc finger protein 622-like          65.5    1e-10   Pyrus x bretschneideri [bai li]
ref|XP_010525877.1|  PREDICTED: zinc finger protein 622               65.1    2e-10   Tarenaya hassleriana [spider flower]
ref|XP_004966161.1|  PREDICTED: zinc finger protein 622-like          65.1    2e-10   Setaria italica
gb|AFW69247.1|  hypothetical protein ZEAMMB73_978259                  62.4    2e-10   
gb|KHN31608.1|  Zinc finger protein                                   64.7    2e-10   Glycine soja [wild soybean]
gb|KHN13053.1|  Zinc finger protein 622                               64.3    2e-10   Glycine soja [wild soybean]
ref|XP_008219929.1|  PREDICTED: zinc finger protein 622               64.7    2e-10   Prunus mume [ume]
ref|XP_007222754.1|  hypothetical protein PRUPE_ppa006521mg           64.7    2e-10   Prunus persica
gb|AFK42392.1|  unknown                                               64.3    3e-10   Lotus japonicus
ref|XP_008352169.1|  PREDICTED: zinc finger protein 622-like          64.3    3e-10   
gb|AFK41799.1|  unknown                                               63.9    4e-10   Lotus japonicus
ref|NP_567875.1|  protein REI1-LIKE 1                                 63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAK44084.1|AF370269_1  putative zinc finger protein                63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974652.1|  protein REI1-LIKE 1                                 63.5    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151247.1|  LOC100284880                                     62.4    1e-09   Zea mays [maize]
ref|XP_010049815.1|  PREDICTED: zinc finger protein 622               62.4    2e-09   Eucalyptus grandis [rose gum]
ref|XP_002437507.1|  hypothetical protein SORBIDRAFT_10g028300        62.0    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002867303.1|  zinc finger family protein                       61.6    2e-09   
ref|XP_011031356.1|  PREDICTED: zinc finger protein 622-like          61.6    3e-09   Populus euphratica
ref|XP_006404984.1|  hypothetical protein EUTSA_v10000189mg           61.2    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006283853.1|  hypothetical protein CARUB_v10004960mg           60.8    4e-09   Capsella rubella
ref|XP_006382168.1|  zinc finger family protein                       60.8    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006412594.1|  hypothetical protein EUTSA_v10025366mg           60.5    6e-09   Eutrema salsugineum [saltwater cress]
emb|CDX68744.1|  BnaC01g07090D                                        60.5    7e-09   
ref|XP_009126994.1|  PREDICTED: zinc finger protein 622               60.1    7e-09   Brassica rapa
ref|XP_009117121.1|  PREDICTED: zinc finger protein 622-like          60.1    8e-09   Brassica rapa
emb|CDX76808.1|  BnaC08g33940D                                        59.7    9e-09   
emb|CDY28267.1|  BnaA01g05820D                                        60.1    9e-09   Brassica napus [oilseed rape]
emb|CDY34766.1|  BnaA09g41330D                                        59.7    1e-08   Brassica napus [oilseed rape]
ref|XP_010432868.1|  PREDICTED: zinc finger protein 622-like          59.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010447561.1|  PREDICTED: zinc finger protein 622-like          59.3    1e-08   Camelina sativa [gold-of-pleasure]
gb|KHN31605.1|  Zinc finger protein 622                               58.9    2e-08   Glycine soja [wild soybean]
ref|XP_010929264.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  58.5    3e-08   
gb|KHN13054.1|  Zinc finger protein                                   58.5    3e-08   Glycine soja [wild soybean]
ref|XP_011045006.1|  PREDICTED: zinc finger protein 622-like          58.2    4e-08   Populus euphratica
ref|XP_002324955.2|  zinc finger family protein                       58.2    5e-08   
gb|KFK29727.1|  hypothetical protein AALP_AA7G170800                  57.8    5e-08   Arabis alpina [alpine rockcress]
ref|XP_010438043.1|  PREDICTED: zinc finger protein 622-like          57.8    6e-08   Camelina sativa [gold-of-pleasure]
emb|CDY20320.1|  BnaC04g36360D                                        57.0    9e-08   Brassica napus [oilseed rape]
emb|CDY46155.1|  BnaA04g14430D                                        57.0    1e-07   Brassica napus [oilseed rape]
ref|XP_009140559.1|  PREDICTED: zinc finger protein 622               56.6    1e-07   Brassica rapa
ref|XP_008794318.1|  PREDICTED: zinc finger protein 622-like          56.6    2e-07   Phoenix dactylifera
ref|XP_002974456.1|  hypothetical protein SELMODRAFT_101058           54.7    7e-07   
ref|XP_002985761.1|  hypothetical protein SELMODRAFT_234873           54.7    7e-07   Selaginella moellendorffii
dbj|BAD53868.1|  hypothetical protein                                 51.6    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02196.1|  hypothetical protein OsI_24291                        51.6    1e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_180026.1|  zinc finger domain protein REI1-LIKE 2              53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32629.1|  hypothetical protein AALP_AA6G268300                  53.1    2e-06   Arabis alpina [alpine rockcress]
gb|KDO67272.1|  hypothetical protein CISIN_1g043125mg                 50.4    3e-06   Citrus sinensis [apfelsine]
ref|XP_002880589.1|  hypothetical protein ARALYDRAFT_481305           52.8    4e-06   
gb|KDO38064.1|  hypothetical protein CISIN_1g042126mg                 52.0    5e-06   Citrus sinensis [apfelsine]
ref|XP_006293479.1|  hypothetical protein CARUB_v10023355mg           52.0    6e-06   Capsella rubella
ref|XP_010429428.1|  PREDICTED: zinc finger protein 622-like          51.6    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010417208.1|  PREDICTED: zinc finger protein 622-like          51.2    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010472458.1|  PREDICTED: zinc finger protein 622-like          51.2    1e-05   Camelina sativa [gold-of-pleasure]



>gb|KJB55201.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
 gb|KJB55205.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=407

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMG+ATVQSRE MV+MKVMKAM R G EAMRTK+G++NNVIRNLP NVPY
Sbjct  354  SRYRSMGIATVQSREQMVRMKVMKAMNRGGVEAMRTKVGVKNNVIRNLPKNVPY  407



>ref|XP_010102859.1| Zinc finger protein [Morus notabilis]
 ref|XP_010111936.1| Zinc finger protein [Morus notabilis]
 gb|EXB94240.1| Zinc finger protein [Morus notabilis]
 gb|EXC32054.1| Zinc finger protein [Morus notabilis]
Length=410

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE MV+MKVMKAM R G EAMRTKIG+++NVIRNLP NVPY
Sbjct  357  SRYRSMGLATVQSREQMVRMKVMKAMNRSGVEAMRTKIGMKSNVIRNLPKNVPY  410



>gb|KJB55204.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=342

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMG+ATVQSRE MV+MKVMKAM R G EAMRTK+G++NNVIRNLP NVPY
Sbjct  289  SRYRSMGIATVQSREQMVRMKVMKAMNRGGVEAMRTKVGVKNNVIRNLPKNVPY  342



>gb|KHG19598.1| Zinc finger protein [Gossypium arboreum]
Length=407

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMG+ATVQSRE +V+MKVMKAM R G EAMRTK+G++NNVIRNLP NVPY
Sbjct  354  SRYRSMGIATVQSREQIVRMKVMKAMNRGGVEAMRTKVGMKNNVIRNLPKNVPY  407



>gb|EPS72142.1| hypothetical protein M569_02614 [Genlisea aurea]
Length=383

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL TVQSREN ++MK MKAM R G E MR+KIG+++NVIRNLP NVPY
Sbjct  330  SRYRSMGLETVQSRENAIRMKAMKAMNRSGVEFMRSKIGMKSNVIRNLPQNVPY  383



>gb|KDP33442.1| hypothetical protein JCGZ_07013 [Jatropha curcas]
Length=408

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE MV+MKVMK M R G EAMRTKIG++NNVIRNLP NVPY
Sbjct  355  SRYRSMGLATVQSREQMVRMKVMKEMNRSGAEAMRTKIGLKNNVIRNLPKNVPY  408



>gb|KJB06567.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=363

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E +V+MKVMKAM R G E MRTK+G++NNVI+NLP NVPY
Sbjct  310  SRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKNVPY  363



>gb|KJB06566.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=392

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E +V+MKVMKAM R G E MRTK+G++NNVI+NLP NVPY
Sbjct  339  SRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKNVPY  392



>ref|XP_008466318.1| PREDICTED: zinc finger protein 622 [Cucumis melo]
Length=393

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE M++MKVMK M R G EAMRTKIG++NNVIRNLP NVP+
Sbjct  340  ARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKNVPH  393



>ref|XP_004166762.1| PREDICTED: zinc finger protein 622-like, partial [Cucumis sativus]
Length=182

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE M++MKVMK M R G EAMRTKIG++NNVIRNLP NVP+
Sbjct  129  ARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKNVPH  182



>ref|XP_007011582.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 ref|XP_007011583.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29201.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29202.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
Length=407

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKVMK M R G EAMRTK+G++NNVIRNLP NVP+
Sbjct  354  SRYRSMGLATVQSREQIVRMKVMKQMNRSGVEAMRTKVGMKNNVIRNLPKNVPF  407



>ref|XP_004136315.1| PREDICTED: zinc finger protein 622-like [Cucumis sativus]
 gb|KGN60160.1| hypothetical protein Csa_3G881730 [Cucumis sativus]
Length=395

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE M++MKVMK M R G EAMRTKIG++NNVIRNLP NVP+
Sbjct  342  ARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKNVPH  395



>gb|KHG15735.1| Zinc finger protein [Gossypium arboreum]
Length=392

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E +V+MKVMKAM R G E MRTK+G++NNVI+NLP NVPY
Sbjct  339  SRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKNVPY  392



>emb|CBI20772.3| unnamed protein product [Vitis vinifera]
Length=376

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKVMK M + G EAMR+KIG+++NVIRNLPNNVPY
Sbjct  323  SRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPNNVPY  376



>ref|XP_009406616.1| PREDICTED: zinc finger protein 622-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E +V+MKVM+ M R+G EAMR+KIG+++NVIRNLP NVPY
Sbjct  364  SRYRSMGLATVQSKEQIVRMKVMREMSRHGVEAMRSKIGMKSNVIRNLPKNVPY  417



>ref|XP_006483575.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
Length=190

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQ+RE+MV+MKV+K M R G EAMRT++G++NN+IRNLP NVPY
Sbjct  137  SRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKNVPY  190



>ref|XP_002282746.1| PREDICTED: zinc finger protein 622 [Vitis vinifera]
Length=411

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKVMK M + G EAMR+KIG+++NVIRNLPNNVPY
Sbjct  358  SRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPNNVPY  411



>ref|XP_011082078.1| PREDICTED: zinc finger protein 622 [Sesamum indicum]
Length=411

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQSRE++V+MKV+KAM + G EAMR+KIG+++NVIRNLP NVPY
Sbjct  358  SRYKSMGLATVQSREHVVRMKVIKAMNKSGIEAMRSKIGMKSNVIRNLPKNVPY  411



>ref|XP_009769243.1| PREDICTED: LOW QUALITY PROTEIN: cytoplasmic 60S subunit biogenesis 
factor SPCC550.15c [Nicotiana sylvestris]
Length=412

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS E+MVKMKV+KAM R G +AMR+KIG+++NVIRNLP N+PY
Sbjct  359  SRYRSMGLATVQSWEHMVKMKVLKAMNRCGVDAMRSKIGMKSNVIRNLPKNIPY  412



>emb|CAN62771.1| hypothetical protein VITISV_027109 [Vitis vinifera]
Length=374

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKVMK M + G EAMR+KIG+++NVIRNLP NVPY
Sbjct  321  SRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPKNVPY  374



>ref|XP_009800477.1| PREDICTED: zinc finger protein 622-like [Nicotiana sylvestris]
Length=415

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE++VKMKV+KAM + G E MR KIG+++NVIRNLP N+PY
Sbjct  362  ARYRSMGLATVQSREHIVKMKVLKAMNKSGVEVMRNKIGMKSNVIRNLPKNIPY  415



>ref|XP_009616044.1| PREDICTED: zinc finger protein 622 [Nicotiana tomentosiformis]
Length=415

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE+MVKMKV+KAM + G E MR KIG+++NVIRNLP N+PY
Sbjct  362  ARYRSMGLATVQSREHMVKMKVLKAMNKSGVEVMRNKIGMKSNVIRNLPKNIPY  415



>gb|KDO67270.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=389

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQ+RE+MV+MKV+K M R G EAMRT++G++NN+IRNLP NVPY
Sbjct  336  SRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKNVPY  389



>ref|XP_004291236.1| PREDICTED: zinc finger protein 622 [Fragaria vesca subsp. vesca]
Length=408

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RY+SMGLATVQS+E MV+MKV+K M R G EAMR+KIG+++NVIRNLP+NVPY
Sbjct  355  ARYKSMGLATVQSKERMVQMKVLKEMRRSGVEAMRSKIGMKSNVIRNLPSNVPY  408



>ref|XP_006450152.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 ref|XP_006483574.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
 gb|ESR63392.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 gb|KDO67267.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=410

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQ+RE+MV+MKV+K M R G EAMRT++G++NN+IRNLP NVPY
Sbjct  357  SRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKNVPY  410



>ref|XP_006483736.1| PREDICTED: zinc finger protein 622-like, partial [Citrus sinensis]
Length=419

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQ+RE+MV+MKV+K M R G EAMRT++G++NN+IRNLP NVPY
Sbjct  366  SRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKNVPY  419



>emb|CDP12454.1| unnamed protein product [Coffea canephora]
Length=411

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE++V+MKV+KAM R G EAMR+KIG+++NVIRNLP NV +
Sbjct  358  SRYRSMGLATVQSREHIVRMKVLKAMSRSGVEAMRSKIGMKSNVIRNLPKNVTH  411



>ref|XP_010914164.1| PREDICTED: zinc finger protein 622-like [Elaeis guineensis]
Length=418

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRS+GLATVQS+E +V+MKV++ M R G E MR+KIG+++NVIRNLP NVPY
Sbjct  365  SRYRSLGLATVQSKEKIVRMKVLRQMNRNGVEVMRSKIGMKSNVIRNLPKNVPY  418



>ref|XP_004253056.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=415

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE MVK+KV++AM + G E MR+KIG+++NVIRNLP N+PY
Sbjct  362  ARYRSMGLATVQSREQMVKLKVLRAMNKSGVEIMRSKIGMKSNVIRNLPKNIPY  415



>gb|KJB06568.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=390

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  178  RSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RSMGLATVQS+E +V+MKVMKAM R G E MRTK+G++NNVI+NLP NVPY
Sbjct  340  RSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKNVPY  390



>ref|XP_006342459.1| PREDICTED: zinc finger protein 622-like [Solanum tuberosum]
Length=414

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSRE MVK+KV++AM + G E MR+KIG+++NVIRNLP N+PY
Sbjct  361  ARYRSMGLATVQSREQMVKLKVLRAMNKSGVEIMRSKIGMKSNVIRNLPKNIPY  414



>ref|XP_002527963.1| transcription factor, putative [Ricinus communis]
 gb|EEF34375.1| transcription factor, putative [Ricinus communis]
Length=407

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE MV+MKVMK M R  +EAMRTKIG+++N+IRNLP NVPY
Sbjct  355  SRYRSMGLATVQSREQMVRMKVMKEMNR-SSEAMRTKIGMKSNIIRNLPKNVPY  407



>gb|EMT04737.1| Zinc finger protein 622 [Aegilops tauschii]
Length=379

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM + G E MRTKIG+++NVIRNLP NVPY
Sbjct  326  SSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKNVPY  379



>gb|ABK25050.1| unknown [Picea sitchensis]
Length=420

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E +++   +K +   G E MRTK+G++NNVIRNLP NVPY
Sbjct  367  SRYRSMGLATVQSKEKILRRNALKKIRSSGVEVMRTKVGLKNNVIRNLPKNVPY  420



>dbj|BAK05098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM + G E MRTKIG+++NVIRNLP NVPY
Sbjct  347  SSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKNVPY  400



>ref|XP_010265409.1| PREDICTED: zinc finger protein 622 [Nelumbo nucifera]
Length=404

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL TVQSRE +V+MKV++ M R G +AM+ KIG+++NVI+NLP NVPY
Sbjct  351  SRYRSMGLVTVQSREQVVRMKVLREMNRSGVQAMQAKIGMKSNVIKNLPKNVPY  404



>ref|XP_010668047.1| PREDICTED: zinc finger protein 622 [Beta vulgaris subsp. vulgaris]
Length=404

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMG+ TVQS++  ++MKV+K + R G EAMR+K+G+++NVIRNLPNNVPY
Sbjct  351  SRYKSMGIVTVQSKQQTIRMKVLKEINRSGVEAMRSKMGMKSNVIRNLPNNVPY  404



>gb|EYU22071.1| hypothetical protein MIMGU_mgv1a007393mg [Erythranthe guttata]
Length=409

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RY++MGLATVQSRE++V+MKVMKAM R G + MR+K+G+++NVIRNLP N+PY
Sbjct  356  ARYKTMGLATVQSREHVVRMKVMKAMNRSGVDIMRSKMGMKSNVIRNLPKNIPY  409



>ref|XP_003563458.1| PREDICTED: zinc finger protein 622 [Brachypodium distachyon]
Length=402

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM + G E MRTKIG+++NVIRNLP NVPY
Sbjct  349  SSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKNVPY  402



>ref|XP_008347704.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=381

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  328  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  381



>ref|XP_008794317.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776891.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=418

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYR +GLATVQS+E +V+MKV++ M R G E MR+KIG+++NVIRNLPNNVPY
Sbjct  365  SRYRILGLATVQSKERIVRMKVLREMNRNGVEGMRSKIGMKSNVIRNLPNNVPY  418



>ref|XP_003550141.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  354  SRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  407



>ref|XP_007161307.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
 gb|ESW33301.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
Length=413

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL TVQSRE +V+MKV+K M R G E MR+KI +++NVIRNLP+NVPY
Sbjct  360  SRYRSMGLTTVQSREQIVRMKVLKEMSRSGVENMRSKIAMKSNVIRNLPSNVPY  413



>ref|XP_009618306.1| PREDICTED: zinc finger protein 622-like [Nicotiana tomentosiformis]
Length=416

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYR MGLATVQ RE MVKMKV+KAM R G +AM +KIG+++NVIRNLP N PY
Sbjct  363  SRYRIMGLATVQWRERMVKMKVLKAMNRCGGDAMLSKIGMKSNVIRNLPKNTPY  416



>ref|XP_004498584.1| PREDICTED: zinc finger protein 622-like [Cicer arietinum]
Length=410

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE+ V+MK++K M + G E MR+K+G+++NVIRNLPNNV Y
Sbjct  357  SRYRSMGLATVQSREHFVRMKILKEMNKSGVEHMRSKMGMKSNVIRNLPNNVTY  410



>gb|KEH39759.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=408

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RYRSMGLATVQSR+ +V+MKV+K M R G E MR+K+G+++NVIRNLPNNV Y
Sbjct  355  ARYRSMGLATVQSRQQIVRMKVLKQMNRSGVEHMRSKMGMKSNVIRNLPNNVTY  408



>gb|EEC81236.1| hypothetical protein OsI_24290 [Oryza sativa Indica Group]
Length=358

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E +V++KV++AM + G E MRTKIG+++NVIRNLP N PY
Sbjct  305  SSYKSMGLVTVQSKEQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKNCPY  358



>ref|XP_003538078.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRS+GL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLPNNVPY
Sbjct  354  SRYRSLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPNNVPY  407



>ref|XP_009338830.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  405



>ref|XP_003538077.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
Length=407

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  354  SRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  407



>ref|XP_006656412.1| PREDICTED: zinc finger protein 622-like [Oryza brachyantha]
Length=398

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQSRE +V++KV++AM + G E MRTKIG+++NVIRNLP N PY
Sbjct  345  SSYKSMGLVTVQSREQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKNCPY  398



>ref|XP_008378248.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=405

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  405



>ref|XP_003550140.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
 ref|XP_006601093.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=407

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  354  SRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  407



>ref|XP_006845651.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
 gb|ERN07326.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
Length=403

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY++MG+ TVQS+E +++MKV+K M R G EA+RT++G++NNVIRNLP NVPY
Sbjct  350  SRYQNMGVVTVQSKERVLRMKVLKEMHRSGVEALRTRVGMKNNVIRNLPKNVPY  403



>ref|XP_006591049.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=347

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  294  SRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  347



>ref|XP_009363611.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  405



>ref|NP_001280881.1| zinc finger protein 622 [Malus domestica]
 gb|ADL36644.1| C2H2L domain class transcription factor [Malus domestica]
Length=405

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  405



>dbj|BAD94371.1| hypothetical protein with zinc finger [Arabidopsis thaliana]
Length=154

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  102  SRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  154



>ref|NP_001058435.1| Os06g0693500 [Oryza sativa Japonica Group]
 dbj|BAD53867.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF20349.1| Os06g0693500 [Oryza sativa Japonica Group]
 gb|EAZ38119.1| hypothetical protein OsJ_22468 [Oryza sativa Japonica Group]
 dbj|BAG95937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=399

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E +V++KV++AM + G E MRTKIG+++NVIRNLP N PY
Sbjct  346  SSYKSMGLVTVQSKEQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKNCPY  399



>ref|XP_009368013.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  405



>ref|XP_010525877.1| PREDICTED: zinc finger protein 622 [Tarenaya hassleriana]
Length=410

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGL TVQS+E++V+MKV++ M R G E MRTK+G+++NVIRNLP NVPY
Sbjct  358  SRYKSMGLTTVQSKEHIVRMKVLREMNRRG-ETMRTKLGMKSNVIRNLPKNVPY  410



>ref|XP_004966161.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=405

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM + G E MRTKIG+++NVIRNLP N PY
Sbjct  352  SSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKNCPY  405



>gb|AFW69247.1| hypothetical protein ZEAMMB73_978259, partial [Zea mays]
Length=143

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM R G E MR KIG+++NVIRNLP N P+
Sbjct  90   SSYKSMGLVTVQSKEQMVRLKVLRAMNRTGVETMRNKIGMKSNVIRNLPKNCPH  143



>gb|KHN31608.1| Zinc finger protein [Glycine soja]
Length=407

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRS+GL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  354  SRYRSLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  407



>gb|KHN13053.1| Zinc finger protein 622 [Glycine soja]
Length=346

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  293  SRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  346



>ref|XP_008219929.1| PREDICTED: zinc finger protein 622 [Prunus mume]
Length=408

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  355  SRYKSMGLATVQSKERMVRMKVLKEMKRSGVEAMRSKMGMKSNVIRNLPKNCTY  408



>ref|XP_007222754.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
 gb|EMJ23953.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
Length=408

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N  Y
Sbjct  355  SRYKSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCTY  408



>gb|AFK42392.1| unknown [Lotus japonicus]
Length=410

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKV+K M + G E MR+K+G+++NVIRNLP N  Y
Sbjct  357  SRYRSMGLATVQSREQIVRMKVLKQMSKTGVENMRSKMGMKSNVIRNLPKNCTY  410



>ref|XP_008352169.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=434

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNN  35
            SRYRSMGLATVQS+E MV+MKV+K M R G EAMR+K+G+++NVIRNLP N
Sbjct  352  SRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKN  402



>gb|AFK41799.1| unknown [Lotus japonicus]
Length=410

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE +V+MKV+K M + G E MR+K+G+++NVIRNLP N  Y
Sbjct  357  SRYRSMGLATVQSREQIVRMKVLKQMSKTGVENMRSKMGMKSNVIRNLPKNCTY  410



>ref|NP_567875.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AAN12920.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AEE85908.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=404

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  352  SRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  404



>gb|AAK44084.1|AF370269_1 putative zinc finger protein [Arabidopsis thaliana]
Length=404

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  352  SRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  404



>ref|NP_974652.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AEE85909.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=405

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  353  SRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  405



>ref|NP_001151247.1| LOC100284880 [Zea mays]
 gb|ACG42118.1| zinc finger protein 622 [Zea mays]
 gb|ACR38026.1| unknown [Zea mays]
 gb|AFW69246.1| Zinc finger protein 622 [Zea mays]
Length=404

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+SMGL TVQS+E MV++KV++AM R G E MR KIG+++NVIRNLP N P+
Sbjct  351  SSYKSMGLVTVQSKEQMVRLKVLRAMNRTGVETMRNKIGMKSNVIRNLPKNCPH  404



>ref|XP_010049815.1| PREDICTED: zinc finger protein 622 [Eucalyptus grandis]
 gb|KCW82616.1| hypothetical protein EUGRSUZ_C04005 [Eucalyptus grandis]
Length=414

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -3

Query  187  SRYRSMGLAT-VQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T V+SRE MV++KV++ M R G EAMRTKIG+++NVIRNLP NV +
Sbjct  360  SRYRSMGLTTTVRSREQMVRLKVIREMNRSGVEAMRTKIGMKSNVIRNLPKNVTH  414



>ref|XP_002437507.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
 gb|EER88874.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
Length=404

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y++MGL TVQS+E MV++KV++AM + G E MR KIG+++NVIRNLP N PY
Sbjct  351  SSYKNMGLVTVQSKEQMVRLKVLRAMNKTGVETMRNKIGMKSNVIRNLPKNCPY  404



>ref|XP_002867303.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43562.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = -3

Query  184  RYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RY+S+GL TV S+E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  354  RYKSLGLKTVPSKEETLRMKVRKEMSQRG-ETMRTKIGVKSNVIRNLPNNVPY  405



>ref|XP_011031356.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL T+QSRE MV+MKVMK + R   EAMRTKI ++NNVI NLP NVPY
Sbjct  356  SRYRSMGLTTIQSREQMVRMKVMKQVSRSA-EAMRTKINMKNNVIWNLPKNVPY  408



>ref|XP_006404984.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
 dbj|BAJ34463.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46437.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
Length=403

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATV S+E++V+MKVM+ M + G + MR K+G+++NVIRNLPNNV Y
Sbjct  351  SRYKSMGLATVHSKEDIVRMKVMREMNKRGAK-MRVKLGMKSNVIRNLPNNVTY  403



>ref|XP_006283853.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
 gb|EOA16751.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
Length=403

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL T  ++E  ++MKV K M + G E MRTKIG+++NVIRNLPNNVPY
Sbjct  351  SRYKSLGLKTAPTKEETLRMKVRKQMSQRG-ETMRTKIGVKSNVIRNLPNNVPY  403



>ref|XP_006382168.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP59965.1| zinc finger family protein [Populus trichocarpa]
Length=408

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGL TVQSRE MV+MKVMK + R   EAMRTKI ++NNVI NLP NVPY
Sbjct  356  SRYRSMGLTTVQSREQMVRMKVMKQVSRSA-EAMRTKINMKNNVIWNLPKNVPY  408



>ref|XP_006412594.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
 dbj|BAJ34316.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54047.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
Length=402

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E+ VKMKV+K M + G E MRTKI +++NVIRNLPNNVPY
Sbjct  350  SRYKSLGLKTVPSKEDTVKMKVLKEMNKRG-ETMRTKIAMKSNVIRNLPNNVPY  402



>emb|CDX68744.1| BnaC01g07090D [Brassica napus]
Length=403

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E+ VKMK +K M + G E MRTK+ +++NVIRNLPNNVPY
Sbjct  351  SRYKSLGLKTVPSKEDRVKMKALKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  403



>ref|XP_009126994.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=395

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E+ VKMK +K M + G E MRTK+ +++NVIRNLPNNVPY
Sbjct  343  SRYKSLGLKTVPSKEDRVKMKALKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  395



>ref|XP_009117121.1| PREDICTED: zinc finger protein 622-like [Brassica rapa]
Length=400

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -3

Query  184  RYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RY+SMGLATVQS+E++V+MKVM+ M + G   MR K+G+++NVIRNLPNNV Y
Sbjct  349  RYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  400



>emb|CDX76808.1| BnaC08g33940D [Brassica napus]
Length=319

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -3

Query  184  RYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RY+SMGLATVQS+E++V+MKVM+ M + G   MR K+G+++NVIRNLPNNV Y
Sbjct  268  RYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  319



>emb|CDY28267.1| BnaA01g05820D [Brassica napus]
Length=395

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV S+E+ VKMK +K M + G E MRTK+ +++NVIRNLPNNVPY
Sbjct  343  SRYKSLGLKTVPSKEDRVKMKAIKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  395



>emb|CDY34766.1| BnaA09g41330D [Brassica napus]
Length=400

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -3

Query  184  RYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RY+SMGLATVQS+E++V+MKVM+ M + G   MR K+G+++NVIRNLPNNV Y
Sbjct  349  RYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  400



>ref|XP_010432868.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV ++E  ++MKV K M + G E  RTKIG+++NVIRNLPNNVPY
Sbjct  354  SRYKSLGLKTVPTKEETLRMKVRKEMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  406



>ref|XP_010447561.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL TV ++E  ++MKV K M + G E  RTKIG+++NVIRNLPNNVPY
Sbjct  354  SRYKSLGLKTVPTKEETLRMKVRKEMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  406



>gb|KHN31605.1| Zinc finger protein 622 [Glycine soja]
Length=352

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -3

Query  181  YRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            + SMGL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  301  FLSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  352



>ref|XP_010929264.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622-like 
[Elaeis guineensis]
Length=411

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SR RS+  ATVQS+  +V MK+++ M R G EAMR+KIG+++NVIRNLP NVPY
Sbjct  358  SRDRSLRSATVQSKVRIVTMKLLRKMNRNGVEAMRSKIGMKSNVIRNLPKNVPY  411



>gb|KHN13054.1| Zinc finger protein [Glycine soja]
Length=405

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  178  RSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            RS+GL T+QSRE +V+MKV+K M R G + MRTK+ +++NVIRNLP NVPY
Sbjct  355  RSLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKNVPY  405



>ref|XP_011045006.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE MV+MKVMK + R   E MRTKI ++NNVI NLP NV Y
Sbjct  356  SRYRSMGLATVQSREQMVRMKVMKQVNRSA-ETMRTKISMKNNVIWNLPKNVLY  408



>ref|XP_002324955.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF03520.2| zinc finger family protein [Populus trichocarpa]
Length=407

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRSMGLATVQSRE M++MKVMK + R   EAMRTKI  +NNVI +LP NV Y
Sbjct  355  SRYRSMGLATVQSREQMLRMKVMKQVNRSA-EAMRTKISTKNNVIWDLPKNVLY  407



>gb|KFK29727.1| hypothetical protein AALP_AA7G170800 [Arabis alpina]
Length=399

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRYRS+GL TV S+E+ +KMKV K M +  +E MR KI +++NVIRNLPNNVPY
Sbjct  347  SRYRSLGLRTVPSKEDTIKMKVRKEMNKR-SETMRNKIAMKSNVIRNLPNNVPY  399



>ref|XP_010438043.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=407

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+S+GL T+ ++E  ++MKV K M + G E  RTKIG+++NVIRNLPNNVPY
Sbjct  355  SRYKSLGLKTLPTKEETLRMKVRKDMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  407



>emb|CDY20320.1| BnaC04g36360D [Brassica napus]
Length=399

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RY+SMGLATVQS+E++V+MKVM+ M + G  + R K+G+++NVIRNLPNNV Y
Sbjct  347  NRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  399



>emb|CDY46155.1| BnaA04g14430D [Brassica napus]
Length=399

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RY+SMGLATVQS+E++V+MKVM+ M + G  + R K+G+++NVIRNLPNNV Y
Sbjct  347  NRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  399



>ref|XP_009140559.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=407

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            +RY+SMGLATVQS+E++V+MKVM+ M + G  + R K+G+++NVIRNLPNNV Y
Sbjct  355  NRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  407



>ref|XP_008794318.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776890.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=426

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SR R + LAT+Q++E  V+MKV++ M R G EAMR+KIG+++NVIRNLP NVPY
Sbjct  373  SRNRILRLATMQTKERTVRMKVLRKMNRNGVEAMRSKIGMKSNVIRNLPKNVPY  426



>ref|XP_002974456.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
 gb|EFJ24678.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
Length=398

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNN  35
            SRYRSMGLAT QS+ + V  K    +     EAMRTK+G++NNVIRNLP N
Sbjct  345  SRYRSMGLATRQSQRSFVSRKETSHLPAMRLEAMRTKLGLKNNVIRNLPKN  395



>ref|XP_002985761.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
 gb|EFJ13339.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
Length=394

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNN  35
            SRYRSMGLAT QS+ + V  K    +     EAMRTK+G++NNVIRNLP N
Sbjct  341  SRYRSMGLATRQSQRSFVSRKETSHLPAVRLEAMRTKLGLKNNVIRNLPKN  391



>dbj|BAD53868.1| hypothetical protein [Oryza sativa Japonica Group]
Length=159

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+ M L T+QS+E   ++K ++AM +   E MRTKIG++NNVIR LP N PY
Sbjct  107  SSYKGMRLVTLQSKEKAARLKSLRAMNK-TVENMRTKIGMKNNVIRKLPKNCPY  159



>gb|EAZ02196.1| hypothetical protein OsI_24291 [Oryza sativa Indica Group]
 gb|EAZ38120.1| hypothetical protein OsJ_22469 [Oryza sativa Japonica Group]
Length=168

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            S Y+ M L T+QS+E   ++K ++AM +   E MRTKIG++NNVIR LP N PY
Sbjct  116  SSYKGMRLVTLQSKEKAARLKSLRAMNK-TVENMRTKIGMKNNVIRKLPKNCPY  168



>ref|NP_180026.1| zinc finger domain protein REI1-LIKE 2 [Arabidopsis thaliana]
 gb|AAD25324.1|AF095588_1 C2H2 zinc finger protein FZF [Arabidopsis thaliana]
 gb|AAD18121.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAL32698.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM48014.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC07585.1| C2H2 zinc finger protein FZF [Arabidopsis thaliana]
Length=395

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATVQS+E +V+MKVM+ M + G ++   ++G+++NVIRNLPNNV Y
Sbjct  343  SRYKMMGLATVQSKEAIVRMKVMREMNKRGAKS-SVRLGMKSNVIRNLPNNVTY  395



>gb|KFK32629.1| hypothetical protein AALP_AA6G268300 [Arabis alpina]
Length=403

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+SMGLATV S+E +V+MKV++ M + G ++ R K+G+++NVIRNLPN V Y
Sbjct  351  SRYKSMGLATVHSKEEIVRMKVLREMNKRGAKS-RVKLGMKSNVIRNLPNCVTY  403



>gb|KDO67272.1| hypothetical protein CISIN_1g043125mg [Citrus sinensis]
Length=103

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -3

Query  175  SMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            ++   TVQ+RE+MV+MKV+  M R   EAMRT++G++NN+IRNLP NVPY
Sbjct  54   ALASTTVQTREHMVRMKVINEMNRTRVEAMRTRVGMKNNIIRNLPRNVPY  103



>ref|XP_002880589.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56848.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATV S+E +V+MKVM+ M + G ++   ++G+++NVIRNLPNNV Y
Sbjct  346  SRYKMMGLATVHSKEEIVRMKVMREMNKRGAKS-SVRLGMKSNVIRNLPNNVTY  398



>gb|KDO38064.1| hypothetical protein CISIN_1g042126mg, partial [Citrus sinensis]
Length=369

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVI  53
            SRY+SMGLATVQ+RE+MV+MKV+K M R G EAMRT++G++NN++
Sbjct  322  SRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIM  366



>ref|XP_006293479.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
 gb|EOA26377.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
Length=401

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATV S+E++V+MKVM+ M + G  +   ++G+++NVIRNLPNNV Y
Sbjct  349  SRYKRMGLATVHSKESIVRMKVMREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  401



>ref|XP_010429428.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=404

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATV S+E++V+MKV++ M + G  +   ++G+++NVIRNLPNNV Y
Sbjct  352  SRYKRMGLATVHSKEDIVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  404



>ref|XP_010417208.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=401

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATV S+E+MV+MKV++ M + G  +   ++G+++NVIRNLPNNV Y
Sbjct  349  SRYKRMGLATVHSKEDMVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  401



>ref|XP_010472458.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=403

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -3

Query  187  SRYRSMGLATVQSRENmvkmkvmKAMXRYGNEAMRTKIGIRNNVIRNLPNNVPY  26
            SRY+ MGLATV S+E++V+MKV++ M + G  +   ++G+++NVIRNLPNNV Y
Sbjct  351  SRYKRMGLATVHSKEDIVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  403



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570351139820