BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF004B05

Length=327
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010102859.1|  Zinc finger protein                                109   7e-26   Morus notabilis
gb|KJB55204.1|  hypothetical protein B456_009G068400                    108   9e-26   Gossypium raimondii
gb|KJB55201.1|  hypothetical protein B456_009G068400                    108   1e-25   Gossypium raimondii
gb|KDP33442.1|  hypothetical protein JCGZ_07013                         107   4e-25   Jatropha curcas
gb|KHG19598.1|  Zinc finger protein                                     104   4e-24   Gossypium arboreum [tree cotton]
ref|XP_008466318.1|  PREDICTED: zinc finger protein 622                 103   5e-24   Cucumis melo [Oriental melon]
ref|XP_007011582.1|  Zinc finger protein 622 isoform 1                  103   7e-24   
ref|XP_004136315.1|  PREDICTED: zinc finger protein 622-like            103   7e-24   Cucumis sativus [cucumbers]
gb|KJB06567.1|  hypothetical protein B456_001G001500                    103   8e-24   Gossypium raimondii
gb|KJB06566.1|  hypothetical protein B456_001G001500                    103   9e-24   Gossypium raimondii
ref|XP_004166762.1|  PREDICTED: zinc finger protein 622-like            100   1e-23   
gb|KHG15735.1|  Zinc finger protein                                     102   1e-23   Gossypium arboreum [tree cotton]
ref|XP_009616044.1|  PREDICTED: zinc finger protein 622                 102   1e-23   Nicotiana tomentosiformis
gb|KDO67270.1|  hypothetical protein CISIN_1g015261mg                   102   2e-23   Citrus sinensis [apfelsine]
ref|XP_006450152.1|  hypothetical protein CICLE_v10008476mg             101   5e-23   Citrus clementina [clementine]
ref|XP_006483575.1|  PREDICTED: zinc finger protein 622-like          98.6    5e-23   
emb|CAN62771.1|  hypothetical protein VITISV_027109                     100   5e-23   Vitis vinifera
ref|XP_006483736.1|  PREDICTED: zinc finger protein 622-like            101   6e-23   
ref|XP_009800477.1|  PREDICTED: zinc finger protein 622-like            100   6e-23   Nicotiana sylvestris
ref|XP_009769243.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    100   9e-23   Nicotiana sylvestris
emb|CBI20772.3|  unnamed protein product                                100   9e-23   Vitis vinifera
ref|XP_002282746.1|  PREDICTED: zinc finger protein 622                 100   1e-22   Vitis vinifera
ref|XP_004253056.1|  PREDICTED: zinc finger protein 622                 100   1e-22   Solanum lycopersicum
ref|XP_002527963.1|  transcription factor, putative                     100   1e-22   Ricinus communis
ref|XP_006342459.1|  PREDICTED: zinc finger protein 622-like            100   1e-22   Solanum tuberosum [potatoes]
ref|XP_009618306.1|  PREDICTED: zinc finger protein 622-like          99.8    2e-22   Nicotiana tomentosiformis
ref|XP_011082078.1|  PREDICTED: zinc finger protein 622               99.8    2e-22   Sesamum indicum [beniseed]
emb|CDP12454.1|  unnamed protein product                              99.0    3e-22   Coffea canephora [robusta coffee]
ref|XP_004291236.1|  PREDICTED: zinc finger protein 622               95.1    1e-20   Fragaria vesca subsp. vesca
ref|XP_008347704.1|  PREDICTED: zinc finger protein 622-like          94.7    1e-20   
gb|EYU22071.1|  hypothetical protein MIMGU_mgv1a007393mg              94.4    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_009338830.1|  PREDICTED: zinc finger protein 622-like          94.4    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_010914164.1|  PREDICTED: zinc finger protein 622-like          94.4    2e-20   Elaeis guineensis
ref|XP_008378248.1|  PREDICTED: zinc finger protein 622-like          94.0    2e-20   
ref|XP_006591049.1|  PREDICTED: zinc finger protein 622-like isof...  93.2    2e-20   Glycine max [soybeans]
ref|XP_003550141.1|  PREDICTED: zinc finger protein 622-like          94.0    3e-20   Glycine max [soybeans]
ref|XP_003538077.1|  PREDICTED: zinc finger protein 622-like isof...  94.0    3e-20   Glycine max [soybeans]
ref|XP_003550140.1|  PREDICTED: zinc finger protein 622-like isof...  93.6    3e-20   Glycine max [soybeans]
gb|EPS72142.1|  hypothetical protein M569_02614                       93.2    4e-20   Genlisea aurea
gb|KJB06568.1|  hypothetical protein B456_001G001500                  93.2    4e-20   Gossypium raimondii
ref|XP_007161307.1|  hypothetical protein PHAVU_001G058800g           93.2    5e-20   Phaseolus vulgaris [French bean]
ref|XP_009406616.1|  PREDICTED: zinc finger protein 622-like          92.8    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265409.1|  PREDICTED: zinc finger protein 622               92.8    7e-20   Nelumbo nucifera [Indian lotus]
ref|NP_001280881.1|  zinc finger protein 622                          92.8    7e-20   Malus domestica [apple tree]
ref|XP_009363611.1|  PREDICTED: zinc finger protein 622-like          92.4    8e-20   Pyrus x bretschneideri [bai li]
gb|KHN31608.1|  Zinc finger protein                                   92.4    9e-20   Glycine soja [wild soybean]
ref|XP_008794317.1|  PREDICTED: zinc finger protein 622-like          92.4    1e-19   Phoenix dactylifera
ref|XP_008219929.1|  PREDICTED: zinc finger protein 622               92.0    1e-19   Prunus mume [ume]
ref|XP_007222754.1|  hypothetical protein PRUPE_ppa006521mg           92.0    1e-19   Prunus persica
gb|KHN13053.1|  Zinc finger protein 622                               91.3    1e-19   Glycine soja [wild soybean]
ref|XP_003538078.1|  PREDICTED: zinc finger protein 622-like          91.3    2e-19   Glycine max [soybeans]
gb|KEH39759.1|  C2H2-type zinc finger protein                         91.3    2e-19   Medicago truncatula
ref|XP_008352169.1|  PREDICTED: zinc finger protein 622-like          91.7    2e-19   
ref|XP_011045006.1|  PREDICTED: zinc finger protein 622-like          90.9    3e-19   Populus euphratica
ref|XP_004498584.1|  PREDICTED: zinc finger protein 622-like          90.9    3e-19   Cicer arietinum [garbanzo]
gb|AFK42392.1|  unknown                                               90.5    4e-19   Lotus japonicus
gb|AFK41799.1|  unknown                                               90.5    4e-19   Lotus japonicus
gb|EMT04737.1|  Zinc finger protein 622                               90.1    4e-19   
dbj|BAK05098.1|  predicted protein                                    90.1    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009368013.1|  PREDICTED: zinc finger protein 622-like          90.1    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_003563458.1|  PREDICTED: zinc finger protein 622               89.7    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_011031356.1|  PREDICTED: zinc finger protein 622-like          89.7    8e-19   Populus euphratica
ref|XP_002324955.2|  zinc finger family protein                       89.4    1e-18   
ref|XP_006656412.1|  PREDICTED: zinc finger protein 622-like          89.0    1e-18   Oryza brachyantha
ref|XP_004966161.1|  PREDICTED: zinc finger protein 622-like          89.0    2e-18   Setaria italica
gb|EEC81236.1|  hypothetical protein OsI_24290                        87.8    3e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001058435.1|  Os06g0693500                                     87.8    4e-18   
ref|XP_010049815.1|  PREDICTED: zinc finger protein 622               87.8    5e-18   Eucalyptus grandis [rose gum]
ref|XP_006845651.1|  hypothetical protein AMTR_s00019p00227240        87.0    9e-18   Amborella trichopoda
gb|AFW69247.1|  hypothetical protein ZEAMMB73_978259                  83.6    9e-18   
ref|NP_001151247.1|  LOC100284880                                     86.3    1e-17   Zea mays [maize]
ref|XP_002437507.1|  hypothetical protein SORBIDRAFT_10g028300        85.9    2e-17   Sorghum bicolor [broomcorn]
ref|XP_010525877.1|  PREDICTED: zinc finger protein 622               85.5    3e-17   Tarenaya hassleriana [spider flower]
gb|KDO38064.1|  hypothetical protein CISIN_1g042126mg                 84.0    8e-17   Citrus sinensis [apfelsine]
gb|ABK25050.1|  unknown                                               84.3    9e-17   Picea sitchensis
gb|KHN13054.1|  Zinc finger protein                                   82.4    4e-16   Glycine soja [wild soybean]
gb|KHN31605.1|  Zinc finger protein 622                               80.9    7e-16   Glycine soja [wild soybean]
ref|XP_010668047.1|  PREDICTED: zinc finger protein 622               80.5    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382168.1|  zinc finger family protein                       80.5    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010929264.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  80.1    3e-15   
ref|XP_008794318.1|  PREDICTED: zinc finger protein 622-like          79.7    4e-15   Phoenix dactylifera
ref|XP_006412594.1|  hypothetical protein EUTSA_v10025366mg           79.0    8e-15   Eutrema salsugineum [saltwater cress]
dbj|BAD94371.1|  hypothetical protein with zinc finger                73.6    7e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDX68744.1|  BnaC01g07090D                                        75.9    9e-14   
ref|XP_009126994.1|  PREDICTED: zinc finger protein 622               75.9    9e-14   Brassica rapa
emb|CDY28267.1|  BnaA01g05820D                                        75.5    1e-13   Brassica napus [oilseed rape]
ref|NP_567875.1|  protein REI1-LIKE 1                                 75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAK44084.1|AF370269_1  putative zinc finger protein                75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974652.1|  protein REI1-LIKE 1                                 75.5    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117121.1|  PREDICTED: zinc finger protein 622-like          74.7    2e-13   Brassica rapa
emb|CDY34766.1|  BnaA09g41330D                                        74.7    2e-13   Brassica napus [oilseed rape]
gb|KFK29727.1|  hypothetical protein AALP_AA7G170800                  74.3    4e-13   Arabis alpina [alpine rockcress]
ref|XP_009140559.1|  PREDICTED: zinc finger protein 622               74.3    4e-13   Brassica rapa
emb|CDY46155.1|  BnaA04g14430D                                        74.3    4e-13   Brassica napus [oilseed rape]
emb|CDY20320.1|  BnaC04g36360D                                        74.3    4e-13   Brassica napus [oilseed rape]
ref|XP_006404984.1|  hypothetical protein EUTSA_v10000189mg           73.9    4e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006283853.1|  hypothetical protein CARUB_v10004960mg           72.0    2e-12   Capsella rubella
emb|CDX76808.1|  BnaC08g33940D                                        70.9    3e-12   
ref|XP_010432868.1|  PREDICTED: zinc finger protein 622-like          71.2    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010447561.1|  PREDICTED: zinc finger protein 622-like          70.5    8e-12   Camelina sativa [gold-of-pleasure]
gb|KDO67272.1|  hypothetical protein CISIN_1g043125mg                 67.0    9e-12   Citrus sinensis [apfelsine]
ref|XP_010438043.1|  PREDICTED: zinc finger protein 622-like          70.1    1e-11   Camelina sativa [gold-of-pleasure]
gb|KEH41235.1|  C2H2-type zinc finger protein                         68.9    3e-11   Medicago truncatula
ref|XP_002867303.1|  zinc finger family protein                       68.6    3e-11   
ref|XP_010417208.1|  PREDICTED: zinc finger protein 622-like          67.8    8e-11   Camelina sativa [gold-of-pleasure]
ref|NP_180026.1|  zinc finger domain protein REI1-LIKE 2              67.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293479.1|  hypothetical protein CARUB_v10023355mg           67.0    1e-10   Capsella rubella
gb|KFK32629.1|  hypothetical protein AALP_AA6G268300                  66.2    3e-10   Arabis alpina [alpine rockcress]
ref|XP_010472458.1|  PREDICTED: zinc finger protein 622-like          65.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010429428.1|  PREDICTED: zinc finger protein 622-like          65.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002880589.1|  hypothetical protein ARALYDRAFT_481305           65.9    4e-10   
gb|EAZ02196.1|  hypothetical protein OsI_24291                        63.2    4e-10   Oryza sativa Indica Group [Indian rice]
dbj|BAD53868.1|  hypothetical protein                                 63.2    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002974456.1|  hypothetical protein SELMODRAFT_101058           63.9    2e-09   
ref|XP_002985761.1|  hypothetical protein SELMODRAFT_234873           63.5    2e-09   Selaginella moellendorffii
emb|CDP12462.1|  unnamed protein product                              56.6    6e-07   Coffea canephora [robusta coffee]
ref|XP_001753134.1|  predicted protein                                53.1    7e-06   



>ref|XP_010102859.1| Zinc finger protein [Morus notabilis]
 ref|XP_010111936.1| Zinc finger protein [Morus notabilis]
 gb|EXB94240.1| Zinc finger protein [Morus notabilis]
 gb|EXC32054.1| Zinc finger protein [Morus notabilis]
Length=410

 Score =   109 bits (272),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A+TA+LASRYRSMGLATVQSRE MV+MKVMKA NR G EAMRTKIG+++NVIRNLP N
Sbjct  348  DMAITASLASRYRSMGLATVQSREQMVRMKVMKAMNRSGVEAMRTKIGMKSNVIRNLPKN  407

Query  146  XPY  138
             PY
Sbjct  408  VPY  410



>gb|KJB55204.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=342

 Score =   108 bits (270),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMG+ATVQSRE MV+MKVMKA NR G EAMRTK+G++NNVIRNLP N
Sbjct  280  NMAITAALASRYRSMGIATVQSREQMVRMKVMKAMNRGGVEAMRTKVGVKNNVIRNLPKN  339

Query  146  XPY  138
             PY
Sbjct  340  VPY  342



>gb|KJB55201.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
 gb|KJB55205.1| hypothetical protein B456_009G068400 [Gossypium raimondii]
Length=407

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMG+ATVQSRE MV+MKVMKA NR G EAMRTK+G++NNVIRNLP N
Sbjct  345  NMAITAALASRYRSMGIATVQSREQMVRMKVMKAMNRGGVEAMRTKVGVKNNVIRNLPKN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>gb|KDP33442.1| hypothetical protein JCGZ_07013 [Jatropha curcas]
Length=408

 Score =   107 bits (266),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/61 (82%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQSRE MV+MKVMK  NR G EAMRTKIG++NNVIRNLP N P
Sbjct  348  AITAALASRYRSMGLATVQSREQMVRMKVMKEMNRSGAEAMRTKIGLKNNVIRNLPKNVP  407

Query  140  Y  138
            Y
Sbjct  408  Y  408



>gb|KHG19598.1| Zinc finger protein [Gossypium arboreum]
Length=407

 Score =   104 bits (259),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAAL+SRYRSMG+ATVQSRE +V+MKVMKA NR G EAMRTK+G++NNVIRNLP N P
Sbjct  347  AITAALSSRYRSMGIATVQSREQIVRMKVMKAMNRGGVEAMRTKVGMKNNVIRNLPKNVP  406

Query  140  Y  138
            Y
Sbjct  407  Y  407



>ref|XP_008466318.1| PREDICTED: zinc finger protein 622 [Cucumis melo]
Length=393

 Score =   103 bits (258),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D A+TA LA+RYRSMGLATVQSRE M++MKVMK  NR G EAMRTKIG++NNVIRNLP N
Sbjct  331  DAAITAVLAARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKN  390

Query  146  XPY  138
             P+
Sbjct  391  VPH  393



>ref|XP_007011582.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 ref|XP_007011583.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29201.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
 gb|EOY29202.1| Zinc finger protein 622 isoform 1 [Theobroma cacao]
Length=407

 Score =   103 bits (257),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQSRE +V+MKVMK  NR G EAMRTK+G++NNVIRNLP N
Sbjct  345  NMAITAALASRYRSMGLATVQSREQIVRMKVMKQMNRSGVEAMRTKVGMKNNVIRNLPKN  404

Query  146  XPY  138
             P+
Sbjct  405  VPF  407



>ref|XP_004136315.1| PREDICTED: zinc finger protein 622-like [Cucumis sativus]
 gb|KGN60160.1| hypothetical protein Csa_3G881730 [Cucumis sativus]
Length=395

 Score =   103 bits (257),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D A+TA LA+RYRSMGLATVQSRE M++MKVMK  NR G EAMRTKIG++NNVIRNLP N
Sbjct  333  DAAITAVLAARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKN  392

Query  146  XPY  138
             P+
Sbjct  393  VPH  395



>gb|KJB06567.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=363

 Score =   103 bits (256),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQS+E +V+MKVMKA NR G E MRTK+G++NNVI+NLP N
Sbjct  301  NMAITAALASRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKN  360

Query  146  XPY  138
             PY
Sbjct  361  VPY  363



>gb|KJB06566.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=392

 Score =   103 bits (256),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQS+E +V+MKVMKA NR G E MRTK+G++NNVI+NLP N
Sbjct  330  NMAITAALASRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKN  389

Query  146  XPY  138
             PY
Sbjct  390  VPY  392



>ref|XP_004166762.1| PREDICTED: zinc finger protein 622-like, partial [Cucumis sativus]
Length=182

 Score =   100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D A+TA LA+RYRSMGLATVQSRE M++MKVMK  NR G EAMRTKIG++NNVIRNLP N
Sbjct  120  DAAITAVLAARYRSMGLATVQSREKMIRMKVMKEMNRTGLEAMRTKIGLKNNVIRNLPKN  179

Query  146  XPY  138
             P+
Sbjct  180  VPH  182



>gb|KHG15735.1| Zinc finger protein [Gossypium arboreum]
Length=392

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQS+E +V+MKVMKA NR G E MRTK+G++NNVI+NLP N
Sbjct  330  NMAITAALASRYRSMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKN  389

Query  146  XPY  138
             PY
Sbjct  390  VPY  392



>ref|XP_009616044.1| PREDICTED: zinc finger protein 622 [Nicotiana tomentosiformis]
Length=415

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A++AALA+RYRSMGLATVQSRE+MVKMKV+KA N+ G E MR KIG+++NVIRNLP N
Sbjct  353  DVAVSAALAARYRSMGLATVQSREHMVKMKVLKAMNKSGVEVMRNKIGMKSNVIRNLPKN  412

Query  146  XPY  138
             PY
Sbjct  413  IPY  415



>gb|KDO67270.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=389

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRY+SMGLATVQ+RE+MV+MKV+K  NR G EAMRT++G++NN+IRNLP N
Sbjct  327  NVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKN  386

Query  146  XPY  138
             PY
Sbjct  387  VPY  389



>ref|XP_006450152.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 ref|XP_006483574.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
 gb|ESR63392.1| hypothetical protein CICLE_v10008476mg [Citrus clementina]
 gb|KDO67267.1| hypothetical protein CISIN_1g015261mg [Citrus sinensis]
Length=410

 Score =   101 bits (251),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRY+SMGLATVQ+RE+MV+MKV+K  NR G EAMRT++G++NN+IRNLP N
Sbjct  348  NVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKN  407

Query  146  XPY  138
             PY
Sbjct  408  VPY  410



>ref|XP_006483575.1| PREDICTED: zinc finger protein 622-like [Citrus sinensis]
Length=190

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRY+SMGLATVQ+RE+MV+MKV+K  NR G EAMRT++G++NN+IRNLP N
Sbjct  128  NVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKN  187

Query  146  XPY  138
             PY
Sbjct  188  VPY  190



>emb|CAN62771.1| hypothetical protein VITISV_027109 [Vitis vinifera]
Length=374

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQSRE +V+MKVMK  N+ G EAMR+KIG+++NVIRNLP N P
Sbjct  314  AITAALASRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPKNVP  373

Query  140  Y  138
            Y
Sbjct  374  Y  374



>ref|XP_006483736.1| PREDICTED: zinc finger protein 622-like, partial [Citrus sinensis]
Length=419

 Score =   101 bits (251),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRY+SMGLATVQ+RE+MV+MKV+K  NR G EAMRT++G++NN+IRNLP N
Sbjct  357  NVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNLPKN  416

Query  146  XPY  138
             PY
Sbjct  417  VPY  419



>ref|XP_009800477.1| PREDICTED: zinc finger protein 622-like [Nicotiana sylvestris]
Length=415

 Score =   100 bits (250),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A++AALA+RYRSMGLATVQSRE++VKMKV+KA N+ G E MR KIG+++NVIRNLP N
Sbjct  353  DVAVSAALAARYRSMGLATVQSREHIVKMKVLKAMNKSGVEVMRNKIGMKSNVIRNLPKN  412

Query  146  XPY  138
             PY
Sbjct  413  IPY  415



>ref|XP_009769243.1| PREDICTED: LOW QUALITY PROTEIN: cytoplasmic 60S subunit biogenesis 
factor SPCC550.15c [Nicotiana sylvestris]
Length=412

 Score =   100 bits (249),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+ +TAAL SRYRSMGLATVQS E+MVKMKV+KA NR G +AMR+KIG+++NVIRNLP N
Sbjct  350  DVVITAALTSRYRSMGLATVQSWEHMVKMKVLKAMNRCGVDAMRSKIGMKSNVIRNLPKN  409

Query  146  XPY  138
             PY
Sbjct  410  IPY  412



>emb|CBI20772.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   100 bits (249),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQSRE +V+MKVMK  N+ G EAMR+KIG+++NVIRNLP N P
Sbjct  316  AITAALASRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPNNVP  375

Query  140  Y  138
            Y
Sbjct  376  Y  376



>ref|XP_002282746.1| PREDICTED: zinc finger protein 622 [Vitis vinifera]
Length=411

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/61 (75%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQSRE +V+MKVMK  N+ G EAMR+KIG+++NVIRNLP N P
Sbjct  351  AITAALASRYRSMGLATVQSREQIVRMKVMKQMNKSGVEAMRSKIGMKSNVIRNLPNNVP  410

Query  140  Y  138
            Y
Sbjct  411  Y  411



>ref|XP_004253056.1| PREDICTED: zinc finger protein 622 [Solanum lycopersicum]
Length=415

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A++AALA+RYRSMGLATVQSRE MVK+KV++A N+ G E MR+KIG+++NVIRNLP N
Sbjct  353  DVAISAALAARYRSMGLATVQSREQMVKLKVLRAMNKSGVEIMRSKIGMKSNVIRNLPKN  412

Query  146  XPY  138
             PY
Sbjct  413  IPY  415



>ref|XP_002527963.1| transcription factor, putative [Ricinus communis]
 gb|EEF34375.1| transcription factor, putative [Ricinus communis]
Length=407

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 1/62 (2%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            +A+TAALASRYRSMGLATVQSRE MV+MKVMK  NR  +EAMRTKIG+++N+IRNLP N 
Sbjct  347  VAITAALASRYRSMGLATVQSREQMVRMKVMKEMNR-SSEAMRTKIGMKSNIIRNLPKNV  405

Query  143  PY  138
            PY
Sbjct  406  PY  407



>ref|XP_006342459.1| PREDICTED: zinc finger protein 622-like [Solanum tuberosum]
Length=414

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A++AALA+RYRSMGLATVQSRE MVK+KV++A N+ G E MR+KIG+++NVIRNLP N
Sbjct  352  DVAISAALAARYRSMGLATVQSREQMVKLKVLRAMNKSGVEIMRSKIGMKSNVIRNLPKN  411

Query  146  XPY  138
             PY
Sbjct  412  IPY  414



>ref|XP_009618306.1| PREDICTED: zinc finger protein 622-like [Nicotiana tomentosiformis]
Length=416

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            DIAL+AALASRYR MGLATVQ RE MVKMKV+KA NR G +AM +KIG+++NVIRNLP N
Sbjct  354  DIALSAALASRYRIMGLATVQWRERMVKMKVLKAMNRCGGDAMLSKIGMKSNVIRNLPKN  413

Query  146  XPY  138
             PY
Sbjct  414  TPY  416



>ref|XP_011082078.1| PREDICTED: zinc finger protein 622 [Sesamum indicum]
Length=411

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRY+SMGLATVQSRE++V+MKV+KA N+ G EAMR+KIG+++NVIRNLP N P
Sbjct  351  AITAALASRYKSMGLATVQSREHVVRMKVIKAMNKSGIEAMRSKIGMKSNVIRNLPKNVP  410

Query  140  Y  138
            Y
Sbjct  411  Y  411



>emb|CDP12454.1| unnamed protein product [Coffea canephora]
Length=411

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/60 (75%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A+TAALASRYRSMGLATVQSRE++V+MKV+KA +R G EAMR+KIG+++NVIRNLP N
Sbjct  349  DVAITAALASRYRSMGLATVQSREHIVRMKVLKAMSRSGVEAMRSKIGMKSNVIRNLPKN  408



>ref|XP_004291236.1| PREDICTED: zinc finger protein 622 [Fragaria vesca subsp. vesca]
Length=408

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/62 (68%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            +A+TAA+A+RY+SMGLATVQS+E MV+MKV+K   R G EAMR+KIG+++NVIRNLP N 
Sbjct  347  MAITAAVAARYKSMGLATVQSKERMVQMKVLKEMRRSGVEAMRSKIGMKSNVIRNLPSNV  406

Query  143  PY  138
            PY
Sbjct  407  PY  408



>ref|XP_008347704.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=381

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            +A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N 
Sbjct  320  VAITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNC  379

Query  143  PY  138
             Y
Sbjct  380  TY  381



>gb|EYU22071.1| hypothetical protein MIMGU_mgv1a007393mg [Erythranthe guttata]
Length=409

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            ALT ALA+RY++MGLATVQSRE++V+MKVMKA NR G + MR+K+G+++NVIRNLP N P
Sbjct  349  ALTNALAARYKTMGLATVQSREHVVRMKVMKAMNRSGVDIMRSKMGMKSNVIRNLPKNIP  408

Query  140  Y  138
            Y
Sbjct  409  Y  409



>ref|XP_009338830.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            +A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N 
Sbjct  344  VAITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNC  403

Query  143  PY  138
             Y
Sbjct  404  TY  405



>ref|XP_010914164.1| PREDICTED: zinc finger protein 622-like [Elaeis guineensis]
Length=418

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+AL  +LASRYRS+GLATVQS+E +V+MKV++  NR G E MR+KIG+++NVIRNLP N
Sbjct  356  DVALAISLASRYRSLGLATVQSKEKIVRMKVLRQMNRNGVEVMRSKIGMKSNVIRNLPKN  415

Query  146  XPY  138
             PY
Sbjct  416  VPY  418



>ref|XP_008378248.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=405

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            +A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N 
Sbjct  344  VAITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNC  403

Query  143  PY  138
             Y
Sbjct  404  TY  405



>ref|XP_006591049.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=347

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  285  NMAITAALASRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  344

Query  146  XPY  138
             PY
Sbjct  345  VPY  347



>ref|XP_003550141.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>ref|XP_003538077.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
Length=407

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>ref|XP_003550140.1| PREDICTED: zinc finger protein 622-like isoform X1 [Glycine max]
 ref|XP_006601093.1| PREDICTED: zinc finger protein 622-like isoform X2 [Glycine max]
Length=407

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>gb|EPS72142.1| hypothetical protein M569_02614 [Genlisea aurea]
Length=383

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  311  AALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            A LASRYRSMGL TVQSREN ++MK MKA NR G E MR+KIG+++NVIRNLP N PY
Sbjct  326  AVLASRYRSMGLETVQSRENAIRMKAMKAMNRSGVEFMRSKIGMKSNVIRNLPQNVPY  383



>gb|KJB06568.1| hypothetical protein B456_001G001500 [Gossypium raimondii]
Length=390

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 2/63 (3%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASR  SMGLATVQS+E +V+MKVMKA NR G E MRTK+G++NNVI+NLP N
Sbjct  330  NMAITAALASR--SMGLATVQSKEQIVRMKVMKAMNRSGVETMRTKVGMKNNVIQNLPKN  387

Query  146  XPY  138
             PY
Sbjct  388  VPY  390



>ref|XP_007161307.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
 gb|ESW33301.1| hypothetical protein PHAVU_001G058800g [Phaseolus vulgaris]
Length=413

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL TVQSRE +V+MKV+K  +R G E MR+KI +++NVIRNLP N
Sbjct  351  NMAITAALASRYRSMGLTTVQSREQIVRMKVLKEMSRSGVENMRSKIAMKSNVIRNLPSN  410

Query  146  XPY  138
             PY
Sbjct  411  VPY  413



>ref|XP_009406616.1| PREDICTED: zinc finger protein 622-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D +L  +LASRYRSMGLATVQS+E +V+MKVM+  +R G EAMR+KIG+++NVIRNLP N
Sbjct  355  DASLALSLASRYRSMGLATVQSKEQIVRMKVMREMSRHGVEAMRSKIGMKSNVIRNLPKN  414

Query  146  XPY  138
             PY
Sbjct  415  VPY  417



>ref|XP_010265409.1| PREDICTED: zinc finger protein 622 [Nelumbo nucifera]
Length=404

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+ L AALASRYRSMGL TVQSRE +V+MKV++  NR G +AM+ KIG+++NVI+NLP N
Sbjct  342  DVFLAAALASRYRSMGLVTVQSREQVVRMKVLREMNRSGVQAMQAKIGMKSNVIKNLPKN  401

Query  146  XPY  138
             PY
Sbjct  402  VPY  404



>ref|NP_001280881.1| zinc finger protein 622 [Malus domestica]
 gb|ADL36644.1| C2H2L domain class transcription factor [Malus domestica]
Length=405

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N  
Sbjct  345  AITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCT  404

Query  140  Y  138
            Y
Sbjct  405  Y  405



>ref|XP_009363611.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N  
Sbjct  345  AITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCT  404

Query  140  Y  138
            Y
Sbjct  405  Y  405



>gb|KHN31608.1| Zinc finger protein [Glycine soja]
Length=407

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRS+GL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASRYRSLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>ref|XP_008794317.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776891.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=418

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            DIAL  +LASRYR +GLATVQS+E +V+MKV++  NR G E MR+KIG+++NVIRNLP N
Sbjct  356  DIALAISLASRYRILGLATVQSKERIVRMKVLREMNRNGVEGMRSKIGMKSNVIRNLPNN  415

Query  146  XPY  138
             PY
Sbjct  416  VPY  418



>ref|XP_008219929.1| PREDICTED: zinc finger protein 622 [Prunus mume]
Length=408

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRY+SMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N  
Sbjct  348  AITAALASRYKSMGLATVQSKERMVRMKVLKEMKRSGVEAMRSKMGMKSNVIRNLPKNCT  407

Query  140  Y  138
            Y
Sbjct  408  Y  408



>ref|XP_007222754.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
 gb|EMJ23953.1| hypothetical protein PRUPE_ppa006521mg [Prunus persica]
Length=408

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRY+SMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N  
Sbjct  348  AITAALASRYKSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCT  407

Query  140  Y  138
            Y
Sbjct  408  Y  408



>gb|KHN13053.1| Zinc finger protein 622 [Glycine soja]
Length=346

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  284  NMAITAALASRYRSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  343

Query  146  XPY  138
             PY
Sbjct  344  VPY  346



>ref|XP_003538078.1| PREDICTED: zinc finger protein 622-like [Glycine max]
Length=407

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRS+GL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASRYRSLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPNN  404

Query  146  XPY  138
             PY
Sbjct  405  VPY  407



>gb|KEH39759.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=408

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            +IA+TA LA+RYRSMGLATVQSR+ +V+MKV+K  NR G E MR+K+G+++NVIRNLP N
Sbjct  346  NIAITAELAARYRSMGLATVQSRQQIVRMKVLKQMNRSGVEHMRSKMGMKSNVIRNLPNN  405

Query  146  XPY  138
              Y
Sbjct  406  VTY  408



>ref|XP_008352169.1| PREDICTED: zinc finger protein 622-like [Malus domestica]
Length=434

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            A+TAALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N
Sbjct  345  AITAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKN  402



>ref|XP_011045006.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A+TAALASRYRSMGLATVQSRE MV+MKVMK  NR   E MRTKI ++NNVI NLP N
Sbjct  347  DMAITAALASRYRSMGLATVQSREQMVRMKVMKQVNRSA-ETMRTKISMKNNVIWNLPKN  405

Query  146  XPY  138
              Y
Sbjct  406  VLY  408



>ref|XP_004498584.1| PREDICTED: zinc finger protein 622-like [Cicer arietinum]
Length=410

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+TAALASRYRSMGLATVQSRE+ V+MK++K  N+ G E MR+K+G+++NVIRNLP N  
Sbjct  350  AITAALASRYRSMGLATVQSREHFVRMKILKEMNKSGVEHMRSKMGMKSNVIRNLPNNVT  409

Query  140  Y  138
            Y
Sbjct  410  Y  410



>gb|AFK42392.1| unknown [Lotus japonicus]
Length=410

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQSRE +V+MKV+K  ++ G E MR+K+G+++NVIRNLP N
Sbjct  348  NMAITAALASRYRSMGLATVQSREQIVRMKVLKQMSKTGVENMRSKMGMKSNVIRNLPKN  407

Query  146  XPY  138
              Y
Sbjct  408  CTY  410



>gb|AFK41799.1| unknown [Lotus japonicus]
Length=410

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/63 (65%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASRYRSMGLATVQSRE +V+MKV+K  ++ G E MR+K+G+++NVIRNLP N
Sbjct  348  NMAITAALASRYRSMGLATVQSREQIVRMKVLKQMSKTGVENMRSKMGMKSNVIRNLPKN  407

Query  146  XPY  138
              Y
Sbjct  408  CTY  410



>gb|EMT04737.1| Zinc finger protein 622 [Aegilops tauschii]
Length=379

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  317  DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKN  376

Query  146  XPY  138
             PY
Sbjct  377  VPY  379



>dbj|BAK05098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  338  DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKN  397

Query  146  XPY  138
             PY
Sbjct  398  VPY  400



>ref|XP_009368013.1| PREDICTED: zinc finger protein 622-like [Pyrus x bretschneideri]
Length=405

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -2

Query  320  ALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXP  141
            A+ AALASRYRSMGLATVQS+E MV+MKV+K   R G EAMR+K+G+++NVIRNLP N  
Sbjct  345  AIRAALASRYRSMGLATVQSKERMVRMKVLKEMRRSGVEAMRSKMGMKSNVIRNLPKNCT  404

Query  140  Y  138
            Y
Sbjct  405  Y  405



>ref|XP_003563458.1| PREDICTED: zinc finger protein 622 [Brachypodium distachyon]
Length=402

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  340  DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKN  399

Query  146  XPY  138
             PY
Sbjct  400  VPY  402



>ref|XP_011031356.1| PREDICTED: zinc finger protein 622-like [Populus euphratica]
Length=408

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -2

Query  323  IALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNX  144
            IA+ AALASRYRSMGL T+QSRE MV+MKVMK  +R   EAMRTKI ++NNVI NLP N 
Sbjct  348  IAVAAALASRYRSMGLTTIQSREQMVRMKVMKQVSRSA-EAMRTKINMKNNVIWNLPKNV  406

Query  143  PY  138
            PY
Sbjct  407  PY  408



>ref|XP_002324955.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF03520.2| zinc finger family protein [Populus trichocarpa]
Length=407

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+A+TAALASRYRSMGLATVQSRE M++MKVMK  NR   EAMRTKI  +NNVI +LP N
Sbjct  346  DMAITAALASRYRSMGLATVQSREQMLRMKVMKQVNRSA-EAMRTKISTKNNVIWDLPKN  404

Query  146  XPY  138
              Y
Sbjct  405  VLY  407



>ref|XP_006656412.1| PREDICTED: zinc finger protein 622-like [Oryza brachyantha]
Length=398

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQSRE +V++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  336  DRALALSLASSYKSMGLVTVQSREQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKN  395

Query  146  XPY  138
             PY
Sbjct  396  CPY  398



>ref|XP_004966161.1| PREDICTED: zinc finger protein 622-like [Setaria italica]
Length=405

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  343  DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNKSGVETMRTKIGMKSNVIRNLPKN  402

Query  146  XPY  138
             PY
Sbjct  403  CPY  405



>gb|EEC81236.1| hypothetical protein OsI_24290 [Oryza sativa Indica Group]
Length=358

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E +V++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  296  DRALALSLASSYKSMGLVTVQSKEQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKN  355

Query  146  XPY  138
             PY
Sbjct  356  CPY  358



>ref|NP_001058435.1| Os06g0693500 [Oryza sativa Japonica Group]
 dbj|BAD53867.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF20349.1| Os06g0693500 [Oryza sativa Japonica Group]
 gb|EAZ38119.1| hypothetical protein OsJ_22468 [Oryza sativa Japonica Group]
 dbj|BAG95937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=399

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E +V++KV++A N+ G E MRTKIG+++NVIRNLP N
Sbjct  337  DRALALSLASSYKSMGLVTVQSKEQVVRLKVLRAMNKTGVETMRTKIGMKSNVIRNLPKN  396

Query  146  XPY  138
             PY
Sbjct  397  CPY  399



>ref|XP_010049815.1| PREDICTED: zinc finger protein 622 [Eucalyptus grandis]
 gb|KCW82616.1| hypothetical protein EUGRSUZ_C04005 [Eucalyptus grandis]
Length=414

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  320  ALTAALASRYRSMGLAT-VQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            A+TAALASRYRSMGL T V+SRE MV++KV++  NR G EAMRTKIG+++NVIRNLP N
Sbjct  353  AITAALASRYRSMGLTTTVRSREQMVRLKVIREMNRSGVEAMRTKIGMKSNVIRNLPKN  411



>ref|XP_006845651.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
 gb|ERN07326.1| hypothetical protein AMTR_s00019p00227240 [Amborella trichopoda]
Length=403

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  AL SRY++MG+ TVQS+E +++MKV+K  +R G EA+RT++G++NNVIRNLP N
Sbjct  341  DAALARALVSRYQNMGVVTVQSKERVLRMKVLKEMHRSGVEALRTRVGMKNNVIRNLPKN  400

Query  146  XPY  138
             PY
Sbjct  401  VPY  403



>gb|AFW69247.1| hypothetical protein ZEAMMB73_978259, partial [Zea mays]
Length=143

 Score = 83.6 bits (205),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A NR G E MR KIG+++NVIRNLP N
Sbjct  81   DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNRTGVETMRNKIGMKSNVIRNLPKN  140

Query  146  XPY  138
             P+
Sbjct  141  CPH  143



>ref|NP_001151247.1| LOC100284880 [Zea mays]
 gb|ACG42118.1| zinc finger protein 622 [Zea mays]
 gb|ACR38026.1| unknown [Zea mays]
 gb|AFW69246.1| Zinc finger protein 622 [Zea mays]
Length=404

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y+SMGL TVQS+E MV++KV++A NR G E MR KIG+++NVIRNLP N
Sbjct  342  DRALALSLASSYKSMGLVTVQSKEQMVRLKVLRAMNRTGVETMRNKIGMKSNVIRNLPKN  401

Query  146  XPY  138
             P+
Sbjct  402  CPH  404



>ref|XP_002437507.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
 gb|EER88874.1| hypothetical protein SORBIDRAFT_10g028300 [Sorghum bicolor]
Length=404

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D AL  +LAS Y++MGL TVQS+E MV++KV++A N+ G E MR KIG+++NVIRNLP N
Sbjct  342  DRALALSLASSYKNMGLVTVQSKEQMVRLKVLRAMNKTGVETMRNKIGMKSNVIRNLPKN  401

Query  146  XPY  138
             PY
Sbjct  402  CPY  404



>ref|XP_010525877.1| PREDICTED: zinc finger protein 622 [Tarenaya hassleriana]
Length=410

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 38/60 (63%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+LASRY+SMGL TVQS+E++V+MKV++  NR G E MRTK+G+++NVIRNLP N PY
Sbjct  352  IIASLASRYKSMGLTTVQSKEHIVRMKVLREMNRRG-ETMRTKLGMKSNVIRNLPKNVPY  410



>gb|KDO38064.1| hypothetical protein CISIN_1g042126mg, partial [Citrus sinensis]
Length=369

 Score = 84.0 bits (206),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVI  165
            ++A+TAALASRY+SMGLATVQ+RE+MV+MKV+K  NR G EAMRT++G++NN++
Sbjct  313  NVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIM  366



>gb|ABK25050.1| unknown [Picea sitchensis]
Length=420

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D+AL+ AL SRYRSMGLATVQS+E +++   +K     G E MRTK+G++NNVIRNLP N
Sbjct  358  DVALSHALVSRYRSMGLATVQSKEKILRRNALKKIRSSGVEVMRTKVGLKNNVIRNLPKN  417

Query  146  XPY  138
             PY
Sbjct  418  VPY  420



>gb|KHN13054.1| Zinc finger protein [Glycine soja]
Length=405

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 51/63 (81%), Gaps = 2/63 (3%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+TAALASR  S+GL T+QSRE +V+MKV+K  NR G + MRTK+ +++NVIRNLP N
Sbjct  345  NMAITAALASR--SLGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMKSNVIRNLPKN  402

Query  146  XPY  138
             PY
Sbjct  403  VPY  405



>gb|KHN31605.1| Zinc finger protein 622 [Glycine soja]
Length=352

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 10/73 (14%)
 Frame = -2

Query  326  DIALTAALASR----------YRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIR  177
            ++A+TAALASR          + SMGL T+QSRE +V+MKV+K  NR G + MRTK+ ++
Sbjct  280  NMAITAALASRQMVVMILLFFFLSMGLTTIQSREKIVRMKVLKEMNRSGVDNMRTKMAMK  339

Query  176  NNVIRNLPXNXPY  138
            +NVIRNLP N PY
Sbjct  340  SNVIRNLPKNVPY  352



>ref|XP_010668047.1| PREDICTED: zinc finger protein 622 [Beta vulgaris subsp. vulgaris]
Length=404

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  299  SRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            SRY+SMG+ TVQS++  ++MKV+K  NR G EAMR+K+G+++NVIRNLP N PY
Sbjct  351  SRYKSMGIVTVQSKQQTIRMKVLKEINRSGVEAMRSKMGMKSNVIRNLPNNVPY  404



>ref|XP_006382168.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP59965.1| zinc finger family protein [Populus trichocarpa]
Length=408

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  299  SRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            SRYRSMGL TVQSRE MV+MKVMK  +R   EAMRTKI ++NNVI NLP N PY
Sbjct  356  SRYRSMGLTTVQSREQMVRMKVMKQVSRSA-EAMRTKINMKNNVIWNLPKNVPY  408



>ref|XP_010929264.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 622-like 
[Elaeis guineensis]
Length=411

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            DIA  A+LASR RS+  ATVQS+  +V MK+++  NR G EAMR+KIG+++NVIRNLP N
Sbjct  349  DIAQAASLASRDRSLRSATVQSKVRIVTMKLLRKMNRNGVEAMRSKIGMKSNVIRNLPKN  408

Query  146  XPY  138
             PY
Sbjct  409  VPY  411



>ref|XP_008794318.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
 ref|XP_008776890.1| PREDICTED: zinc finger protein 622-like [Phoenix dactylifera]
Length=426

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            DIA   +LASR R + LAT+Q++E  V+MKV++  NR G EAMR+KIG+++NVIRNLP N
Sbjct  364  DIAPAISLASRNRILRLATMQTKERTVRMKVLRKMNRNGVEAMRSKIGMKSNVIRNLPKN  423

Query  146  XPY  138
             PY
Sbjct  424  VPY  426



>ref|XP_006412594.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
 dbj|BAJ34316.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54047.1| hypothetical protein EUTSA_v10025366mg [Eutrema salsugineum]
Length=402

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E+ VKMKV+K  N+ G E MRTKI +++NVIRNLP N PY
Sbjct  344  IIASLSSRYKSLGLKTVPSKEDTVKMKVLKEMNKRG-ETMRTKIAMKSNVIRNLPNNVPY  402



>dbj|BAD94371.1| hypothetical protein with zinc finger [Arabidopsis thaliana]
Length=154

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  96   IIASLSSRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  154



>emb|CDX68744.1| BnaC01g07090D [Brassica napus]
Length=403

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E+ VKMK +K  N+ G E MRTK+ +++NVIRNLP N PY
Sbjct  345  IVASLSSRYKSLGLKTVPSKEDRVKMKALKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  403



>ref|XP_009126994.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=395

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E+ VKMK +K  N+ G E MRTK+ +++NVIRNLP N PY
Sbjct  337  IVASLSSRYKSLGLKTVPSKEDRVKMKALKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  395



>emb|CDY28267.1| BnaA01g05820D [Brassica napus]
Length=395

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E+ VKMK +K  N+ G E MRTK+ +++NVIRNLP N PY
Sbjct  337  IVASLSSRYKSLGLKTVPSKEDRVKMKAIKEMNKRG-ETMRTKMAMKSNVIRNLPNNVPY  395



>ref|NP_567875.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AAN12920.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AEE85908.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=404

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  346  IIASLSSRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  404



>gb|AAK44084.1|AF370269_1 putative zinc finger protein [Arabidopsis thaliana]
Length=404

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  346  IIASLSSRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  404



>ref|NP_974652.1| protein REI1-LIKE 1 [Arabidopsis thaliana]
 gb|AEE85909.1| zinc finger protein 622 [Arabidopsis thaliana]
Length=405

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV S+E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  347  IIASLSSRYKSLGLKTVPSKEETLRMKVRKEMSKRG-ETMRTKIGVKSNVIRNLPNNVPY  405



>ref|XP_009117121.1| PREDICTED: zinc finger protein 622-like [Brassica rapa]
Length=400

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA RY+SMGLATVQS+E++V+MKVM+  N+ G   MR K+G+++NVIRNLP N  Y
Sbjct  345  SLALRYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  400



>emb|CDY34766.1| BnaA09g41330D [Brassica napus]
Length=400

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA RY+SMGLATVQS+E++V+MKVM+  N+ G   MR K+G+++NVIRNLP N  Y
Sbjct  345  SLALRYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  400



>gb|KFK29727.1| hypothetical protein AALP_AA7G170800 [Arabis alpina]
Length=399

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRYRS+GL TV S+E+ +KMKV K  N+  +E MR KI +++NVIRNLP N PY
Sbjct  341  IVASLSSRYRSLGLRTVPSKEDTIKMKVRKEMNKR-SETMRNKIAMKSNVIRNLPNNVPY  399



>ref|XP_009140559.1| PREDICTED: zinc finger protein 622 [Brassica rapa]
Length=407

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA+RY+SMGLATVQS+E++V+MKVM+  N+ G  + R K+G+++NVIRNLP N  Y
Sbjct  352  SLANRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  407



>emb|CDY46155.1| BnaA04g14430D [Brassica napus]
Length=399

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA+RY+SMGLATVQS+E++V+MKVM+  N+ G  + R K+G+++NVIRNLP N  Y
Sbjct  344  SLANRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  399



>emb|CDY20320.1| BnaC04g36360D [Brassica napus]
Length=399

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA+RY+SMGLATVQS+E++V+MKVM+  N+ G  + R K+G+++NVIRNLP N  Y
Sbjct  344  SLANRYKSMGLATVQSKEDIVRMKVMREMNKRGARS-RVKLGMKSNVIRNLPNNVTY  399



>ref|XP_006404984.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
 dbj|BAJ34463.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46437.1| hypothetical protein EUTSA_v10000189mg [Eutrema salsugineum]
Length=403

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +L SRY+SMGLATV S+E++V+MKVM+  N+ G + MR K+G+++NVIRNLP N  Y
Sbjct  348  SLTSRYKSMGLATVHSKEDIVRMKVMREMNKRGAK-MRVKLGMKSNVIRNLPNNVTY  403



>ref|XP_006283853.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
 gb|EOA16751.1| hypothetical protein CARUB_v10004960mg [Capsella rubella]
Length=403

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL T  ++E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  345  IIASLSSRYKSLGLKTAPTKEETLRMKVRKQMSQRG-ETMRTKIGVKSNVIRNLPNNVPY  403



>emb|CDX76808.1| BnaC08g33940D [Brassica napus]
Length=319

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 46/57 (81%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +LA RY+SMGLATVQS+E++V+MKVM+  N+ G   MR K+G+++NVIRNLP N  Y
Sbjct  264  SLALRYKSMGLATVQSKEDIVRMKVMREMNKRGAR-MRVKLGMKSNVIRNLPNNVTY  319



>ref|XP_010432868.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL TV ++E  ++MKV K  ++ G E  RTKIG+++NVIRNLP N PY
Sbjct  348  IIASLSSRYKSLGLKTVPTKEETLRMKVRKEMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  406



>ref|XP_010447561.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=406

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+++SRY+S+GL TV ++E  ++MKV K  ++ G E  RTKIG+++NVIRNLP N PY
Sbjct  348  IVASISSRYKSLGLKTVPTKEETLRMKVRKEMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  406



>gb|KDO67272.1| hypothetical protein CISIN_1g043125mg [Citrus sinensis]
Length=103

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 7/63 (11%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            ++A+  ALAS        TVQ+RE+MV+MKV+   NR   EAMRT++G++NN+IRNLP N
Sbjct  48   NVAIAVALAS-------TTVQTREHMVRMKVINEMNRTRVEAMRTRVGMKNNIIRNLPRN  100

Query  146  XPY  138
             PY
Sbjct  101  VPY  103



>ref|XP_010438043.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=407

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/60 (52%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            + A+L+SRY+S+GL T+ ++E  ++MKV K  ++ G E  RTKIG+++NVIRNLP N PY
Sbjct  349  IVASLSSRYKSLGLKTLPTKEETLRMKVRKDMSQRG-ETTRTKIGVKSNVIRNLPNNVPY  407



>gb|KEH41235.1| C2H2-type zinc finger protein [Medicago truncatula]
Length=476

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNN  171
            +IA+ A LA+R+RSMGLA+VQSR+ +V+MKV+K  NR G E MR+K+G+++N
Sbjct  296  NIAIIAELAARHRSMGLASVQSRQQIVRMKVLKLMNRSGVEHMRSKMGMKSN  347



>ref|XP_002867303.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43562.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -2

Query  296  RYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            RY+S+GL TV S+E  ++MKV K  ++ G E MRTKIG+++NVIRNLP N PY
Sbjct  354  RYKSLGLKTVPSKEETLRMKVRKEMSQRG-ETMRTKIGVKSNVIRNLPNNVPY  405



>ref|XP_010417208.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=401

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            L  +L SRY+ MGLATV S+E+MV+MKV++  N+ G  +   ++G+++NVIRNLP N  Y
Sbjct  343  LVNSLTSRYKRMGLATVHSKEDMVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  401



>ref|NP_180026.1| zinc finger domain protein REI1-LIKE 2 [Arabidopsis thaliana]
 gb|AAD25324.1|AF095588_1 C2H2 zinc finger protein FZF [Arabidopsis thaliana]
 gb|AAD18121.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAL32698.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM48014.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC07585.1| C2H2 zinc finger protein FZF [Arabidopsis thaliana]
Length=395

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +L SRY+ MGLATVQS+E +V+MKVM+  N+ G ++   ++G+++NVIRNLP N  Y
Sbjct  340  SLTSRYKMMGLATVQSKEAIVRMKVMREMNKRGAKS-SVRLGMKSNVIRNLPNNVTY  395



>ref|XP_006293479.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
 gb|EOA26377.1| hypothetical protein CARUB_v10023355mg [Capsella rubella]
Length=401

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            L  +L SRY+ MGLATV S+E++V+MKVM+  N+ G  +   ++G+++NVIRNLP N  Y
Sbjct  343  LVNSLTSRYKRMGLATVHSKESIVRMKVMREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  401



>gb|KFK32629.1| hypothetical protein AALP_AA6G268300 [Arabis alpina]
Length=403

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +L SRY+SMGLATV S+E +V+MKV++  N+ G ++ R K+G+++NVIRNLP    Y
Sbjct  348  SLTSRYKSMGLATVHSKEEIVRMKVLREMNKRGAKS-RVKLGMKSNVIRNLPNCVTY  403



>ref|XP_010472458.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=403

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            L  +L SRY+ MGLATV S+E++V+MKV++  N+ G  +   ++G+++NVIRNLP N  Y
Sbjct  345  LVNSLTSRYKRMGLATVHSKEDIVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  403



>ref|XP_010429428.1| PREDICTED: zinc finger protein 622-like [Camelina sativa]
Length=404

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -2

Query  317  LTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            L  +L SRY+ MGLATV S+E++V+MKV++  N+ G  +   ++G+++NVIRNLP N  Y
Sbjct  346  LVNSLTSRYKRMGLATVHSKEDIVRMKVLREMNKRGARS-SVRLGMKSNVIRNLPNNVTY  404



>ref|XP_002880589.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56848.1| hypothetical protein ARALYDRAFT_481305 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            +L SRY+ MGLATV S+E +V+MKVM+  N+ G ++   ++G+++NVIRNLP N  Y
Sbjct  343  SLTSRYKMMGLATVHSKEEIVRMKVMREMNKRGAKS-SVRLGMKSNVIRNLPNNVTY  398



>gb|EAZ02196.1| hypothetical protein OsI_24291 [Oryza sativa Indica Group]
 gb|EAZ38120.1| hypothetical protein OsJ_22469 [Oryza sativa Japonica Group]
Length=168

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D  L  +LAS Y+ M L T+QS+E   ++K ++A N+   E MRTKIG++NNVIR LP N
Sbjct  107  DRVLPLSLASSYKGMRLVTLQSKEKAARLKSLRAMNKTV-ENMRTKIGMKNNVIRKLPKN  165

Query  146  XPY  138
             PY
Sbjct  166  CPY  168



>dbj|BAD53868.1| hypothetical protein [Oryza sativa Japonica Group]
Length=159

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            D  L  +LAS Y+ M L T+QS+E   ++K ++A N+   E MRTKIG++NNVIR LP N
Sbjct  98   DRVLPLSLASSYKGMRLVTLQSKEKAARLKSLRAMNKTV-ENMRTKIGMKNNVIRKLPKN  156

Query  146  XPY  138
             PY
Sbjct  157  CPY  159



>ref|XP_002974456.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
 gb|EFJ24678.1| hypothetical protein SELMODRAFT_101058 [Selaginella moellendorffii]
Length=398

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            AL SRYRSMGLAT QS+ + V  K          EAMRTK+G++NNVIRNLP N
Sbjct  342  ALVSRYRSMGLATRQSQRSFVSRKETSHLPAMRLEAMRTKLGLKNNVIRNLPKN  395



>ref|XP_002985761.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
 gb|EFJ13339.1| hypothetical protein SELMODRAFT_234873 [Selaginella moellendorffii]
Length=394

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSRENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXN  147
            AL SRYRSMGLAT QS+ + V  K          EAMRTK+G++NNVIRNLP N
Sbjct  338  ALVSRYRSMGLATRQSQRSFVSRKETSHLPAVRLEAMRTKLGLKNNVIRNLPKN  391



>emb|CDP12462.1| unnamed protein product [Coffea canephora]
Length=379

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/30 (83%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  326  DIALTAALASRYRSMGLATVQSRENMVKMK  237
            D+A+TAALASRYRSMGLATVQSRE++V+MK
Sbjct  349  DVAITAALASRYRSMGLATVQSREHIVRMK  378



>ref|XP_001753134.1| predicted protein [Physcomitrella patens]
 gb|EDQ82175.1| predicted protein [Physcomitrella patens]
Length=398

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = -2

Query  308  ALASRYRSMGLATVQSR---ENMVKMKVMKATNRXGNEAMRTKIGIRNNVIRNLPXNXPY  138
            AL +RYRSMGLAT + +    N  + +  KA+ R   E +R+KI ++NNVIRNLP N  Y
Sbjct  341  ALVARYRSMGLATQEQQWRLRNKPEEQQRKASQRA--EYIRSKIALKNNVIRNLPRNCEY  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566749560160