BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF003I01

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010087126.1|  hypothetical protein L484_012559                   177   7e-50   
ref|XP_002281626.1|  PREDICTED: transcription factor UNE12              176   8e-50   Vitis vinifera
ref|XP_002520976.1|  DNA binding protein, putative                      174   1e-48   Ricinus communis
gb|KHN02539.1|  Transcription factor UNE12                              170   2e-48   Glycine soja [wild soybean]
ref|XP_006383684.1|  hypothetical protein POPTR_0005s23930g             172   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011042433.1|  PREDICTED: transcription factor UNE12              172   3e-48   Populus euphratica
gb|EYU46514.1|  hypothetical protein MIMGU_mgv1a010915mg                172   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_007050429.1|  Basic helix-loop-helix DNA-binding superfami...    171   8e-48   
ref|XP_008451266.1|  PREDICTED: transcription factor UNE12              171   1e-47   Cucumis melo [Oriental melon]
gb|KDP21374.1|  hypothetical protein JCGZ_21845                         171   1e-47   Jatropha curcas
ref|XP_003554277.1|  PREDICTED: transcription factor UNE12-like i...    170   2e-47   Glycine max [soybeans]
ref|XP_004146956.1|  PREDICTED: transcription factor UNE12-like         171   2e-47   Cucumis sativus [cucumbers]
emb|CDP03688.1|  unnamed protein product                                169   7e-47   Coffea canephora [robusta coffee]
ref|XP_009354865.1|  PREDICTED: transcription factor UNE12              169   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_011026052.1|  PREDICTED: transcription factor UNE12-like         168   1e-46   Populus euphratica
gb|KHF99712.1|  Transcription factor UNE12 -like protein                168   1e-46   Gossypium arboreum [tree cotton]
ref|XP_011082599.1|  PREDICTED: transcription factor UNE12-like         169   2e-46   Sesamum indicum [beniseed]
gb|KJB42176.1|  hypothetical protein B456_007G141800                    168   2e-46   Gossypium raimondii
ref|XP_002302077.1|  basic helix-loop-helix family protein              168   2e-46   Populus trichocarpa [western balsam poplar]
gb|KJB42177.1|  hypothetical protein B456_007G141800                    168   2e-46   Gossypium raimondii
ref|XP_008372300.1|  PREDICTED: transcription factor UNE12-like         167   2e-46   
ref|XP_008372294.1|  PREDICTED: transcription factor UNE12-like         167   3e-46   
gb|KHN10703.1|  Transcription factor UNE12                              164   4e-46   Glycine soja [wild soybean]
ref|XP_007144689.1|  hypothetical protein PHAVU_007G176900g             166   5e-46   Phaseolus vulgaris [French bean]
gb|ACN21630.1|  putative basic helix-loop-helix protein BHLH3           166   7e-46   Lotus japonicus
gb|KHG12939.1|  Transcription factor UNE12 -like protein                166   1e-45   Gossypium arboreum [tree cotton]
gb|KHN03837.1|  Transcription factor UNE12                              165   1e-45   Glycine soja [wild soybean]
ref|XP_003536810.1|  PREDICTED: transcription factor UNE12              165   1e-45   Glycine max [soybeans]
ref|XP_007162488.1|  hypothetical protein PHAVU_001G156400g             165   2e-45   Phaseolus vulgaris [French bean]
ref|XP_003521266.1|  PREDICTED: transcription factor UNE12-like         165   2e-45   Glycine max [soybeans]
gb|KJB25973.1|  hypothetical protein B456_004G218900                    164   4e-45   Gossypium raimondii
gb|KJB22947.1|  hypothetical protein B456_004G075200                    164   6e-45   Gossypium raimondii
ref|XP_011079946.1|  PREDICTED: transcription factor UNE12              164   6e-45   Sesamum indicum [beniseed]
ref|XP_004495148.1|  PREDICTED: transcription factor UNE12-like i...    163   7e-45   Cicer arietinum [garbanzo]
gb|KHG09586.1|  Transcription factor UNE12 -like protein                164   7e-45   Gossypium arboreum [tree cotton]
ref|XP_003590536.1|  Transcription factor UNE12                         161   5e-44   Medicago truncatula
ref|XP_003590537.1|  Transcription factor UNE12                         161   5e-44   Medicago truncatula
gb|KHN18841.1|  Transcription factor UNE12                              160   9e-44   Glycine soja [wild soybean]
ref|XP_003520191.1|  PREDICTED: transcription factor UNE12-like         160   9e-44   
ref|XP_008382959.1|  PREDICTED: transcription factor UNE12-like         159   3e-43   Malus domestica [apple tree]
ref|XP_006349737.1|  PREDICTED: transcription factor UNE12-like         159   6e-43   Solanum tuberosum [potatoes]
ref|XP_004247209.1|  PREDICTED: transcription factor UNE12              159   6e-43   Solanum lycopersicum
emb|CDY18011.1|  BnaC03g30830D                                          159   7e-43   Brassica napus [oilseed rape]
ref|XP_009134422.1|  PREDICTED: transcription factor UNE12-like         157   2e-42   Brassica rapa
ref|XP_006396471.1|  hypothetical protein EUTSA_v10028824mg             157   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_007201836.1|  hypothetical protein PRUPE_ppa009299mg             157   3e-42   Prunus persica
ref|XP_004289895.1|  PREDICTED: transcription factor UNE12              156   4e-42   Fragaria vesca subsp. vesca
ref|XP_008235331.1|  PREDICTED: transcription factor UNE12              156   4e-42   Prunus mume [ume]
ref|NP_001118919.1|  transcription factor UNE12                         155   4e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22062.1|  BnaA09g00910D                                          156   5e-42   Brassica napus [oilseed rape]
ref|XP_010041192.1|  PREDICTED: transcription factor UNE12-like         150   6e-42   Eucalyptus grandis [rose gum]
ref|XP_002872829.1|  hypothetical protein ARALYDRAFT_490301             156   6e-42   
ref|XP_010422571.1|  PREDICTED: transcription factor UNE12-like         155   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009111272.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    156   8e-42   Brassica rapa
gb|KHG20614.1|  Transcription factor UNE12 -like protein                149   8e-42   Gossypium arboreum [tree cotton]
gb|KHG26252.1|  Transcription factor UNE12 -like protein                150   1e-41   Gossypium arboreum [tree cotton]
emb|CDY21898.1|  BnaC09g00040D                                          155   1e-41   Brassica napus [oilseed rape]
emb|CDX90930.1|  BnaA03g26100D                                          155   1e-41   
ref|NP_567245.1|  transcription factor UNE12                            155   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB11136.1|  hypothetical protein B456_001G242500                    155   2e-41   Gossypium raimondii
ref|XP_009607290.1|  PREDICTED: transcription factor UNE12-like         154   2e-41   Nicotiana tomentosiformis
ref|XP_010429869.1|  PREDICTED: transcription factor UNE12-like         155   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009776898.1|  PREDICTED: transcription factor UNE12-like         154   3e-41   Nicotiana sylvestris
emb|CDX91293.1|  BnaC02g27040D                                          154   3e-41   
ref|XP_006443926.1|  hypothetical protein CICLE_v10021443mg             154   4e-41   Citrus clementina [clementine]
ref|XP_006288280.1|  hypothetical protein CARUB_v10001523mg             154   4e-41   
ref|XP_010456011.1|  PREDICTED: transcription factor UNE12              154   4e-41   Camelina sativa [gold-of-pleasure]
gb|AAM65759.1|  putative bHLH transcription factor                      154   6e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ33851.1|  unnamed protein product                                154   6e-41   Eutrema halophilum
gb|AAM10948.1|AF488592_1  putative bHLH transcription factor            153   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679161.1|  PREDICTED: transcription factor UNE12              152   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|AIL24119.1|  basic helix-loop-helix leucine-zipper transcripti...    152   2e-40   Tamarix hispida
ref|XP_004493736.1|  PREDICTED: transcription factor UNE12-like i...    151   3e-40   Cicer arietinum [garbanzo]
ref|XP_004493737.1|  PREDICTED: transcription factor UNE12-like i...    150   5e-40   Cicer arietinum [garbanzo]
ref|XP_010038816.1|  PREDICTED: transcription factor UNE12 isofor...    150   1e-39   Eucalyptus grandis [rose gum]
ref|XP_010038809.1|  PREDICTED: transcription factor UNE12 isofor...    150   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010522761.1|  PREDICTED: transcription factor UNE12              146   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_010457311.1|  PREDICTED: transcription factor bHLH7              140   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010274210.1|  PREDICTED: transcription factor UNE12 isofor...    144   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010274208.1|  PREDICTED: transcription factor UNE12 isofor...    143   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006305432.1|  hypothetical protein CARUB_v10009831mg             142   1e-36   Capsella rubella
gb|ACN21631.1|  putative basic helix-loop-helix protein BHLH4           140   4e-36   Lotus japonicus
gb|KDO48911.1|  hypothetical protein CISIN_1g040019mg                   136   7e-36   Citrus sinensis [apfelsine]
ref|XP_009144630.1|  PREDICTED: transcription factor UNE12-like         139   1e-35   Brassica rapa
ref|NP_001184895.1|  transcription factor bHLH7                         139   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892144.1|  basic helix-loop-helix family protein              139   2e-35   
ref|NP_563672.1|  transcription factor bHLH7                            139   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97278.1|  BnaA02g20690D                                          139   2e-35   
gb|KFK42664.1|  hypothetical protein AALP_AA1G023700                    139   2e-35   Arabis alpina [alpine rockcress]
ref|XP_008218266.1|  PREDICTED: transcription factor UNE12-like i...    140   2e-35   Prunus mume [ume]
ref|XP_008218265.1|  PREDICTED: transcription factor UNE12-like i...    139   2e-35   Prunus mume [ume]
ref|XP_009364494.1|  PREDICTED: transcription factor UNE12 isofor...    139   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_008366876.1|  PREDICTED: transcription factor UNE12-like i...    139   3e-35   Malus domestica [apple tree]
ref|XP_009364493.1|  PREDICTED: transcription factor UNE12 isofor...    139   3e-35   Pyrus x bretschneideri [bai li]
ref|XP_004171988.1|  PREDICTED: transcription factor UNE12-like         136   4e-35   
ref|XP_007205486.1|  hypothetical protein PRUPE_ppa008172mg             139   4e-35   Prunus persica
ref|XP_010457313.1|  PREDICTED: transcription factor bHLH7-like         138   4e-35   
gb|EYU17893.1|  hypothetical protein MIMGU_mgv1a010769mg                138   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_010474907.1|  PREDICTED: transcription factor bHLH7-like         138   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009119583.1|  PREDICTED: transcription factor bHLH7              137   9e-35   Brassica rapa
ref|XP_010481495.1|  PREDICTED: transcription factor bHLH7-like         137   1e-34   
emb|CDY18143.1|  BnaC05g01660D                                          136   2e-34   Brassica napus [oilseed rape]
ref|XP_010556765.1|  PREDICTED: transcription factor UNE12              136   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_007030571.1|  Basic helix-loop-helix DNA-binding superfami...    136   3e-34   Theobroma cacao [chocolate]
ref|XP_002284047.1|  PREDICTED: transcription factor UNE12              135   5e-34   Vitis vinifera
emb|CBI34158.3|  unnamed protein product                                134   5e-34   Vitis vinifera
ref|XP_004135655.1|  PREDICTED: transcription factor UNE12-like         135   5e-34   Cucumis sativus [cucumbers]
ref|XP_008450747.1|  PREDICTED: transcription factor UNE12-like i...    135   5e-34   Cucumis melo [Oriental melon]
ref|XP_011465955.1|  PREDICTED: transcription factor UNE12 isofor...    135   6e-34   Fragaria vesca subsp. vesca
ref|XP_004302053.1|  PREDICTED: transcription factor UNE12 isofor...    135   6e-34   Fragaria vesca subsp. vesca
emb|CAN66761.1|  hypothetical protein VITISV_032727                     135   7e-34   Vitis vinifera
ref|XP_006432927.1|  hypothetical protein CICLE_v10001768mg             135   1e-33   Citrus clementina [clementine]
ref|XP_008366877.1|  PREDICTED: transcription factor UNE12-like i...    135   1e-33   
ref|XP_009364496.1|  PREDICTED: transcription factor UNE12 isofor...    135   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_008450748.1|  PREDICTED: transcription factor UNE12-like i...    134   1e-33   Cucumis melo [Oriental melon]
ref|XP_010659880.1|  PREDICTED: transcription factor UNE12-like         134   2e-33   Vitis vinifera
gb|KJB44876.1|  hypothetical protein B456_007G277200                    134   2e-33   Gossypium raimondii
gb|KHG28438.1|  Transcription factor UNE12 -like protein                134   3e-33   Gossypium arboreum [tree cotton]
ref|XP_002319074.2|  hypothetical protein POPTR_0013s03830g             127   7e-33   
ref|XP_002306441.2|  hypothetical protein POPTR_0005s05500g             132   1e-32   
ref|XP_006418274.1|  hypothetical protein EUTSA_v10008279mg             131   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_011032406.1|  PREDICTED: transcription factor UNE12-like i...    132   2e-32   Populus euphratica
ref|XP_011032404.1|  PREDICTED: transcription factor UNE12-like i...    132   2e-32   Populus euphratica
ref|XP_006418273.1|  hypothetical protein EUTSA_v10008279mg             131   2e-32   
ref|NP_001059050.1|  Os07g0182200                                       126   2e-32   
ref|XP_002531293.1|  conserved hypothetical protein                     130   4e-32   
ref|XP_010025019.1|  PREDICTED: transcription factor UNE12-like i...    128   6e-32   
gb|ACG44301.1|  BHLH transcription factor                               125   7e-32   Zea mays [maize]
ref|XP_008370704.1|  PREDICTED: transcription factor UNE12-like i...    130   7e-32   
ref|XP_008370703.1|  PREDICTED: transcription factor UNE12-like i...    130   8e-32   
gb|KDP23663.1|  hypothetical protein JCGZ_23496                         129   2e-31   Jatropha curcas
ref|XP_007144828.1|  hypothetical protein PHAVU_007G187500g             129   2e-31   Phaseolus vulgaris [French bean]
ref|XP_010246321.1|  PREDICTED: transcription factor UNE12-like i...    130   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010246322.1|  PREDICTED: transcription factor UNE12-like i...    130   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010246320.1|  PREDICTED: transcription factor UNE12-like i...    130   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010246319.1|  PREDICTED: transcription factor UNE12-like i...    130   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010025017.1|  PREDICTED: transcription factor UNE12-like i...    127   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010025016.1|  PREDICTED: transcription factor UNE12-like i...    127   5e-31   Eucalyptus grandis [rose gum]
gb|KCW61602.1|  hypothetical protein EUGRSUZ_H04337                     128   5e-31   Eucalyptus grandis [rose gum]
gb|KHN04930.1|  Transcription factor UNE12                              127   6e-31   Glycine soja [wild soybean]
ref|XP_009398565.1|  PREDICTED: transcription factor UNE12-like i...    126   9e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496017.1|  PREDICTED: transcription factor UNE12-like         129   9e-31   
ref|XP_006650733.1|  PREDICTED: transcription factor UNE12-like         122   1e-30   
gb|KEH43018.1|  transcription factor UNE12-like protein                 127   1e-30   Medicago truncatula
ref|XP_009398564.1|  PREDICTED: transcription factor UNE12-like i...    126   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ02995.1|  hypothetical protein OsI_25136                          125   2e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_011038575.1|  PREDICTED: transcription factor UNE12-like         126   2e-30   Populus euphratica
ref|XP_009399361.1|  PREDICTED: transcription factor UNE12-like         124   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003556469.1|  PREDICTED: transcription factor UNE12-like i...    125   5e-30   Glycine max [soybeans]
ref|XP_006606461.1|  PREDICTED: transcription factor UNE12-like i...    125   6e-30   Glycine max [soybeans]
gb|EEE66685.1|  hypothetical protein OsJ_23336                          125   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228372.1|  PREDICTED: transcription factor UNE12-like i...    121   8e-30   
ref|NP_001152044.1|  LOC100285681                                       124   8e-30   Zea mays [maize]
ref|XP_002466294.1|  hypothetical protein SORBIDRAFT_01g005130          123   9e-30   Sorghum bicolor [broomcorn]
ref|XP_008788137.1|  PREDICTED: transcription factor UNE12-like i...    123   1e-29   
ref|XP_008788138.1|  PREDICTED: transcription factor UNE12-like i...    123   1e-29   Phoenix dactylifera
ref|XP_004955662.1|  PREDICTED: transcription factor UNE12-like         123   1e-29   Setaria italica
ref|XP_009418926.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006589182.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   Glycine max [soybeans]
ref|XP_006589181.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   
ref|XP_003536121.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   Glycine max [soybeans]
ref|XP_006589180.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   
ref|XP_009418925.1|  PREDICTED: transcription factor UNE12-like i...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010674832.1|  PREDICTED: transcription factor UNE12-like         123   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004981425.1|  PREDICTED: transcription factor UNE12-like         122   2e-29   Setaria italica
ref|XP_009418924.1|  PREDICTED: transcription factor UNE12-like i...    122   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461549.1|  hypothetical protein SORBIDRAFT_02g004570          121   4e-29   Sorghum bicolor [broomcorn]
gb|ACN21629.1|  putative basic helix-loop-helix protein BHLH2           122   4e-29   Lotus japonicus
ref|XP_010936103.1|  PREDICTED: transcription factor UNE12 isofor...    121   5e-29   Elaeis guineensis
ref|XP_011076653.1|  PREDICTED: transcription factor UNE12-like         122   5e-29   Sesamum indicum [beniseed]
gb|KHN22077.1|  Transcription factor UNE12                              122   7e-29   Glycine soja [wild soybean]
gb|EEE60096.1|  hypothetical protein OsJ_12958                          121   7e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010274209.1|  PREDICTED: transcription factor UNE12 isofor...    121   7e-29   Nelumbo nucifera [Indian lotus]
ref|NP_001051563.1|  Os03g0797600                                       121   9e-29   
ref|XP_010936096.1|  PREDICTED: transcription factor UNE12 isofor...    121   9e-29   Elaeis guineensis
gb|ADX60279.1|  bHLH transcription factor                               120   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ABB16991.1|  unknown                                                 121   1e-28   Solanum tuberosum [potatoes]
gb|EMS63234.1|  Transcription factor UNE12                              118   1e-28   Triticum urartu
ref|XP_010228376.1|  PREDICTED: transcription factor UNE12-like i...    120   1e-28   
ref|XP_008786085.1|  PREDICTED: transcription factor UNE12-like i...    120   1e-28   Phoenix dactylifera
ref|XP_008786084.1|  PREDICTED: transcription factor UNE12-like i...    120   2e-28   
ref|XP_004247636.1|  PREDICTED: transcription factor UNE12-like         120   2e-28   Solanum lycopersicum
ref|XP_010923486.1|  PREDICTED: transcription factor UNE12-like i...    120   2e-28   Elaeis guineensis
ref|XP_010923485.1|  PREDICTED: transcription factor UNE12-like i...    120   2e-28   Elaeis guineensis
gb|EMT27472.1|  Transcription factor UNE12                              117   3e-28   
ref|XP_003561348.1|  PREDICTED: transcription factor UNE12-like i...    119   4e-28   Brachypodium distachyon [annual false brome]
ref|XP_010553329.1|  PREDICTED: transcription factor bHLH7-like         119   6e-28   Tarenaya hassleriana [spider flower]
gb|EPS57409.1|  hypothetical protein M569_17409                         118   7e-28   Genlisea aurea
ref|NP_001274947.1|  uncharacterized LOC102577469                       118   1e-27   Solanum tuberosum [potatoes]
ref|XP_010228286.1|  PREDICTED: transcription factor UNE12-like i...    115   6e-27   Brachypodium distachyon [annual false brome]
ref|XP_006356051.1|  PREDICTED: transcription factor UNE12-like         111   9e-27   
ref|XP_009762993.1|  PREDICTED: transcription factor UNE12-like         115   2e-26   Nicotiana sylvestris
emb|CDP20692.1|  unnamed protein product                                113   9e-26   Coffea canephora [robusta coffee]
gb|ACF82186.1|  unknown                                                 109   3e-25   Zea mays [maize]
ref|XP_006838881.1|  hypothetical protein AMTR_s00002p00267570          111   3e-25   
ref|XP_009612697.1|  PREDICTED: transcription factor UNE12-like         111   6e-25   Nicotiana tomentosiformis
ref|XP_010553760.1|  PREDICTED: transcription factor bHLH7-like i...    110   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_010553759.1|  PREDICTED: transcription factor bHLH7-like i...    110   1e-24   Tarenaya hassleriana [spider flower]
ref|NP_001140213.1|  putative HLH DNA-binding domain superfamily ...    108   2e-24   Zea mays [maize]
gb|AFW90608.1|  beta-fructofuranosidase protein                         105   3e-23   Solanum tuberosum [potatoes]
ref|XP_004234028.1|  PREDICTED: transcription factor UNE12-like         104   1e-22   Solanum lycopersicum
ref|XP_009800017.1|  PREDICTED: transcription factor UNE12-like       95.5    6e-20   Nicotiana sylvestris
ref|XP_009793513.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  92.4    4e-18   Nicotiana sylvestris
ref|XP_010917608.1|  PREDICTED: transcription factor UNE12-like       84.3    1e-16   Elaeis guineensis
ref|XP_010265624.1|  PREDICTED: transcription factor bHLH66-like      85.9    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011084002.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  80.9    3e-14   
ref|XP_004507723.1|  PREDICTED: transcription factor bHLH66-like      79.3    1e-13   Cicer arietinum [garbanzo]
ref|XP_010275766.1|  PREDICTED: transcription factor bHLH66           79.0    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009358465.1|  PREDICTED: transcription factor bHLH66-like      79.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008367760.1|  PREDICTED: transcription factor bHLH66-like      78.6    3e-13   
ref|XP_009366166.1|  PREDICTED: transcription factor bHLH66-like      77.4    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_004287121.1|  PREDICTED: transcription factor bHLH66-like      77.4    7e-13   Fragaria vesca subsp. vesca
gb|KHG24512.1|  Transcription factor bHLH66 -like protein             77.4    8e-13   Gossypium arboreum [tree cotton]
ref|XP_007011960.1|  LJRHL1-like 1                                    77.0    9e-13   
gb|KJB54936.1|  hypothetical protein B456_009G055200                  77.0    1e-12   Gossypium raimondii
ref|XP_008242964.1|  PREDICTED: transcription factor bHLH66-like      77.0    1e-12   Prunus mume [ume]
ref|XP_006343666.1|  PREDICTED: transcription factor bHLH66-like      76.6    1e-12   Solanum tuberosum [potatoes]
ref|XP_009394940.1|  PREDICTED: transcription factor bHLH82-like ...  76.3    1e-12   
ref|XP_003610348.1|  Transcription factor bHLH66                      75.9    2e-12   
ref|XP_007154897.1|  hypothetical protein PHAVU_003G157100g           75.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_003610347.1|  Transcription factor bHLH66                      75.9    2e-12   
ref|XP_007154896.1|  hypothetical protein PHAVU_003G157100g           75.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_006857186.1|  hypothetical protein AMTR_s00065p00184910        75.9    2e-12   
ref|XP_009795099.1|  PREDICTED: transcription factor bHLH66-like      75.5    2e-12   Nicotiana sylvestris
ref|NP_001141950.1|  putative HLH DNA-binding domain superfamily ...  75.5    3e-12   Zea mays [maize]
ref|XP_008667581.1|  PREDICTED: putative HLH DNA-binding domain s...  75.5    3e-12   Zea mays [maize]
ref|XP_007204332.1|  hypothetical protein PRUPE_ppa005254mg           75.5    3e-12   
ref|XP_010929149.1|  PREDICTED: uncharacterized protein LOC105050...  75.5    4e-12   Elaeis guineensis
ref|XP_004251756.1|  PREDICTED: transcription factor bHLH66-like      74.7    4e-12   Solanum lycopersicum
ref|XP_009394942.1|  PREDICTED: transcription factor bHLH82-like ...  74.7    5e-12   
gb|KJB65757.1|  hypothetical protein B456_010G112200                  74.7    5e-12   Gossypium raimondii
ref|XP_008343903.1|  PREDICTED: transcription factor bHLH66-like      75.1    5e-12   
gb|KJB65759.1|  hypothetical protein B456_010G112200                  74.7    5e-12   Gossypium raimondii
emb|CAN75431.1|  hypothetical protein VITISV_021146                   74.7    5e-12   Vitis vinifera
ref|XP_002308393.2|  hypothetical protein POPTR_0006s20070g           74.7    5e-12   
gb|KHG27662.1|  Transcription factor bHLH66 -like protein             74.7    6e-12   Gossypium arboreum [tree cotton]
ref|XP_010656597.1|  PREDICTED: transcription factor UNE12-like i...  74.3    6e-12   Vitis vinifera
ref|XP_010656596.1|  PREDICTED: uncharacterized protein LOC100243...  74.3    6e-12   Vitis vinifera
gb|KJB65758.1|  hypothetical protein B456_010G112200                  74.3    6e-12   Gossypium raimondii
ref|XP_002325140.2|  hypothetical protein POPTR_0018s11800g           74.3    7e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010942107.1|  PREDICTED: transcription factor bHLH66-like      74.7    7e-12   Elaeis guineensis
ref|XP_006473971.1|  PREDICTED: transcription factor bHLH66-like      74.3    7e-12   Citrus sinensis [apfelsine]
ref|XP_008799645.1|  PREDICTED: transcription factor bHLH66           74.3    7e-12   Phoenix dactylifera
gb|KDP38664.1|  hypothetical protein JCGZ_04017                       74.3    8e-12   Jatropha curcas
emb|CDY46132.1|  BnaA04g14200D                                        71.2    8e-12   Brassica napus [oilseed rape]
ref|XP_011033445.1|  PREDICTED: transcription factor bHLH66-like      73.9    9e-12   Populus euphratica
ref|XP_010438099.1|  PREDICTED: transcription factor bHLH69 isofo...  72.8    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010432917.1|  PREDICTED: transcription factor bHLH69-like      72.8    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_006453668.1|  hypothetical protein CICLE_v10008192mg           73.6    2e-11   Citrus clementina [clementine]
gb|KDO59404.1|  hypothetical protein CISIN_1g012156mg                 73.6    2e-11   Citrus sinensis [apfelsine]
gb|KDO59403.1|  hypothetical protein CISIN_1g012156mg                 73.2    2e-11   Citrus sinensis [apfelsine]
gb|KDO59405.1|  hypothetical protein CISIN_1g012156mg                 73.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_010929150.1|  PREDICTED: uncharacterized protein LOC105050...  73.6    2e-11   Elaeis guineensis
ref|XP_007138416.1|  hypothetical protein PHAVU_009G207000g           72.8    2e-11   Phaseolus vulgaris [French bean]
ref|XP_003570296.1|  PREDICTED: transcription factor bHLH82-like      72.4    2e-11   Brachypodium distachyon [annual false brome]
ref|XP_003533887.2|  PREDICTED: transcription factor bHLH66-like      72.8    2e-11   Glycine max [soybeans]
gb|ACP28172.1|  roothairless1/slippery                                72.4    2e-11   Lotus japonicus
gb|KHN18326.1|  Transcription factor bHLH66                           71.6    3e-11   Glycine soja [wild soybean]
ref|XP_011078667.1|  PREDICTED: transcription factor bHLH66-like      72.4    3e-11   Sesamum indicum [beniseed]
ref|XP_006600554.1|  PREDICTED: transcription factor bHLH66-like ...  72.0    3e-11   Glycine max [soybeans]
ref|XP_006600553.1|  PREDICTED: transcription factor bHLH66-like ...  72.0    3e-11   Glycine max [soybeans]
ref|XP_010093338.1|  hypothetical protein L484_002940                 72.4    3e-11   
ref|XP_006600552.1|  PREDICTED: transcription factor bHLH66-like ...  72.0    3e-11   Glycine max [soybeans]
ref|XP_011018013.1|  PREDICTED: transcription factor bHLH66-like      72.0    3e-11   Populus euphratica
ref|XP_006600551.1|  PREDICTED: transcription factor bHLH66-like ...  72.0    3e-11   Glycine max [soybeans]
ref|XP_006350094.1|  PREDICTED: transcription factor bHLH66-like      72.0    3e-11   Solanum tuberosum [potatoes]
ref|XP_008794343.1|  PREDICTED: uncharacterized protein LOC103710419  72.0    4e-11   Phoenix dactylifera
ref|XP_009619149.1|  PREDICTED: transcription factor bHLH66-like      71.6    4e-11   Nicotiana tomentosiformis
ref|XP_010682674.1|  PREDICTED: transcription factor bHLH66-like      71.6    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002523493.1|  conserved hypothetical protein                   71.2    6e-11   Ricinus communis
ref|XP_008775394.1|  PREDICTED: transcription factor UNE12-like i...  68.6    6e-11   Phoenix dactylifera
ref|XP_010447636.1|  PREDICTED: transcription factor bHLH69-like      70.9    6e-11   Camelina sativa [gold-of-pleasure]
emb|CDY20290.1|  BnaC04g36660D                                        68.9    6e-11   Brassica napus [oilseed rape]
ref|XP_002867318.1|  basic helix-loop-helix family protein            70.5    7e-11   
ref|XP_004146688.1|  PREDICTED: uncharacterized protein LOC101211609  71.2    7e-11   Cucumis sativus [cucumbers]
ref|XP_008443870.1|  PREDICTED: transcription factor bHLH82           71.2    8e-11   Cucumis melo [Oriental melon]
ref|XP_009140529.1|  PREDICTED: transcription factor bHLH66           70.9    8e-11   Brassica rapa
ref|XP_010525813.1|  PREDICTED: transcription factor bHLH66           69.7    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_010238169.1|  PREDICTED: transcription factor bHLH66-like ...  70.9    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_010238168.1|  PREDICTED: transcription factor bHLH66-like ...  70.9    1e-10   
ref|XP_006412645.1|  hypothetical protein EUTSA_v10025656mg           70.1    1e-10   
emb|CDP10214.1|  unnamed protein product                              69.7    1e-10   
ref|NP_194827.2|  transcription factor bHLH69                         69.7    2e-10   
emb|CAA18195.1|  putative protein                                     69.3    2e-10   
ref|XP_009790289.1|  PREDICTED: transcription factor bHLH66-like      69.7    2e-10   
ref|XP_002965459.1|  hypothetical protein SELMODRAFT_24892            66.2    3e-10   
ref|XP_009596056.1|  PREDICTED: transcription factor bHLH66-like      69.7    3e-10   
ref|XP_001774188.1|  predicted protein                                67.8    3e-10   
ref|XP_002986418.1|  hypothetical protein SELMODRAFT_425336           68.9    3e-10   
ref|XP_006282219.1|  hypothetical protein CARUB_v10028492mg           68.6    3e-10   
ref|XP_010506835.1|  PREDICTED: transcription factor bHLH82-like      68.6    4e-10   
gb|EYU31775.1|  hypothetical protein MIMGU_mgv1a007474mg              68.6    4e-10   
emb|CDX68710.1|  BnaC01g07430D                                        68.6    4e-10   
emb|CBI36515.3|  unnamed protein product                              68.2    4e-10   
ref|XP_006404930.1|  hypothetical protein EUTSA_v10000220mg           68.2    5e-10   
ref|XP_009127366.1|  PREDICTED: transcription factor bHLH69           68.2    5e-10   
emb|CDY28232.1|  BnaA01g06170D                                        68.2    5e-10   
ref|XP_010048828.1|  PREDICTED: transcription factor bHLH66-like      68.6    6e-10   
ref|NP_001175840.1|  Os09g0417400                                     68.6    7e-10   
gb|AAM10956.1|AF488601_1  putative bHLH transcription factor          67.4    7e-10   
ref|XP_006294501.1|  hypothetical protein CARUB_v10023532mg           67.4    8e-10   
ref|XP_002866244.1|  basic helix-loop-helix family protein            67.0    1e-09   
ref|XP_002880568.1|  basic helix-loop-helix family protein            67.0    1e-09   
ref|XP_003546668.1|  PREDICTED: transcription factor bHLH82-like      67.8    1e-09   
gb|EPS68388.1|  hypothetical protein M569_06382                       67.4    1e-09   
ref|XP_010539140.1|  PREDICTED: transcription factor bHLH82           66.2    1e-09   
ref|XP_010429396.1|  PREDICTED: transcription factor bHLH66-like      66.6    1e-09   
ref|XP_008775393.1|  PREDICTED: transcription factor UNE12-like i...  64.7    2e-09   
ref|NP_180003.1|  bHLH protein LJRHL1-like 1                          66.6    2e-09   
gb|AAM10955.1|AF488599_1  putative bHLH transcription factor          66.2    2e-09   
gb|KFK32666.1|  hypothetical protein AALP_AA6G272900                  65.9    2e-09   
ref|XP_009126798.1|  PREDICTED: transcription factor bHLH82-like      66.2    2e-09   
ref|XP_004956830.1|  PREDICTED: glycine, alanine and asparagine-r...  65.9    2e-09   
ref|XP_006828665.1|  hypothetical protein AMTR_s00129p00124210        65.5    2e-09   
ref|XP_006401139.1|  hypothetical protein EUTSA_v10014212mg           66.2    2e-09   
ref|XP_010419295.1|  PREDICTED: transcription factor bHLH66-like      65.9    2e-09   
ref|XP_010453077.1|  PREDICTED: transcription factor bHLH82-like      65.9    3e-09   
ref|XP_010548502.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  65.5    3e-09   
ref|XP_010261699.1|  PREDICTED: transcription factor bHLH68-like ...  65.1    3e-09   
ref|XP_010483364.1|  PREDICTED: transcription factor bHLH82           65.9    3e-09   
ref|XP_010261705.1|  PREDICTED: transcription factor bHLH110-like...  65.1    3e-09   
ref|XP_002462383.1|  hypothetical protein SORBIDRAFT_02g024750        66.6    3e-09   
ref|XP_010261704.1|  PREDICTED: transcription factor bHLH68-like ...  64.7    3e-09   
ref|XP_001776681.1|  predicted protein                                64.7    4e-09   
gb|KJB07351.1|  hypothetical protein B456_001G017900                  64.3    4e-09   
ref|XP_004242577.1|  PREDICTED: transcription factor bHLH82-like      64.7    4e-09   
emb|CDY11836.1|  BnaC03g12620D                                        65.1    5e-09   
ref|XP_009390561.1|  PREDICTED: transcription factor bHLH66-like ...  65.9    5e-09   
ref|XP_009390560.1|  PREDICTED: transcription factor bHLH66-like ...  65.9    5e-09   
emb|CDY34780.1|  BnaA09g41470D                                        64.7    5e-09   
ref|XP_009117141.1|  PREDICTED: transcription factor bHLH66-like      64.3    6e-09   
dbj|BAD44153.1|  putative bHLH transcription factor (bHLH066)         64.3    6e-09   
ref|NP_200609.1|  bHLH protein LJRHL1-like 3                          64.7    7e-09   
gb|KFK27334.1|  hypothetical protein AALP_AA8G369700                  64.3    7e-09   
emb|CDY32733.1|  BnaA02g07950D                                        64.7    7e-09   
gb|KHF97539.1|  Transcription factor bHLH82 -like protein             63.5    8e-09   
emb|CDY02785.1|  BnaC02g11040D                                        64.3    8e-09   
ref|XP_010443514.1|  PREDICTED: transcription factor bHLH82-like      64.3    8e-09   
ref|XP_009132090.1|  PREDICTED: transcription factor bHLH82-like      64.7    8e-09   
ref|XP_010472429.1|  PREDICTED: transcription factor bHLH66           63.9    9e-09   
gb|EEC84577.1|  hypothetical protein OsI_31377                        65.1    9e-09   
gb|EYU25352.1|  hypothetical protein MIMGU_mgv1a008095mg              64.7    1e-08   
gb|KFK29682.1|  hypothetical protein AALP_AA7G165100                  63.5    1e-08   
emb|CDX88653.1|  BnaA03g09960D                                        63.9    1e-08   
ref|XP_009380793.1|  PREDICTED: transcription factor bHLH82-like      63.5    1e-08   
emb|CDX76819.1|  BnaC08g34050D                                        63.2    2e-08   
ref|XP_008466922.1|  PREDICTED: transcription factor bHLH66-like      60.1    2e-08   
gb|ACG32161.1|  hypothetical protein                                  61.6    2e-08   
gb|EAY87854.1|  hypothetical protein OsI_09276                        62.8    2e-08   
gb|EEE57973.1|  hypothetical protein OsJ_08713                        62.8    2e-08   
dbj|BAD19075.1|  basic helix-loop-helix (bHLH) -like                  62.4    3e-08   
emb|CDY55014.1|  BnaA10g29390D                                        62.8    3e-08   
ref|XP_006284115.1|  hypothetical protein CARUB_v10005248mg           61.6    4e-08   
ref|XP_009120317.1|  PREDICTED: transcription factor bHLH82-like      62.4    5e-08   
ref|XP_010917385.1|  PREDICTED: transcription factor bHLH78-like      60.8    5e-08   
emb|CDY62262.1|  BnaCnng39760D                                        62.0    7e-08   
gb|EYU31779.1|  hypothetical protein MIMGU_mgv1a009878mg              62.0    7e-08   
ref|XP_009401065.1|  PREDICTED: transcription factor UNE12-like       60.5    9e-08   
ref|XP_002982702.1|  hypothetical protein SELMODRAFT_422025           60.5    1e-07   
ref|XP_003560994.1|  PREDICTED: transcription factor bHLH82           61.6    1e-07   
ref|XP_004139396.1|  PREDICTED: transcription factor bHLH66-like      61.6    1e-07   
ref|XP_008652712.1|  PREDICTED: transcription factor bHLH69-like ...  60.5    1e-07   
ref|XP_008652713.1|  PREDICTED: transcription factor bHLH66-like ...  60.5    1e-07   
ref|XP_009417990.1|  PREDICTED: transcription factor bHLH133-like     58.9    1e-07   
ref|XP_002981234.1|  hypothetical protein SELMODRAFT_444782           60.1    1e-07   
ref|NP_001151181.1|  LOC100284814                                     61.2    2e-07   
ref|XP_006656710.1|  PREDICTED: transcription factor bHLH66-like      60.8    2e-07   
ref|XP_010656080.1|  PREDICTED: uncharacterized protein LOC100257...  59.3    2e-07   
tpg|DAA61472.1|  TPA: putative HLH DNA-binding domain superfamily...  60.5    2e-07   
ref|XP_008797366.1|  PREDICTED: transcription factor bHLH10-like      58.2    2e-07   
tpg|DAA61473.1|  TPA: putative HLH DNA-binding domain superfamily...  60.5    3e-07   
dbj|BAK05422.1|  predicted protein                                    58.9    3e-07   
emb|CBI27747.3|  unnamed protein product                              58.9    3e-07   
ref|XP_004952733.1|  PREDICTED: uncharacterized protein LOC101783...  58.5    4e-07   
ref|XP_002277344.2|  PREDICTED: uncharacterized protein LOC100257...  58.5    4e-07   
ref|XP_008784365.1|  PREDICTED: uncharacterized protein LOC103703328  57.4    4e-07   
ref|XP_007012525.1|  Transcription factor bHLH69, putative isoform 1  60.1    4e-07   
ref|XP_010932342.1|  PREDICTED: uncharacterized protein LOC105053039  57.4    4e-07   
ref|XP_009391705.1|  PREDICTED: transcription factor bHLH62-like      57.0    6e-07   
ref|XP_006452905.1|  hypothetical protein CICLE_v10008008mg           57.4    8e-07   
ref|XP_006474565.1|  PREDICTED: uncharacterized protein LOC102611...  57.4    8e-07   
ref|XP_008242151.1|  PREDICTED: transcription factor bHLH112-like     59.3    9e-07   
ref|XP_010547827.1|  PREDICTED: uncharacterized protein LOC104819452  57.0    1e-06   
ref|NP_001047162.2|  Os02g0564700                                     56.2    1e-06   
gb|KCW78923.1|  hypothetical protein EUGRSUZ_C00360                   58.2    2e-06   
ref|XP_008645842.1|  PREDICTED: uncharacterized protein LOC103627...  56.2    2e-06   
ref|XP_004952732.1|  PREDICTED: uncharacterized protein LOC101783...  58.2    2e-06   
ref|XP_006648756.1|  PREDICTED: uncharacterized protein LOC102704398  55.8    2e-06   
gb|EMS58799.1|  Transcription factor bHLH82                           57.0    2e-06   
ref|XP_008645841.1|  PREDICTED: uncharacterized protein LOC103627...  55.8    2e-06   
ref|XP_010047123.1|  PREDICTED: transcription factor bHLH69-like      57.8    2e-06   
gb|KDP33969.1|  hypothetical protein JCGZ_07540                       54.7    3e-06   
ref|XP_007203011.1|  hypothetical protein PRUPE_ppa017709mg           57.0    5e-06   
gb|EMT03170.1|  Transcription factor bHLH82                           56.2    7e-06   
ref|XP_002452977.1|  hypothetical protein SORBIDRAFT_04g035890        53.9    8e-06   
dbj|BAD15821.1|  putative bHLH transcription factor PTF1              56.2    9e-06   
ref|XP_008679227.1|  PREDICTED: transcription factor bHLH66-like      53.9    9e-06   
gb|EAY86326.1|  hypothetical protein OsI_07700                        56.2    9e-06   
gb|EMT30437.1|  Transcription factor bHLH82                           52.8    1e-05   
ref|NP_001131264.1|  uncharacterized protein LOC100192577             55.5    1e-05   
ref|XP_006381552.1|  hypothetical protein POPTR_0006s13790g           52.4    1e-05   
ref|XP_011039907.1|  PREDICTED: transcription factor bHLH66-like      52.4    1e-05   
gb|EMS47179.1|  Transcription factor bHLH82                           52.4    2e-05   
ref|XP_006655874.1|  PREDICTED: transcription factor SPATULA-like...  52.4    2e-05   
ref|XP_008647330.1|  PREDICTED: uncharacterized protein LOC100192...  55.1    2e-05   
ref|XP_008647333.1|  PREDICTED: uncharacterized protein LOC100192...  55.1    2e-05   
dbj|BAJ94866.1|  predicted protein                                    52.0    2e-05   
ref|XP_008659194.1|  PREDICTED: transcription factor bHLH82-like      52.4    3e-05   
gb|KJB54556.1|  hypothetical protein B456_009G038500                  51.2    5e-05   
ref|XP_009381570.1|  PREDICTED: transcription factor bHLH82-like ...  53.9    5e-05   
ref|XP_009381569.1|  PREDICTED: transcription factor bHLH82-like ...  53.9    5e-05   
gb|ABI95371.1|  PTF1                                                  52.8    6e-05   
ref|XP_002438003.1|  hypothetical protein SORBIDRAFT_10g006250        53.5    7e-05   
gb|AHI17691.1|  bHLH4 transcription factor                            50.4    8e-05   
ref|XP_006649131.1|  PREDICTED: transcription factor bHLH66-like      53.1    8e-05   
ref|XP_006655876.1|  PREDICTED: transcription factor SPATULA-like...  52.4    2e-04   
gb|EAY99993.1|  hypothetical protein OsI_21996                        52.4    2e-04   
ref|XP_010235563.1|  PREDICTED: uncharacterized protein LOC100834217  51.6    3e-04   
ref|XP_010107083.1|  hypothetical protein L484_019561                 51.6    3e-04   
gb|AAO73566.1|  bHLH transcription factor PTF1                        51.6    3e-04   
ref|XP_010227911.1|  PREDICTED: uncharacterized protein LOC100841109  51.6    3e-04   
gb|ACF60480.1|  bHLH transcription factor                             51.2    4e-04   
ref|NP_001057043.1|  Os06g0193400                                     51.2    4e-04   
dbj|BAD35276.1|  putative bHLH transcription factor PTF1              51.2    4e-04   
gb|ACF87364.1|  unknown                                               48.5    5e-04   
gb|ACG29975.1|  helix-loop-helix DNA-binding domain containing pr...  50.8    5e-04   
ref|XP_008659041.1|  PREDICTED: bHLH transcription factor PTF1 is...  50.8    5e-04   
ref|NP_001105867.1|  bHLH transcription factor PTF1                   50.8    5e-04   
ref|XP_004964606.1|  PREDICTED: putative transcription factor bHL...  50.8    6e-04   
ref|XP_002516201.1|  DNA-directed RNA polymerase beta chain, puta...  50.1    0.001   



>ref|XP_010087126.1| hypothetical protein L484_012559 [Morus notabilis]
 gb|EXB26566.1| hypothetical protein L484_012559 [Morus notabilis]
Length=305

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  209  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  267

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYHSQ PDT+ +VKPETNPPS
Sbjct  268  FLQSKALCIMPISLASAIYHSQPPDTSSVVKPETNPPS  305



>ref|XP_002281626.1| PREDICTED: transcription factor UNE12 [Vitis vinifera]
 emb|CBI17928.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP++ VEEE  SE GR +PAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  193  RLGGAGAVAPLVTDIPLASVEEEA-SEGGRNEPAWEKWSNDGTERQVAKLMEENVGAAMQ  251

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYHSQ PDTTPL+KP+TNPPS
Sbjct  252  FLQSKALCIMPISLASAIYHSQQPDTTPLIKPQTNPPS  289



>ref|XP_002520976.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF41393.1| DNA binding protein, putative [Ricinus communis]
Length=299

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  203  RLGGAGAVAPLVTDIPLSSVEDETG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  261

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+QAPDT+ +VKPETNPPS
Sbjct  262  FLQSKALCIMPISLATAIYHTQAPDTSTIVKPETNPPS  299



>gb|KHN02539.1| Transcription factor UNE12 [Glycine soja]
Length=210

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  114  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQ  172

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PDT+ +VKPETNPPS
Sbjct  173  FLQSKALCIMPISLASAIYQSQPPDTSSIVKPETNPPS  210



>ref|XP_006383684.1| hypothetical protein POPTR_0005s23930g [Populus trichocarpa]
 gb|ERP61481.1| hypothetical protein POPTR_0005s23930g [Populus trichocarpa]
Length=300

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSSVEDETG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+Q PDTT +VKPETNPPS
Sbjct  263  FLQSKALCIMPISLATAIYHTQPPDTTTIVKPETNPPS  300



>ref|XP_011042433.1| PREDICTED: transcription factor UNE12 [Populus euphratica]
Length=300

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSSVEDETG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+Q PDTT +VKPETNPPS
Sbjct  263  FLQSKALCIMPISLATAIYHTQPPDTTTIVKPETNPPS  300



>gb|EYU46514.1| hypothetical protein MIMGU_mgv1a010915mg [Erythranthe guttata]
Length=297

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTD+PIS +EEEG +E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  201  RLGGAGAVAPLVTDVPISTIEEEG-NEGGRAQPAWEKWSNDGTERQVAKLMEENVGAAMQ  259

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYH+Q PDT  L+KPE+NPPS
Sbjct  260  FLQSKALCIMPISLASAIYHTQPPDTPTLMKPESNPPS  297



>ref|XP_007050429.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX94586.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=303

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  207  RLGGAGAVAPLVTDIPLSSVEDESG-EGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  265

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+Q PDT+P+VKPE NPP+
Sbjct  266  FLQSKALCIMPISLATAIYHTQPPDTSPIVKPEANPPA  303



>ref|XP_008451266.1| PREDICTED: transcription factor UNE12 [Cucumis melo]
Length=313

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  217  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  275

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYH+Q PD++ +VKPE+NPP+
Sbjct  276  FLQSKALCIMPISLASAIYHTQPPDSSSIVKPESNPPA  313



>gb|KDP21374.1| hypothetical protein JCGZ_21845 [Jatropha curcas]
Length=301

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  205  RLGGAGAVAPLVTDIPLSSVEDETG-EDGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  263

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+Q PDT+ +VKPETNPPS
Sbjct  264  FLQSKALCIMPISLATAIYHTQPPDTSTIVKPETNPPS  301



>ref|XP_003554277.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=292

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  196  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQ  254

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PDT+ +VKPETNPPS
Sbjct  255  FLQSKALCIMPISLASAIYQSQPPDTSSIVKPETNPPS  292



>ref|XP_004146956.1| PREDICTED: transcription factor UNE12-like [Cucumis sativus]
 ref|XP_004162188.1| PREDICTED: transcription factor UNE12-like [Cucumis sativus]
 gb|KGN44766.1| hypothetical protein Csa_7G378550 [Cucumis sativus]
Length=316

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  220  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  278

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIYH+Q PD++ +VKPE+NPP
Sbjct  279  FLQSKALCIMPISLASAIYHTQPPDSSSVVKPESNPP  315



>emb|CDP03688.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS VEEE G E GR QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  217  RLGGAGAVAPLVTDIPISSVEEESG-EGGRPQPAWDKWSNDGTERQVAKLMEENVGAAMQ  275

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIYH+Q PD + L+KPETNPP
Sbjct  276  FLQSKALCIMPISLASAIYHTQPPDASNLIKPETNPP  312



>ref|XP_009354865.1| PREDICTED: transcription factor UNE12 [Pyrus x bretschneideri]
 ref|XP_009354866.1| PREDICTED: transcription factor UNE12 [Pyrus x bretschneideri]
Length=301

 Score =   169 bits (427),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 90/98 (92%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQ
Sbjct  205  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQ  263

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY++Q PDT+ +VKPE NPPS
Sbjct  264  FLQSKALCIMPISLASAIYNTQPPDTSTVVKPEMNPPS  301



>ref|XP_011026052.1| PREDICTED: transcription factor UNE12-like [Populus euphratica]
Length=300

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR Q AWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSPVEDETG-EGGRNQLAWEKWSNDGTERQVAKLMEENVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+Q PDTT +VKPETNPPS
Sbjct  263  FLQSKALCIMPISLATAIYHTQPPDTTTIVKPETNPPS  300



>gb|KHF99712.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=305

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G ++GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  209  RLGGAGAVAPLVTDIPLSSVEDESG-DSGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  267

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLA+AIYHSQ PDT+ ++KPET+PP
Sbjct  268  FLQSKALCIMPISLATAIYHSQPPDTSSIIKPETDPP  304



>ref|XP_011082599.1| PREDICTED: transcription factor UNE12-like [Sesamum indicum]
Length=320

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS +EEEG S++GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  224  RLGGAGAVAPLVTDIPISSIEEEG-SDSGRAQPAWEKWSNDGTERQVAKLMEENVGAAMQ  282

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIYH+Q P+TT  VKPE++PP
Sbjct  283  FLQSKALCIMPISLASAIYHTQPPETTTTVKPESDPP  319



>gb|KJB42176.1| hypothetical protein B456_007G141800 [Gossypium raimondii]
Length=303

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 91/98 (93%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTD+P+S VE+E G E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQ
Sbjct  207  RLGAAGAVAPLVTDLPLSSVEDESG-EGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQ  265

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALC+MPISLA+AIYH+Q+PDT+ +VKPETNPPS
Sbjct  266  FLQSKALCVMPISLATAIYHTQSPDTSSVVKPETNPPS  303



>ref|XP_002302077.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE81350.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=300

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G E GR Q AWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSPVEDETG-EGGRNQLAWEKWSNDGTERQVAKLMEENVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPI+LA+AIYH+Q PDTT +VKPETNPPS
Sbjct  263  FLQSKALCIMPITLATAIYHTQPPDTTTIVKPETNPPS  300



>gb|KJB42177.1| hypothetical protein B456_007G141800 [Gossypium raimondii]
Length=304

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTD+P+S VE++   E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQ
Sbjct  207  RLGAAGAVAPLVTDLPLSSVEQDESGEGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALC+MPISLA+AIYH+Q+PDT+ +VKPETNPPS
Sbjct  267  FLQSKALCVMPISLATAIYHTQSPDTSSVVKPETNPPS  304



>ref|XP_008372300.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008372301.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008356199.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008356200.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
Length=300

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQ KALCIMPISLASAIY++Q PDT+ +VKPE NPPS
Sbjct  263  FLQXKALCIMPISLASAIYNTQPPDTSSVVKPEMNPPS  300



>ref|XP_008372294.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_008372295.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
Length=300

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG SE GR QPAW+KWSNDGTERQVAKLME+NVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDIPLSSVEEEG-SEGGRNQPAWDKWSNDGTERQVAKLMEDNVGAAMQ  262

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQ KALCIMPISLASAIY++Q PDT+ +VKPE NPPS
Sbjct  263  FLQYKALCIMPISLASAIYNTQPPDTSSVVKPEMNPPS  300



>gb|KHN10703.1| Transcription factor UNE12 [Glycine soja]
Length=210

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  114  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQ  172

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PDT+ +VK ET+PPS
Sbjct  173  FLQSKALCIMPISLASAIYQSQPPDTSSIVKHETSPPS  210



>ref|XP_007144689.1| hypothetical protein PHAVU_007G176900g [Phaseolus vulgaris]
 gb|ESW16683.1| hypothetical protein PHAVU_007G176900g [Phaseolus vulgaris]
Length=280

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 87/98 (89%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG    GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  185  RLGGAGAVAPLVTDIPLSSVEEEGSE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  242

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ  DT+ +VKPETNPPS
Sbjct  243  FLQSKALCIMPISLASAIYQSQPSDTSSIVKPETNPPS  280



>gb|ACN21630.1| putative basic helix-loop-helix protein BHLH3 [Lotus japonicus]
Length=297

 Score =   166 bits (421),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+KWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  201  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKWSNDGTEKQVAKLMEENVGAAMQ  259

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PD++ +VKPETNPPS
Sbjct  260  FLQSKALCIMPISLASAIYQSQPPDSSSMVKPETNPPS  297



>gb|KHG12939.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=302

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTD+P+S VE+E G E GR+QPAWEKWSNDGTERQVAKLMEE+VGAAMQ
Sbjct  207  RLGAAGAVAPLVTDLPLSSVEDESG-EGGRSQPAWEKWSNDGTERQVAKLMEEDVGAAMQ  265

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALC+MPISLA+AIYH+Q+PDT+ +VKPETNPP
Sbjct  266  FLQSKALCVMPISLATAIYHTQSPDTSSVVKPETNPP  302



>gb|KHN03837.1| Transcription factor UNE12 [Glycine soja]
Length=278

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 87/98 (89%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG   GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  183  RLGGAGAVAPLVTDIPLSSVEEEGGE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  240

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMP+SLASAIY SQ   T+ +VKPETNPPS
Sbjct  241  FLQSKALCIMPVSLASAIYQSQPSGTSSIVKPETNPPS  278



>ref|XP_003536810.1| PREDICTED: transcription factor UNE12 [Glycine max]
Length=283

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 87/98 (89%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG   GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  188  RLGGAGAVAPLVTDIPLSSVEEEGGE--GRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  245

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMP+SLASAIY SQ   T+ +VKPETNPPS
Sbjct  246  FLQSKALCIMPVSLASAIYQSQPSGTSSIVKPETNPPS  283



>ref|XP_007162488.1| hypothetical protein PHAVU_001G156400g [Phaseolus vulgaris]
 gb|ESW34482.1| hypothetical protein PHAVU_001G156400g [Phaseolus vulgaris]
Length=292

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+K SNDGTERQVAKLMEENVGAAMQ
Sbjct  196  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKCSNDGTERQVAKLMEENVGAAMQ  254

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PD++ +VKPETNPPS
Sbjct  255  FLQSKALCIMPISLASAIYQSQPPDSSSIVKPETNPPS  292



>ref|XP_003521266.1| PREDICTED: transcription factor UNE12-like [Glycine max]
Length=292

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG E  R +PAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  196  RLGGAGAVAPLVTDIPLSSVEEEGG-EGARNRPAWDKWSNDGTERQVAKLMEENVGAAMQ  254

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PDT+ +VK ET+PPS
Sbjct  255  FLQSKALCIMPISLASAIYQSQPPDTSSIVKHETSPPS  292



>gb|KJB25973.1| hypothetical protein B456_004G218900 [Gossypium raimondii]
Length=305

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE+E G + GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  209  RLGGAGAVAPLVTDIPLSSVEDESG-DGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  267

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLA+AIYHSQ  DT+ +VKPET+PP
Sbjct  268  FLQSKALCIMPISLATAIYHSQPLDTSSIVKPETDPP  304



>gb|KJB22947.1| hypothetical protein B456_004G075200 [Gossypium raimondii]
 gb|KJB22948.1| hypothetical protein B456_004G075200 [Gossypium raimondii]
Length=304

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE E G E GR+QPAWEKWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  208  RLGGAGAVAPLVTDIPLSSVEYESG-EGGRSQPAWEKWSNDGTEQQVAKLMEENVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSK+LCIMPISLA+AIYH+Q PDT+ +VKPET PP+
Sbjct  267  FLQSKSLCIMPISLATAIYHTQVPDTSSVVKPETIPPA  304



>ref|XP_011079946.1| PREDICTED: transcription factor UNE12 [Sesamum indicum]
Length=324

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS +EEE G + GR QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  228  RLGGAGAVAPLVTDIPISSIEEESG-DGGRAQPAWEKWSNDGTERQVAKLMEENVGAAMQ  286

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
             LQSKALCIMPISLASAIYH+Q  DT  L KPE++PPS
Sbjct  287  LLQSKALCIMPISLASAIYHTQPRDTVTLAKPESSPPS  324



>ref|XP_004495148.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cicer 
arietinum]
Length=285

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  190  RLGGAGAVAPLVTDIPLSSVEEEG-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQ  248

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIY SQ  D++ +VKPET PP
Sbjct  249  FLQSKALCIMPISLASAIYQSQPSDSSSIVKPETTPP  285



>gb|KHG09586.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=304

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VE E G E GR+ PAWEKWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  208  RLGGAGAVAPLVTDIPLSSVEYESG-EGGRSHPAWEKWSNDGTEQQVAKLMEENVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSK+LCIMPISLA+AIYH+Q PD++ +VKPETNPP+
Sbjct  267  FLQSKSLCIMPISLATAIYHTQVPDSSCVVKPETNPPA  304



>ref|XP_003590536.1| Transcription factor UNE12 [Medicago truncatula]
 gb|AES60787.1| basic helix loop helix protein BHLH4 [Medicago truncatula]
Length=282

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  186  RLGGAGAVAPLVTDIPLSSVEEEG-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQ  244

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIY SQ  D + +VKPET PP
Sbjct  245  FLQSKALCIMPISLASAIYQSQPSDNSSIVKPETIPP  281



>ref|XP_003590537.1| Transcription factor UNE12 [Medicago truncatula]
 gb|AES60788.1| basic helix loop helix protein BHLH4 [Medicago truncatula]
Length=285

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEG S++GR QPAWEKWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  189  RLGGAGAVAPLVTDIPLSSVEEEG-SDSGRNQPAWEKWSNDGTEKQVAKLMEENVGAAMQ  247

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIY SQ  D + +VKPET PP
Sbjct  248  FLQSKALCIMPISLASAIYQSQPSDNSSIVKPETIPP  284



>gb|KHN18841.1| Transcription factor UNE12 [Glycine soja]
Length=274

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 84/96 (88%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAPLVTDIP+S VEEEGG   GR QPAWEK SNDGTERQVAKLMEENVGAAMQFL
Sbjct  181  GGADAVAPLVTDIPLSSVEEEGGE--GRNQPAWEKCSNDGTERQVAKLMEENVGAAMQFL  238

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMP+SLASAIY SQ  DT+ +VKPE NPPS
Sbjct  239  QSKALCIMPVSLASAIYQSQPSDTSSIVKPEINPPS  274



>ref|XP_003520191.1| PREDICTED: transcription factor UNE12-like [Glycine max]
Length=274

 Score =   160 bits (405),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 84/96 (88%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAPLVTDIP+S VEEEGG   GR QPAWEK SNDGTERQVAKLMEENVGAAMQFL
Sbjct  181  GGADAVAPLVTDIPLSSVEEEGGE--GRNQPAWEKCSNDGTERQVAKLMEENVGAAMQFL  238

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMP+SLASAIY SQ  DT+ +VKPE NPPS
Sbjct  239  QSKALCIMPVSLASAIYQSQPSDTSSIVKPEINPPS  274



>ref|XP_008382959.1| PREDICTED: transcription factor UNE12-like [Malus domestica]
 ref|XP_009367753.1| PREDICTED: transcription factor UNE12-like [Pyrus x bretschneideri]
Length=298

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 89/98 (91%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  202  RLGGAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  260

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYH+Q+PDT+ +VKPE NPPS
Sbjct  261  FLQSKALCIMPISLASAIYHTQSPDTSSVVKPEMNPPS  298



>ref|XP_006349737.1| PREDICTED: transcription factor UNE12-like [Solanum tuberosum]
Length=302

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS VEEE        QPAWEKWS+DGTERQVAKLMEENVGAAMQ
Sbjct  205  RLGGAGAVAPLVTDIPISSVEEESSEGGNNNQPAWEKWSSDGTERQVAKLMEENVGAAMQ  264

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYHSQ PDT+ LVKPETNPPS
Sbjct  265  FLQSKALCIMPISLASAIYHSQPPDTSSLVKPETNPPS  302



>ref|XP_004247209.1| PREDICTED: transcription factor UNE12 [Solanum lycopersicum]
Length=302

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS VEEE        QPAWEKWS+DGTERQVAKLMEENVGAAMQ
Sbjct  205  RLGGAGAVAPLVTDIPISSVEEESSEGGNNNQPAWEKWSSDGTERQVAKLMEENVGAAMQ  264

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYHSQ PDT+ LVKPETNPPS
Sbjct  265  FLQSKALCIMPISLASAIYHSQPPDTSSLVKPETNPPS  302



>emb|CDY18011.1| BnaC03g30830D [Brassica napus]
Length=304

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+  SE GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  207  GGAGAVAPLVTDMPLSSSVEDETSEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  266

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  267  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  302



>ref|XP_009134422.1| PREDICTED: transcription factor UNE12-like [Brassica rapa]
Length=309

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  212  GGAGAVAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  271

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  272  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  307



>ref|XP_006396471.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 ref|XP_006396472.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 gb|ESQ37924.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
 gb|ESQ37925.1| hypothetical protein EUTSA_v10028824mg [Eutrema salsugineum]
Length=310

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  309



>ref|XP_007201836.1| hypothetical protein PRUPE_ppa009299mg [Prunus persica]
 gb|EMJ03035.1| hypothetical protein PRUPE_ppa009299mg [Prunus persica]
Length=298

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  202  RLGGAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  260

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYH+Q PDT+ +VKPE NPPS
Sbjct  261  FLQSKALCIMPISLASAIYHTQPPDTSSVVKPEMNPPS  298



>ref|XP_004289895.1| PREDICTED: transcription factor UNE12 [Fragaria vesca subsp. 
vesca]
Length=292

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  196  RLGGAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  254

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMP+SLASAIYH+Q PDT+ +VKPE NPPS
Sbjct  255  FLQSKALCIMPVSLASAIYHTQPPDTSSVVKPEMNPPS  292



>ref|XP_008235331.1| PREDICTED: transcription factor UNE12 [Prunus mume]
Length=298

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 88/98 (90%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S VEEEGG    R QPAW+KWSNDGTERQVAKLMEENVGAAMQ
Sbjct  202  RLGGAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWDKWSNDGTERQVAKLMEENVGAAMQ  260

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIYH+Q PDT+ +VKPE NPPS
Sbjct  261  FLQSKALCIMPISLASAIYHTQPPDTSSVVKPEMNPPS  298



>ref|NP_001118919.1| transcription factor UNE12 [Arabidopsis thaliana]
 gb|AEE82201.1| transcription factor UNE12 [Arabidopsis thaliana]
Length=247

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  151  GGAGAVAPLVTDMPLSSSVEDETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  210

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPE NPP
Sbjct  211  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPENNPP  246



>emb|CDY22062.1| BnaA09g00910D [Brassica napus]
Length=304

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  207  GGAGAVAPLVTDMPLSSTVEDESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  266

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  267  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  302



>ref|XP_010041192.1| PREDICTED: transcription factor UNE12-like [Eucalyptus grandis]
 gb|KCW44559.1| hypothetical protein EUGRSUZ_L01929 [Eucalyptus grandis]
Length=99

 Score =   150 bits (378),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTDIP+S VEEEGG    R QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  3    RLGAAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  61

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIY +Q PDT+ LVK E+NPPS
Sbjct  62   FLQSKALCIMPISLATAIYQTQPPDTSSLVKSESNPPS  99



>ref|XP_002872829.1| hypothetical protein ARALYDRAFT_490301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49088.1| hypothetical protein ARALYDRAFT_490301 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   + GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVEDETGDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  309



>ref|XP_010422571.1| PREDICTED: transcription factor UNE12-like [Camelina sativa]
Length=262

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  166  GGAGAVAPLVTDMPLSSSVEDETGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  225

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  226  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  261



>ref|XP_009111272.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor UNE12 [Brassica 
rapa]
Length=304

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  207  GGAGAVAPLVTDMPLSSSVEDESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  266

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  267  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  302



>gb|KHG20614.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=100

 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVAP V DIP+S +E+E G E+GR+QPAWEKWSNDGT+R VAKLMEENVGAAMQ
Sbjct  3    RLGGAAAVAPFVIDIPLSSIEDERG-ESGRSQPAWEKWSNDGTDRHVAKLMEENVGAAMQ  61

Query  544  FLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPPS  431
            FLQSKALCIMPISLA AIY +Q PDT + +VKPET+P S
Sbjct  62   FLQSKALCIMPISLAKAIYDTQPPDTSSSIVKPETDPTS  100



>gb|KHG26252.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=131

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = -2

Query  742  QGVEHEQXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEEN  563
            Q +   + GGA AVAP V DIP+S +E+E G E+GR+QPAWEKWSNDGT+R VAKLMEEN
Sbjct  28   QVLTMSRLGGAAAVAPFVIDIPLSSIEDERG-ESGRSQPAWEKWSNDGTDRHVAKLMEEN  86

Query  562  VGAAMQFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPPS  431
            VGAAMQFLQSKALCIMPISLA AIY +Q PDT + +VKPET+P S
Sbjct  87   VGAAMQFLQSKALCIMPISLAKAIYDTQPPDTSSSIVKPETDPTS  131



>emb|CDY21898.1| BnaC09g00040D [Brassica napus]
Length=301

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  204  GGAGAVAPLVTDMPLSSSVEDESGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  263

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDTT +VKPE+NPP
Sbjct  264  LQSKALCMMPISLAMAIYHSQPPDTTSVVKPESNPP  299



>emb|CDX90930.1| BnaA03g26100D [Brassica napus]
Length=310

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+  SE GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  213  GGAGAVAPLVTDMPLSSSVEDETSEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  272

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VK ETNPP
Sbjct  273  LQSKALCMMPISLAMAIYHSQPPDTSSVVKAETNPP  308



>ref|NP_567245.1| transcription factor UNE12 [Arabidopsis thaliana]
 ref|NP_001031577.1| transcription factor UNE12 [Arabidopsis thaliana]
 sp|O22768.2|UNE12_ARATH RecName: Full=Transcription factor UNE12; AltName: Full=Basic 
helix-loop-helix protein 59; Short=AtbHLH59; Short=bHLH 59; 
AltName: Full=Protein UNFERTILIZED EMBRYO SAC 12; AltName: 
Full=Transcription factor EN 93; AltName: Full=bHLH transcription 
factor bHLH059 [Arabidopsis thaliana]
 gb|AAK32915.1|AF367328_1 AT4g02590/T10P11_13 [Arabidopsis thaliana]
 gb|AAC78259.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB80752.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAN28890.1| At4g02590/T10P11_13 [Arabidopsis thaliana]
 dbj|BAH19471.1| AT4G02590 [Arabidopsis thaliana]
 gb|AEE82199.1| transcription factor UNE12 [Arabidopsis thaliana]
 gb|AEE82200.1| transcription factor UNE12 [Arabidopsis thaliana]
Length=310

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVEDETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPE NPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPENNPP  309



>gb|KJB11136.1| hypothetical protein B456_001G242500 [Gossypium raimondii]
Length=299

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVAP V DIP+S +E+E G E+GR+QPAWEKWSNDGTER VAKLMEENVGAAMQ
Sbjct  202  RLGGAAAVAPFVIDIPLSSIEDERG-ESGRSQPAWEKWSNDGTERHVAKLMEENVGAAMQ  260

Query  544  FLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPPS  431
            FLQSKALCIMP+SLA AIYH+Q PDT + +VKPET+P S
Sbjct  261  FLQSKALCIMPVSLAKAIYHTQPPDTSSSIVKPETDPTS  299



>ref|XP_009607290.1| PREDICTED: transcription factor UNE12-like [Nicotiana tomentosiformis]
Length=302

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS VEEE  SE G  QPAWEKWS+DGTERQVAKLMEENVG+AMQ
Sbjct  206  RLGGAGAVAPLVTDIPISSVEEES-SEVGNNQPAWEKWSSDGTERQVAKLMEENVGSAMQ  264

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIYHSQ PDT+ LVKPETNPP
Sbjct  265  FLQSKALCIMPISLASAIYHSQPPDTSSLVKPETNPP  301



>ref|XP_010429869.1| PREDICTED: transcription factor UNE12-like [Camelina sativa]
Length=314

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+   E GR  QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  218  GGAGAVAPLVTDMPLSSSVEDETGEGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  277

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  278  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  313



>ref|XP_009776898.1| PREDICTED: transcription factor UNE12-like [Nicotiana sylvestris]
Length=302

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIPIS VEEE  SE G  QPAWEKWS+DGTERQVAKLMEENVG+AMQ
Sbjct  207  RLGGAGAVAPLVTDIPISSVEEES-SEGGNNQPAWEKWSSDGTERQVAKLMEENVGSAMQ  265

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            FLQSKALCIMPISLASAIYHSQ PDT+ L+KPETNPP
Sbjct  266  FLQSKALCIMPISLASAIYHSQPPDTSSLIKPETNPP  302



>emb|CDX91293.1| BnaC02g27040D [Brassica napus]
Length=298

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 85/97 (88%), Gaps = 2/97 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+ GSE GRT Q AWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  200  GGAGAVAPLVTDMPLSSSVEDEGSEGGRTPQAAWEKWSNDGTERQVAKLMEENVGAAMQL  259

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT + +VKPETNPP
Sbjct  260  LQSKALCMMPISLAMAIYHSQPPDTSSSVVKPETNPP  296



>ref|XP_006443926.1| hypothetical protein CICLE_v10021443mg [Citrus clementina]
 ref|XP_006479602.1| PREDICTED: transcription factor UNE12-like [Citrus sinensis]
 gb|ESR57166.1| hypothetical protein CICLE_v10021443mg [Citrus clementina]
 gb|KDO68565.1| hypothetical protein CISIN_1g022649mg [Citrus sinensis]
Length=294

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 85/98 (87%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVT-DIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + G  GAVAPLVT D+P+S VE+E G E  R QPAWEKWSNDGTERQVAKLMEENVGAAM
Sbjct  197  RVGAPGAVAPLVTTDLPLSSVEDESG-EGVRNQPAWEKWSNDGTERQVAKLMEENVGAAM  255

Query  547  QFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QFLQSKALCIMPISLA+AIYHSQ P++  LVKPETNPP
Sbjct  256  QFLQSKALCIMPISLATAIYHSQPPESPNLVKPETNPP  293



>ref|XP_006288280.1| hypothetical protein CARUB_v10001523mg [Capsella rubella]
 gb|EOA21178.1| hypothetical protein CARUB_v10001523mg [Capsella rubella]
Length=310

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S  VE+E G      QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVEDETGDGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  309



>ref|XP_010456011.1| PREDICTED: transcription factor UNE12 [Camelina sativa]
Length=312

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 83/96 (86%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S  VE+E G      QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  216  GGAGAVAPLVTDMPLSSSVEDETGDGGRAPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  275

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPETNPP
Sbjct  276  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPETNPP  311



>gb|AAM65759.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=310

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GG GAVAPLVTD+P+S   E+   E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGVGAVAPLVTDMPLSSSVEDETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPE NPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPENNPP  309



>dbj|BAJ33851.1| unnamed protein product [Thellungiella halophila]
Length=310

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 84/96 (88%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S   E+  S+ GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVEDETSDGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AI HSQ PDT+ +VKPETNPP
Sbjct  274  LQSKALCMMPISLAMAICHSQPPDTSSVVKPETNPP  309



>gb|AAM10948.1|AF488592_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=310

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 82/96 (85%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+S    +   E GRT QPAWEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  214  GGAGAVAPLVTDMPLSSSVXDETGEGGRTPQPAWEKWSNDGTERQVAKLMEENVGAAMQL  273

Query  541  LQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            LQSKALC+MPISLA AIYHSQ PDT+ +VKPE NPP
Sbjct  274  LQSKALCMMPISLAMAIYHSQPPDTSSVVKPENNPP  309



>ref|XP_010679161.1| PREDICTED: transcription factor UNE12 [Beta vulgaris subsp. vulgaris]
Length=301

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAV PLVTD+PIS VEEEGG    R QP WEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  205  RLGGAGAVVPLVTDMPISSVEEEGGEGG-RGQPVWEKWSNDGTERQVAKLMEENVGAAMQ  263

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMP+SLASAIYH+Q PD + LVKPE+NPPS
Sbjct  264  FLQSKALCIMPVSLASAIYHTQPPDASSLVKPESNPPS  301



>gb|AIL24119.1| basic helix-loop-helix leucine-zipper transcription factor [Tamarix 
hispida]
Length=307

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 87/103 (84%), Gaps = 5/103 (5%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAG-RTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVTD+P+S VE+EGG   G R QPAWEKWSNDGTERQVAKLMEENVGAAM
Sbjct  205  RLGGAGAVAPLVTDVPVSSVEDEGGEGGGGRNQPAWEKWSNDGTERQVAKLMEENVGAAM  264

Query  547  QFLQSKALCIMPISLASAIYHSQAPDTT----PLVKPETNPPS  431
            QFLQSKALCIMPISLASAIYH+Q P  T     LVKPETNP S
Sbjct  265  QFLQSKALCIMPISLASAIYHTQQPSDTSNASSLVKPETNPLS  307



>ref|XP_004493736.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cicer 
arietinum]
Length=300

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 7/105 (7%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVE--EEGGSEAG-----RTQPAWEKWSNDGTERQVAKLMEE  566
            + GGAGAVAPLVTDIP+S +E  +  G +       R  PAW+KWSNDGTE+QVAKLMEE
Sbjct  196  RLGGAGAVAPLVTDIPLSSIESYKSNGDQEEGGEGGRNGPAWDKWSNDGTEKQVAKLMEE  255

Query  565  NVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            NVGAAMQFLQSKALCIMPISLASAIY SQ PD++ +VKPETNPPS
Sbjct  256  NVGAAMQFLQSKALCIMPISLASAIYQSQPPDSSSIVKPETNPPS  300



>ref|XP_004493737.1| PREDICTED: transcription factor UNE12-like isoform X2 [Cicer 
arietinum]
Length=292

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDIP+S +EEEGG    R  PAW+KWSNDGTE+QVAKLMEENVGAAMQ
Sbjct  196  RLGGAGAVAPLVTDIPLSSIEEEGGEGG-RNGPAWDKWSNDGTEKQVAKLMEENVGAAMQ  254

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ PD++ +VKPETNPPS
Sbjct  255  FLQSKALCIMPISLASAIYQSQPPDSSSIVKPETNPPS  292



>ref|XP_010038816.1| PREDICTED: transcription factor UNE12 isoform X2 [Eucalyptus 
grandis]
 gb|KCW84665.1| hypothetical protein EUGRSUZ_B01487 [Eucalyptus grandis]
Length=323

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTDIP+S VEEEGG    R QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  227  RLGAAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  285

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIY +Q PDT+ LVK E+NPPS
Sbjct  286  FLQSKALCIMPISLATAIYQTQPPDTSSLVKSESNPPS  323



>ref|XP_010038809.1| PREDICTED: transcription factor UNE12 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84664.1| hypothetical protein EUGRSUZ_B01487 [Eucalyptus grandis]
Length=344

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVAPLVTDIP+S VEEEGG    R QPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  248  RLGAAGAVAPLVTDIPLSSVEEEGGEGG-RNQPAWEKWSNDGTERQVAKLMEENVGAAMQ  306

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIY +Q PDT+ LVK E+NPPS
Sbjct  307  FLQSKALCIMPISLATAIYQTQPPDTSSLVKSESNPPS  344



>ref|XP_010522761.1| PREDICTED: transcription factor UNE12 [Tarenaya hassleriana]
Length=310

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 86/98 (88%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTD+P+S   EE GSE GRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  212  RLGGAGAVAPLVTDMPLSSSVEEEGSEGGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  271

Query  544  FLQSKALCIMPISLASAIYHSQ-APDTTPLVKPETNPP  434
            FLQSKALCIMPISLA AIYHSQ A D+   +KPETNPP
Sbjct  272  FLQSKALCIMPISLAMAIYHSQPASDSPSGIKPETNPP  309



>ref|XP_010457311.1| PREDICTED: transcription factor bHLH7 [Camelina sativa]
Length=122

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 78/98 (80%), Gaps = 7/98 (7%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVT++P+S       S    TQ  WEKWSNDGTERQVAKLMEENVGAAMQ
Sbjct  30   RLGGAGAVAPLVTEMPLS------SSIEDETQAVWEKWSNDGTERQVAKLMEENVGAAMQ  83

Query  544  FLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
             LQSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  84   LLQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  121



>ref|XP_010274210.1| PREDICTED: transcription factor UNE12 isoform X3 [Nelumbo nucifera]
Length=293

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP++ VE EG SE   +Q AWEKWSNDGTERQVAKLMEE+VGAAMQ
Sbjct  195  RLGGAGAVAQLVADIPLTSVEGEG-SEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAAMQ  253

Query  544  FLQSKALCIMPISLASAIYHSQAPD--TTPLVKPETNPPS  431
            FLQSKALCIMP+SLA+AIYH+  P+  TTP+VKPE++ PS
Sbjct  254  FLQSKALCIMPMSLAAAIYHTHPPEAPTTPIVKPESSAPS  293



>ref|XP_010274208.1| PREDICTED: transcription factor UNE12 isoform X1 [Nelumbo nucifera]
Length=324

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 3/100 (3%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP++ VE EG SE   +Q AWEKWSNDGTERQVAKLMEE+VGAAMQ
Sbjct  226  RLGGAGAVAQLVADIPLTSVEGEG-SEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAAMQ  284

Query  544  FLQSKALCIMPISLASAIYHSQAPD--TTPLVKPETNPPS  431
            FLQSKALCIMP+SLA+AIYH+  P+  TTP+VKPE++ PS
Sbjct  285  FLQSKALCIMPMSLAAAIYHTHPPEAPTTPIVKPESSAPS  324



>ref|XP_006305432.1| hypothetical protein CARUB_v10009831mg [Capsella rubella]
 gb|EOA38330.1| hypothetical protein CARUB_v10009831mg [Capsella rubella]
Length=308

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 81/98 (83%), Gaps = 8/98 (8%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTERQVAKLMEENVGAAM
Sbjct  217  RLGGAGAVAPLVTEMPLSSSIEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAM  269

Query  547  QFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            Q LQSKALCIMPISLA AIYHSQ PDT+ +VKPE NPP
Sbjct  270  QLLQSKALCIMPISLAMAIYHSQPPDTSSVVKPEMNPP  307



>gb|ACN21631.1| putative basic helix-loop-helix protein BHLH4 [Lotus japonicus]
Length=275

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 79/98 (81%), Gaps = 11/98 (11%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPL          EEGG E GR QPAWEKWSNDGTE+QVAKLMEEN+GAAMQ
Sbjct  189  RLGGAGAVAPL----------EEGG-EGGRNQPAWEKWSNDGTEKQVAKLMEENIGAAMQ  237

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY SQ  + + +VKPET+PPS
Sbjct  238  FLQSKALCIMPISLASAIYQSQPSENSSIVKPETSPPS  275



>gb|KDO48911.1| hypothetical protein CISIN_1g040019mg [Citrus sinensis]
Length=166

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S   E    + G +QP WEKWSNDGTE+QVAKLMEE++GAAMQ
Sbjct  69   RLGAAGAVAQLVADVPLSSALEGESIDGGSSQPEWEKWSNDGTEQQVAKLMEEDIGAAMQ  128

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAIY ++ PD    VKPE++ PS
Sbjct  129  FLQSKALCIMPISLASAIYRTRQPDAPAFVKPESSTPS  166



>ref|XP_009144630.1| PREDICTED: transcription factor UNE12-like, partial [Brassica 
rapa]
Length=290

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+    E+ GSE GRT Q AWEK SNDGTERQVAKLME+NV AAMQ 
Sbjct  192  GGAGAVAPLVTDMPLPSSVEDEGSEGGRTPQAAWEKGSNDGTERQVAKLMEKNVWAAMQL  251

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSK LC+MPISLA AIYHSQ PDT + +VKPETNPP
Sbjct  252  LQSKTLCMMPISLAMAIYHSQPPDTSSSVVKPETNPP  288



>ref|NP_001184895.1| transcription factor bHLH7 [Arabidopsis thaliana]
 gb|AAD25805.1|AC006550_13 Contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 
and gb|T22783 come from this gene [Arabidopsis thaliana]
 gb|AEE27519.1| transcription factor bHLH7 [Arabidopsis thaliana]
Length=297

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 9/97 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVT++P+S  VE+E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  207  GGAGAVAPLVTEMPLSSSVEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQL  259

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  260  LQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  296



>ref|XP_002892144.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68403.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 78/96 (81%), Gaps = 7/96 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVAPLVT++P+S   E+       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ L
Sbjct  216  GGAGAVAPLVTEMPLSSSTED------ETQAVWEKWSNDGTERQVAKLMEENVGAAMQLL  269

Query  538  QSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            QSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  270  QSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  305



>ref|NP_563672.1| transcription factor bHLH7 [Arabidopsis thaliana]
 sp|Q93Y00.1|BH007_ARATH RecName: Full=Transcription factor bHLH7; AltName: Full=Basic 
helix-loop-helix protein 7; Short=AtbHLH7; Short=bHLH 7; AltName: 
Full=Transcription factor EN 92; AltName: Full=bHLH transcription 
factor bHLH007 [Arabidopsis thaliana]
 gb|AAL55714.2|AF251692_1 putative transcription factor BHLH7 [Arabidopsis thaliana]
 gb|AAK96661.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47952.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27518.1| transcription factor bHLH7 [Arabidopsis thaliana]
Length=302

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 9/97 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVT++P+S  VE+E       TQ  WEKWSNDGTERQVAKLMEENVGAAMQ 
Sbjct  212  GGAGAVAPLVTEMPLSSSVEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAMQL  264

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  265  LQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  301



>emb|CDX97278.1| BnaA02g20690D [Brassica napus]
Length=299

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRT-QPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVTD+P+    E+ GSE GRT Q AWEK SNDGTERQVAKLME+NV AAMQ 
Sbjct  201  GGAGAVAPLVTDMPLPSSVEDEGSEGGRTPQAAWEKGSNDGTERQVAKLMEKNVWAAMQL  260

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSK LC+MPISLA AIYHSQ PDT + +VKPETNPP
Sbjct  261  LQSKTLCMMPISLAMAIYHSQPPDTSSSVVKPETNPP  297



>gb|KFK42664.1| hypothetical protein AALP_AA1G023700 [Arabis alpina]
Length=305

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 9/99 (9%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVTD+P+S  +E+E       +Q  WEKWSNDGTERQVAKLMEENVGAAM
Sbjct  213  RLGGAGAVAPLVTDMPLSSSIEDE-------SQAVWEKWSNDGTERQVAKLMEENVGAAM  265

Query  547  QFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            Q LQSKALCIMPISLA AIYHSQ PDT + ++KPE NPP
Sbjct  266  QLLQSKALCIMPISLAMAIYHSQPPDTSSSIIKPEMNPP  304



>ref|XP_008218266.1| PREDICTED: transcription factor UNE12-like isoform X2 [Prunus 
mume]
Length=341

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  245  RLGGAGAVAQLVADVPLSAVEGEG-IEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  303

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T LVKPE+N  S
Sbjct  304  FLQSKALCIMPISLAPAIFRTHQPDATTLVKPESNSSS  341



>ref|XP_008218265.1| PREDICTED: transcription factor UNE12-like isoform X1 [Prunus 
mume]
Length=346

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  250  RLGGAGAVAQLVADVPLSAVEGEG-IEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  308

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T LVKPE+N  S
Sbjct  309  FLQSKALCIMPISLAPAIFRTHQPDATTLVKPESNSSS  346



>ref|XP_009364494.1| PREDICTED: transcription factor UNE12 isoform X2 [Pyrus x bretschneideri]
Length=336

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  242  GGAGAVAQLVADVPLSAVEGEG-MEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQFL  300

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLA AI+ +  PD T +VKPE+N  S
Sbjct  301  QSKALCIMPISLAPAIFRTHQPDATTMVKPESNSSS  336



>ref|XP_008366876.1| PREDICTED: transcription factor UNE12-like isoform X1 [Malus 
domestica]
Length=336

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  240  RLGGAGAVAQLVADVPLSAVEGEG-MEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  298

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T +VKPE+N  S
Sbjct  299  FLQSKALCIMPISLAPAIFRTHQPDATTMVKPESNSSS  336



>ref|XP_009364493.1| PREDICTED: transcription factor UNE12 isoform X1 [Pyrus x bretschneideri]
Length=337

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  241  RLGGAGAVAQLVADVPLSAVEGEG-MEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  299

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T +VKPE+N  S
Sbjct  300  FLQSKALCIMPISLAPAIFRTHQPDATTMVKPESNSSS  337



>ref|XP_004171988.1| PREDICTED: transcription factor UNE12-like, partial [Cucumis 
sativus]
Length=219

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFL
Sbjct  126  GGAGAVAQLVADVPLSSVEGEG-IESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFL  184

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QSKALCIMPISLASAI+ +   D   LVKPE N P
Sbjct  185  QSKALCIMPISLASAIFRTHQADPQILVKPEMNTP  219



>ref|XP_007205486.1| hypothetical protein PRUPE_ppa008172mg [Prunus persica]
 gb|EMJ06685.1| hypothetical protein PRUPE_ppa008172mg [Prunus persica]
Length=342

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  246  RLGGAGAVAQLVADVPLSAVEGEG-IEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  304

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQ+KALCIMPISLA AI+ +  PD T LVKPE+N  S
Sbjct  305  FLQAKALCIMPISLAPAIFRTHQPDATTLVKPESNSSS  342



>ref|XP_010457313.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=310

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 9/99 (9%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTERQVAKLMEENVGAAM
Sbjct  218  RLGGAGAVAPLVTEMPLSSSIEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAM  270

Query  547  QFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            Q LQSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  271  QLLQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  309



>gb|EYU17893.1| hypothetical protein MIMGU_mgv1a010769mg [Erythranthe guttata]
Length=302

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVAPLVTDI    +EEEGG+  GR QPAWEKWS+DGTERQVAKLMEENVGAAMQ
Sbjct  204  RLGGAGAVAPLVTDISTLSMEEEGGNGGGRAQPAWEKWSSDGTERQVAKLMEENVGAAMQ  263

Query  544  FLQSKALCIMPISLASAIYHSQ-APDTTPLVKPETNPPS  431
            FLQSKALC+MPISLASAIYH+Q   D T  VKPE++P S
Sbjct  264  FLQSKALCMMPISLASAIYHTQPVTDATSHVKPESDPLS  302



>ref|XP_010474907.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=313

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 9/99 (9%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTERQVAKLMEENVGAAM
Sbjct  221  RLGGAGAVAPLVTEMPLSSSIEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAM  273

Query  547  QFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            Q LQSKALCIMPISLA AIYHSQ PDT + +VKPE NPP
Sbjct  274  QLLQSKALCIMPISLAMAIYHSQPPDTSSSIVKPEMNPP  312



>ref|XP_009119583.1| PREDICTED: transcription factor bHLH7 [Brassica rapa]
 emb|CDX89919.1| BnaA10g01630D [Brassica napus]
Length=311

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 7/96 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVAPLVT++P+S   E+       TQ  WEKWS+DGTERQVAKLMEENVGAAMQ L
Sbjct  221  GGAGAVAPLVTEMPLSSSTED------ETQAVWEKWSDDGTERQVAKLMEENVGAAMQLL  274

Query  538  QSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            QSKALCIMP+SLA AIYHSQ PDT + +VKPE NPP
Sbjct  275  QSKALCIMPVSLAMAIYHSQPPDTSSSVVKPEMNPP  310



>ref|XP_010481495.1| PREDICTED: transcription factor bHLH7-like [Camelina sativa]
Length=311

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 9/99 (9%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAM  548
            + GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTERQVAKLMEENVGAAM
Sbjct  219  RLGGAGAVAPLVTEMPLSSSIEDE-------TQAVWEKWSNDGTERQVAKLMEENVGAAM  271

Query  547  QFLQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            Q LQSKALCI+PISLA AIYHSQ PDT + +VKPE NPP
Sbjct  272  QLLQSKALCIIPISLAMAIYHSQPPDTSSSIVKPEMNPP  310



>emb|CDY18143.1| BnaC05g01660D [Brassica napus]
Length=306

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 78/96 (81%), Gaps = 7/96 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVAPLVT++P+S   E+       TQ  WEKWS+DGTERQVAKLMEENVGAAMQ L
Sbjct  216  GGAGAVAPLVTEMPLSSSTED------ETQAVWEKWSDDGTERQVAKLMEENVGAAMQLL  269

Query  538  QSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            QSKALCIMP+SLA AIYHSQ PDT + +VKPE NPP
Sbjct  270  QSKALCIMPVSLAMAIYHSQPPDTSSSVVKPEMNPP  305



>ref|XP_010556765.1| PREDICTED: transcription factor UNE12 [Tarenaya hassleriana]
Length=313

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 6/102 (6%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISL---VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGA  554
            + GGAGAVAPLVTD+P+ L   VE+EG  E GRT+PAWEK S DGTE QVAKLMEENVGA
Sbjct  212  RLGGAGAVAPLVTDMPLPLSSSVEDEG-IEGGRTEPAWEKLSKDGTEGQVAKLMEENVGA  270

Query  553  AMQFLQSKALCIMPISLASAIYHSQA--PDTTPLVKPETNPP  434
            AMQFLQSK+LCIMPISLA A+ HSQ+   DT+  VKPE NPP
Sbjct  271  AMQFLQSKSLCIMPISLAMAVCHSQSQPSDTSSGVKPEMNPP  312



>ref|XP_007030571.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY11073.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=345

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S VE +G    G TQPAWEKWSNDGTE+QVAKLMEE++GAAMQ
Sbjct  250  RLGAAGAVAQLVADVPLSSVEGDGIE--GGTQPAWEKWSNDGTEQQVAKLMEEDIGAAMQ  307

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAI+ +  PD   +VKPE++ PS
Sbjct  308  FLQSKALCIMPISLASAIFRTHQPDAPTIVKPESSTPS  345



>ref|XP_002284047.1| PREDICTED: transcription factor UNE12 [Vitis vinifera]
 emb|CBI26351.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP+  VE E G E G  Q AW+KWSNDGTER+VAKLMEE+VGAAMQ
Sbjct  217  RLGGAGAVAQLVADIPLPAVEGETG-EGGSNQQAWDKWSNDGTEREVAKLMEEDVGAAMQ  275

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIY +   DT  L+KPE N PS
Sbjct  276  FLQSKALCIMPISLAAAIYPAHQTDTPTLIKPEPNAPS  313



>emb|CBI34158.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+  +E +G +E G  Q AWEKWS DGTE+QVAKLMEE+VGAAMQFL
Sbjct  167  GGAGAVAQLVADVPLLSIEGDG-TEGGSNQQAWEKWSTDGTEQQVAKLMEEDVGAAMQFL  225

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLASAI+ +  P+ + LVKPE++ PS
Sbjct  226  QSKALCIMPISLASAIFRTHQPEPSTLVKPESDAPS  261



>ref|XP_004135655.1| PREDICTED: transcription factor UNE12-like [Cucumis sativus]
 gb|KGN66149.1| hypothetical protein Csa_1G573680 [Cucumis sativus]
Length=318

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFL
Sbjct  225  GGAGAVAQLVADVPLSSVEGEG-IESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFL  283

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QSKALCIMPISLASAI+ +   D   LVKPE N P
Sbjct  284  QSKALCIMPISLASAIFRTHQADPQILVKPEMNTP  318



>ref|XP_008450747.1| PREDICTED: transcription factor UNE12-like isoform X1 [Cucumis 
melo]
Length=318

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFL
Sbjct  225  GGAGAVAQLVADVPLSSVEGEG-IESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFL  283

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QSKALCIMPISLASAI+ +   D   LVKPE N P
Sbjct  284  QSKALCIMPISLASAIFRTHQADPQILVKPEMNTP  318



>ref|XP_011465955.1| PREDICTED: transcription factor UNE12 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG       Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ+L
Sbjct  243  GGAGAVAQLVADVPLSAVEGEGIEGGTNNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQYL  302

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLA AI+ +  PDTT +VKPE++  S
Sbjct  303  QSKALCIMPISLAPAIFRTHQPDTTTMVKPESHNSS  338



>ref|XP_004302053.1| PREDICTED: transcription factor UNE12 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=339

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG       Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ+L
Sbjct  244  GGAGAVAQLVADVPLSAVEGEGIEGGTNNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQYL  303

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLA AI+ +  PDTT +VKPE++  S
Sbjct  304  QSKALCIMPISLAPAIFRTHQPDTTTMVKPESHNSS  339



>emb|CAN66761.1| hypothetical protein VITISV_032727 [Vitis vinifera]
Length=337

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP+  VE E G E G  Q AW+KWSNDGTER+VAKLMEE+VGAAMQ
Sbjct  241  RLGGAGAVAQLVADIPLPAVEGETG-EGGSNQQAWDKWSNDGTEREVAKLMEEDVGAAMQ  299

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIY +   DT  L+KPE N PS
Sbjct  300  FLQSKALCIMPISLAAAIYPAHQTDTPTLIKPEPNAPS  337



>ref|XP_006432927.1| hypothetical protein CICLE_v10001768mg [Citrus clementina]
 ref|XP_006471682.1| PREDICTED: transcription factor UNE12-like isoform X1 [Citrus 
sinensis]
 gb|ESR46167.1| hypothetical protein CICLE_v10001768mg [Citrus clementina]
Length=336

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            G AGAVA LV D+P+S   E    + G +QP WEKWSNDGTE+QVAKLMEE++GAAMQFL
Sbjct  241  GAAGAVAQLVADVPLSSALEGESIDGGSSQPEWEKWSNDGTEQQVAKLMEEDIGAAMQFL  300

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLASAIY ++ PD    VKPE++ PS
Sbjct  301  QSKALCIMPISLASAIYRTRQPDAPAFVKPESSTPS  336



>ref|XP_008366877.1| PREDICTED: transcription factor UNE12-like isoform X2 [Malus 
domestica]
Length=334

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S  E   G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  240  RLGGAGAVAQLVADVPLSAGE---GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  296

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T +VKPE+N  S
Sbjct  297  FLQSKALCIMPISLAPAIFRTHQPDATTMVKPESNSSS  334



>ref|XP_009364496.1| PREDICTED: transcription factor UNE12 isoform X3 [Pyrus x bretschneideri]
Length=335

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 3/98 (3%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S  E   G E G  Q AWEKWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  241  RLGGAGAVAQLVADVPLSAGE---GMEGGTNQQAWEKWSNDGTEQQVAKLMEEDVGAAMQ  297

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD T +VKPE+N  S
Sbjct  298  FLQSKALCIMPISLAPAIFRTHQPDATTMVKPESNSSS  335



>ref|XP_008450748.1| PREDICTED: transcription factor UNE12-like isoform X2 [Cucumis 
melo]
Length=313

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E+G  Q AWEKWS+DGTE+QVAKLMEE+VGAAMQFL
Sbjct  220  GGAGAVAQLVADVPLSSVEGEG-IESGNNQQAWEKWSSDGTEQQVAKLMEEDVGAAMQFL  278

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QSKALCIMPISLASAI+ +   D   LVKPE N P
Sbjct  279  QSKALCIMPISLASAIFRTHQADPQILVKPEMNTP  313



>ref|XP_010659880.1| PREDICTED: transcription factor UNE12-like [Vitis vinifera]
Length=331

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+  +E +G +E G  Q AWEKWS DGTE+QVAKLMEE+VGAAMQ
Sbjct  235  RLGGAGAVAQLVADVPLLSIEGDG-TEGGSNQQAWEKWSTDGTEQQVAKLMEEDVGAAMQ  293

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAI+ +  P+ + LVKPE++ PS
Sbjct  294  FLQSKALCIMPISLASAIFRTHQPEPSTLVKPESDAPS  331



>gb|KJB44876.1| hypothetical protein B456_007G277200 [Gossypium raimondii]
Length=323

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 78/96 (81%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            G AGAVA LV D+P+  VE +G    G TQPAWEKWSNDGTE+QVAKLMEE++GAAMQFL
Sbjct  230  GAAGAVAQLVADVPLLSVEGDGA--GGGTQPAWEKWSNDGTEQQVAKLMEEDIGAAMQFL  287

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCI+PISLASAI+ +  PD   +VKPE+N PS
Sbjct  288  QSKALCIVPISLASAIFPAHQPDAPTIVKPESNTPS  323



>gb|KHG28438.1| Transcription factor UNE12 -like protein [Gossypium arboreum]
Length=353

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+  VE +G    G TQPAWEKWSNDGTE+QVAKLMEE++GAAMQ
Sbjct  258  RLGAAGAVAQLVADVPLLSVEGDGA--GGGTQPAWEKWSNDGTEQQVAKLMEEDIGAAMQ  315

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCI+PISLASAI+ +  PD   +VKPE+N PS
Sbjct  316  FLQSKALCIVPISLASAIFPAHQPDAPTIVKPESNTPS  353



>ref|XP_002319074.2| hypothetical protein POPTR_0013s03830g [Populus trichocarpa]
 gb|EEE94997.2| hypothetical protein POPTR_0013s03830g [Populus trichocarpa]
Length=119

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S ++ EG +E G  Q +WE WSND TE++VAKLMEE+VGAAMQ
Sbjct  23   RLGAAGAVAQLVADVPLSSIKGEG-NEGGANQQSWENWSNDDTEQEVAKLMEEDVGAAMQ  81

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAI+ ++ P+ + L+  E+N PS
Sbjct  82   FLQSKALCIMPISLASAIFRARPPNASTLINTESNTPS  119



>ref|XP_002306441.2| hypothetical protein POPTR_0005s05500g [Populus trichocarpa]
 gb|EEE93437.2| hypothetical protein POPTR_0005s05500g [Populus trichocarpa]
Length=331

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAAMQ
Sbjct  235  RLGAAGAVAQLVADVPLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAAMQ  293

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
             LQSKALCIMP+SLASAI+ ++ P+   LVKPE+NPPS
Sbjct  294  LLQSKALCIMPVSLASAIFRARPPNAPTLVKPESNPPS  331



>ref|XP_006418274.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
 dbj|BAJ34239.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36627.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
Length=308

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 9/97 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTE QVAKLMEENVGAAMQ 
Sbjct  218  GGAGAVAPLVTEMPLSSSIEDE-------TQGVWEKWSNDGTELQVAKLMEENVGAAMQL  270

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSKALCIMPISLA AIYHSQ  DT + ++KPE NPP
Sbjct  271  LQSKALCIMPISLAMAIYHSQPQDTSSSIIKPEMNPP  307



>ref|XP_011032406.1| PREDICTED: transcription factor UNE12-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAAMQ
Sbjct  235  RLGAAGAVAQLVADVPLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAAMQ  293

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
             LQSKALCIMPISLASAI+ ++ P+   LVKPE NPPS
Sbjct  294  LLQSKALCIMPISLASAIFRARPPNAPTLVKPELNPPS  331



>ref|XP_011032404.1| PREDICTED: transcription factor UNE12-like isoform X1 [Populus 
euphratica]
Length=332

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S V+ EG  E G  Q AWE WSNDGTE++VAKLMEE+VGAAMQ
Sbjct  236  RLGAAGAVAQLVADVPLSSVQGEG-IEGGANQQAWENWSNDGTEQEVAKLMEEDVGAAMQ  294

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
             LQSKALCIMPISLASAI+ ++ P+   LVKPE NPPS
Sbjct  295  LLQSKALCIMPISLASAIFRARPPNAPTLVKPELNPPS  332



>ref|XP_006418273.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
 gb|ESQ36626.1| hypothetical protein EUTSA_v10008279mg [Eutrema salsugineum]
Length=303

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 9/97 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL-VEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQF  542
            GGAGAVAPLVT++P+S  +E+E       TQ  WEKWSNDGTE QVAKLMEENVGAAMQ 
Sbjct  213  GGAGAVAPLVTEMPLSSSIEDE-------TQGVWEKWSNDGTELQVAKLMEENVGAAMQL  265

Query  541  LQSKALCIMPISLASAIYHSQAPDT-TPLVKPETNPP  434
            LQSKALCIMPISLA AIYHSQ  DT + ++KPE NPP
Sbjct  266  LQSKALCIMPISLAMAIYHSQPQDTSSSIIKPEMNPP  302



>ref|NP_001059050.1| Os07g0182200 [Oryza sativa Japonica Group]
 ref|XP_006657507.1| PREDICTED: transcription factor UNE12-like [Oryza brachyantha]
 dbj|BAF20964.1| Os07g0182200 [Oryza sativa Japonica Group]
 dbj|BAG90055.1| unnamed protein product [Oryza sativa Japonica Group]
Length=136

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIPIS+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  43   GGAGAVAQLVADIPISVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  100

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  101  QSKALCMMPISLAMAIYDTQHSQDGHSVKPEPNTPS  136



>ref|XP_002531293.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31106.1| conserved hypothetical protein [Ricinus communis]
Length=326

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            G AGAVA LV D+P++ VE E    A   Q  WEKWSNDGTE+QVAKLMEE++GAAMQFL
Sbjct  231  GAAGAVAQLVADVPLASVEGESIDGAAANQQTWEKWSNDGTEQQVAKLMEEDIGAAMQFL  290

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLASAI  +  PD   ++KPE+N PS
Sbjct  291  QSKALCIMPISLASAILRTHPPDAPSIIKPESNTPS  326



>ref|XP_010025019.1| PREDICTED: transcription factor UNE12-like isoform X3 [Eucalyptus 
grandis]
Length=253

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFL
Sbjct  159  GGAGAVAQLVADVPLSSAEGEI-IEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFL  217

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK LCIMPISLASAI+ +  PD    +KPE++ PS
Sbjct  218  QSKTLCIMPISLASAIFRTSQPDMPRSIKPESSAPS  253



>gb|ACG44301.1| BHLH transcription factor [Zea mays]
Length=136

 Score =   125 bits (313),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQ+AKLMEE++GAAMQFL
Sbjct  43   GGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTERQIAKLMEEDIGAAMQFL  100

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  101  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  136



>ref|XP_008370704.1| PREDICTED: transcription factor UNE12-like isoform X2 [Malus 
domestica]
Length=331

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE EG  E G  Q A EKWSNDGTE++VAKLMEE+VGAAMQ
Sbjct  235  RLGGAGAVAQLVADVPLSAVEGEG-MEGGTNQQACEKWSNDGTEQEVAKLMEEDVGAAMQ  293

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA AI+ +  PD   +VKPE+N  S
Sbjct  294  FLQSKALCIMPISLAPAIFXTHQPDAPTIVKPESNSSS  331



>ref|XP_008370703.1| PREDICTED: transcription factor UNE12-like isoform X1 [Malus 
domestica]
Length=332

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE EG  E G  Q A EKWSNDGTE++VAKLMEE+VGAAMQFL
Sbjct  238  GGAGAVAQLVADVPLSAVEGEG-MEGGTNQQACEKWSNDGTEQEVAKLMEEDVGAAMQFL  296

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLA AI+ +  PD   +VKPE+N  S
Sbjct  297  QSKALCIMPISLAPAIFXTHQPDAPTIVKPESNSSS  332



>gb|KDP23663.1| hypothetical protein JCGZ_23496 [Jatropha curcas]
Length=332

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            G AGAVA LV DI  S VE     E G  Q  WEKWSNDGTE+QVAKLMEE++GAAMQFL
Sbjct  237  GAAGAVAQLVADIQPSSVEAGESIEGGANQQPWEKWSNDGTEQQVAKLMEEDIGAAMQFL  296

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLASAI+ +  PD   +VKPE+N PS
Sbjct  297  QSKALCIMPISLASAIFRTHPPDAPSIVKPESNTPS  332



>ref|XP_007144828.1| hypothetical protein PHAVU_007G187500g [Phaseolus vulgaris]
 gb|ESW16822.1| hypothetical protein PHAVU_007G187500g [Phaseolus vulgaris]
Length=357

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 0/95 (0%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S VE+    E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQ
Sbjct  261  RLGGAGAVAQLVADVPLSAVEQGEDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQ  320

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            FLQSKALCIMPISLASAI+     +++ ++KPE+N
Sbjct  321  FLQSKALCIMPISLASAIFRMPQSESSTVIKPESN  355



>ref|XP_010246321.1| PREDICTED: transcription factor UNE12-like isoform X3 [Nelumbo 
nucifera]
Length=486

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAAMQ
Sbjct  390  RLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAAMQ  448

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  449  FLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  486



>ref|XP_010246322.1| PREDICTED: transcription factor UNE12-like isoform X4 [Nelumbo 
nucifera]
 ref|XP_010246323.1| PREDICTED: transcription factor UNE12-like isoform X4 [Nelumbo 
nucifera]
Length=432

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAAMQ
Sbjct  336  RLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAAMQ  394

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  395  FLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  432



>ref|XP_010246320.1| PREDICTED: transcription factor UNE12-like isoform X2 [Nelumbo 
nucifera]
Length=503

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAAMQFL
Sbjct  409  GGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAAMQFL  467

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  468  QSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  503



>ref|XP_010246319.1| PREDICTED: transcription factor UNE12-like isoform X1 [Nelumbo 
nucifera]
Length=517

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP++ VE EG      +Q AWEKWS DGTERQVAKLMEE+VGAAMQ
Sbjct  421  RLGGAGAVAQLVADIPLTSVEGEGSEGG-SSQRAWEKWSTDGTERQVAKLMEEDVGAAMQ  479

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLA+AIYH+  P+    VKPE+N PS
Sbjct  480  FLQSKALCIMPISLATAIYHAHPPEAPTAVKPESNTPS  517



>ref|XP_010025017.1| PREDICTED: transcription factor UNE12-like isoform X2 [Eucalyptus 
grandis]
Length=315

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQ
Sbjct  219  RLGGAGAVAQLVADVPLSSAEGEI-IEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQ  277

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSK LCIMPISLASAI+ +  PD    +KPE++ PS
Sbjct  278  FLQSKTLCIMPISLASAIFRTSQPDMPRSIKPESSAPS  315



>ref|XP_010025016.1| PREDICTED: transcription factor UNE12-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW61601.1| hypothetical protein EUGRSUZ_H04337 [Eucalyptus grandis]
Length=320

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFL
Sbjct  226  GGAGAVAQLVADVPLSSAEGEI-IEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFL  284

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK LCIMPISLASAI+ +  PD    +KPE++ PS
Sbjct  285  QSKTLCIMPISLASAIFRTSQPDMPRSIKPESSAPS  320



>gb|KCW61602.1| hypothetical protein EUGRSUZ_H04337 [Eucalyptus grandis]
Length=347

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 74/96 (77%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S  E E   E G  QPAWEKW  DGTE+QVAKLMEE+VGAAMQFL
Sbjct  253  GGAGAVAQLVADVPLSSAEGEI-IEGGNNQPAWEKWLTDGTEQQVAKLMEEDVGAAMQFL  311

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK LCIMPISLASAI+ +  PD    +KPE++ PS
Sbjct  312  QSKTLCIMPISLASAIFRTSQPDMPRSIKPESSAPS  347



>gb|KHN04930.1| Transcription factor UNE12 [Glycine soja]
Length=332

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  238  GGAGAVAQLVADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  297

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLASAI+     + +  +KPE+N
Sbjct  298  QSKALCIMPISLASAIFRMPQSEASTGIKPESN  330



>ref|XP_009398565.1| PREDICTED: transcription factor UNE12-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA L+ DIP+S+   EG  EAG  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  189  GGAGAVAQLIADIPLSV---EG--EAGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  243

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +  P+  P VKPE N PS
Sbjct  244  QSKALCMMPISLAMAIYDTHQPEAQP-VKPEPNTPS  278



>ref|XP_004496017.1| PREDICTED: transcription factor UNE12-like [Cicer arietinum]
Length=492

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE E   E G  Q AW KWSNDGTE+QVAKLMEE+VGAAMQ L
Sbjct  398  GGAGAVAQLVADVPVSAVEGED-VEGGANQQAWTKWSNDGTEQQVAKLMEEDVGAAMQLL  456

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALCIMPISLASAI+     D++ ++KPE+N  S
Sbjct  457  QSKALCIMPISLASAIFRMPQSDSSTIIKPESNNHS  492



>ref|XP_006650733.1| PREDICTED: transcription factor UNE12-like [Oryza brachyantha]
Length=136

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  43   GGAGAVAQLVADIPLSVKGE--ASDSGGDQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  100

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  101  QSKALCMMPISLAMAIYDTQHTQDGQPVKHEPNTPS  136



>gb|KEH43018.1| transcription factor UNE12-like protein [Medicago truncatula]
Length=355

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE E   E G  Q AW KWSNDGTE+QVAKLMEE+VGAAMQ L
Sbjct  261  GGAGAVAQLVADVPVSAVEGED-IEGGTNQQAWAKWSNDGTEQQVAKLMEEDVGAAMQLL  319

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLASAI+     D++ ++KPE+N
Sbjct  320  QSKALCIMPISLASAIFRMPQSDSSTIIKPESN  352



>ref|XP_009398564.1| PREDICTED: transcription factor UNE12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA L+ DIP+S+   EG  EAG  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  211  GGAGAVAQLIADIPLSV---EG--EAGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  265

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +  P+  P VKPE N PS
Sbjct  266  QSKALCMMPISLAMAIYDTHQPEAQP-VKPEPNTPS  300



>gb|EAZ02995.1| hypothetical protein OsI_25136 [Oryza sativa Indica Group]
Length=293

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIPIS+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  200  GGAGAVAQLVADIPISVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  257

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  258  QSKALCMMPISLAMAIYDTQHSQDGHSVKPEPNTPS  293



>ref|XP_011038575.1| PREDICTED: transcription factor UNE12-like [Populus euphratica]
Length=332

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G AGAVA LV D+P+S V+ EG +E G  Q +WE WSND TE++VAKLMEE+VGAAMQ
Sbjct  236  RLGAAGAVAQLVADVPLSSVQGEG-NEGGANQQSWENWSNDDTEQEVAKLMEEDVGAAMQ  294

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALCIMPISLASAI+ ++ P+ + L+  E+N PS
Sbjct  295  FLQSKALCIMPISLASAIFRARPPNASTLINTESNTPS  332



>ref|XP_009399361.1| PREDICTED: transcription factor UNE12-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 75/96 (78%), Gaps = 3/96 (3%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA L+ DIP++ VE E G + G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  210  GGAGAVAQLIADIPLA-VEGEAG-KGGTNQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  267

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +  PD  P VKPE + PS
Sbjct  268  QSKALCMMPISLAMAIYDAHQPDAQP-VKPEPDTPS  302



>ref|XP_003556469.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=331

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  237  GGAGAVAQLVADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  296

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPI LASAI+     + +  +KPE+N
Sbjct  297  QSKALCIMPIPLASAIFRMPQSEASTGIKPESN  329



>ref|XP_006606461.1| PREDICTED: transcription factor UNE12-like isoform X2 [Glycine 
max]
Length=332

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E G  + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  238  GGAGAVAQLVADVPLSAVEGDQDIEGGANEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  297

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPI LASAI+     + +  +KPE+N
Sbjct  298  QSKALCIMPIPLASAIFRMPQSEASTGIKPESN  330



>gb|EEE66685.1| hypothetical protein OsJ_23336 [Oryza sativa Japonica Group]
Length=342

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIPIS+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQ
Sbjct  247  RLGGAGAVAQLVADIPISVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQ  304

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            FLQSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  305  FLQSKALCMMPISLAMAIYDTQHSQDGHSVKPEPNTPS  342



>ref|XP_010228372.1| PREDICTED: transcription factor UNE12-like isoform X1 [Brachypodium 
distachyon]
Length=186

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLM+E++GAAMQFL
Sbjct  93   GGAGAVAQLVADIPLSVKGE--ASDSGSNQQIWEKWSTDGTERQVAKLMDEDIGAAMQFL  150

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N  S
Sbjct  151  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNSHS  186



>ref|NP_001152044.1| LOC100285681 [Zea mays]
 gb|ACG45529.1| BHLH transcription factor [Zea mays]
 gb|AFW67349.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04749.1| bHLH transcription factor, partial [Zea mays]
Length=285

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  192  GGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  249

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  250  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  285



>ref|XP_002466294.1| hypothetical protein SORBIDRAFT_01g005130 [Sorghum bicolor]
 gb|EER93292.1| hypothetical protein SORBIDRAFT_01g005130 [Sorghum bicolor]
Length=283

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  190  GGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  247

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  248  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  283



>ref|XP_008788137.1| PREDICTED: transcription factor UNE12-like isoform X1 [Phoenix 
dactylifera]
Length=264

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  171  GGAGAVAQLVADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  228

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY + +      VKPE N  S
Sbjct  229  QSKALCMMPISLAMAIYDTHSQPEGHTVKPEPNTSS  264



>ref|XP_008788138.1| PREDICTED: transcription factor UNE12-like isoform X2 [Phoenix 
dactylifera]
Length=263

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  170  GGAGAVAQLVADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  227

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY + +      VKPE N  S
Sbjct  228  QSKALCMMPISLAMAIYDTHSQPEGHTVKPEPNTSS  263



>ref|XP_004955662.1| PREDICTED: transcription factor UNE12-like [Setaria italica]
Length=289

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G TQ  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  196  GGAGAVAQLVADIPLSVKGE--ASDSGSTQHIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  253

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +Q P     +KPE N
Sbjct  254  QSKALCMMPISLAMAIYDTQNPQDGHSLKPEPN  286



>ref|XP_009418926.1| PREDICTED: transcription factor UNE12-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=299

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  206  GGAGAVAQLVADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFL  263

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LC+MPISLA AI  +     +  VKPE N PS
Sbjct  264  QSKSLCMMPISLAMAILDTHHQSESKTVKPEPNTPS  299



>ref|XP_006589182.1| PREDICTED: transcription factor UNE12-like isoform X4 [Glycine 
max]
Length=327

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  233  GGAGAVAQLVADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  292

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLAS+I+     + +  +KPE+N
Sbjct  293  QSKALCIMPISLASSIFRMPQSEASTGIKPESN  325



>ref|XP_006589181.1| PREDICTED: transcription factor UNE12-like isoform X3 [Glycine 
max]
Length=328

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  234  GGAGAVAQLVADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  293

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLAS+I+     + +  +KPE+N
Sbjct  294  QSKALCIMPISLASSIFRMPQSEASTGIKPESN  326



>ref|XP_003536121.1| PREDICTED: transcription factor UNE12-like isoform X1 [Glycine 
max]
Length=328

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  234  GGAGAVAQLVADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  293

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLAS+I+     + +  +KPE+N
Sbjct  294  QSKALCIMPISLASSIFRMPQSEASTGIKPESN  326



>ref|XP_006589180.1| PREDICTED: transcription factor UNE12-like isoform X2 [Glycine 
max]
Length=329

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  235  GGAGAVAQLVADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  294

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLAS+I+     + +  +KPE+N
Sbjct  295  QSKALCIMPISLASSIFRMPQSEASTGIKPESN  327



>ref|XP_009418925.1| PREDICTED: transcription factor UNE12-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  225  GGAGAVAQLVADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFL  282

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LC+MPISLA AI  +     +  VKPE N PS
Sbjct  283  QSKSLCMMPISLAMAILDTHHQSESKTVKPEPNTPS  318



>ref|XP_010674832.1| PREDICTED: transcription factor UNE12-like [Beta vulgaris subsp. 
vulgaris]
Length=328

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P S  E EG   A   Q AWEKWSNDGTE+QVAKLME+++GAAMQFL
Sbjct  234  GGAGAVAQLVADVPPSSAEGEGVDGA---QAAWEKWSNDGTEQQVAKLMEQDIGAAMQFL  290

Query  538  QSKALCIMPISLASAIY--HSQAPDTTPLVKPETNPP  434
            QSKALCIMP+SLASAI+  H   PD   +VKPE NPP
Sbjct  291  QSKALCIMPVSLASAIFRSHPPPPDPPGIVKPEANPP  327



>ref|XP_004981425.1| PREDICTED: transcription factor UNE12-like [Setaria italica]
Length=283

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  190  GGAGAVAQLVADIPLSVKGE--ASDSGSKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  247

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VKPE N PS
Sbjct  248  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPNTPS  283



>ref|XP_009418924.1| PREDICTED: transcription factor UNE12-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=328

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE G TQ  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  235  GGAGAVAQLVADIPVSVEGET--SEGGSTQHIWEKWSTDGTERQVAKLMEEDIGAAMQFL  292

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LC+MPISLA AI  +     +  VKPE N PS
Sbjct  293  QSKSLCMMPISLAMAILDTHHQSESKTVKPEPNTPS  328



>ref|XP_002461549.1| hypothetical protein SORBIDRAFT_02g004570 [Sorghum bicolor]
 gb|EER98070.1| hypothetical protein SORBIDRAFT_02g004570 [Sorghum bicolor]
Length=277

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G TQ  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  183  GGAGAVAQLVADIPLSVKGE--ASDSGSTQHIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  240

Query  538  QSKALCIMPISLASAIYHSQ-APDTTPLVKPETN  440
            QSKALC+MPISLA AIY +Q + D   L+KPE N
Sbjct  241  QSKALCMMPISLAMAIYDTQHSQDGHSLMKPEPN  274



>gb|ACN21629.1| putative basic helix-loop-helix protein BHLH2 [Lotus japonicus]
 gb|AFK41432.1| unknown [Lotus japonicus]
Length=342

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE E   E G ++ AW KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  248  GGAGAVAQLVADVPLSAVEGED-IEGGASEQAWSKWSNDGTEQQVAKLMEEDVGAAMQFL  306

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLASAI+     + +  +KPE++
Sbjct  307  QSKALCIMPISLASAIFRMPQSEASTTIKPESD  339



>ref|XP_010936103.1| PREDICTED: transcription factor UNE12 isoform X2 [Elaeis guineensis]
Length=276

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  183  GGAGAVAQLVADIPLPV--EGEASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  240

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +        VKPE N
Sbjct  241  QSKALCMMPISLAMAIYDTHNQPEGHTVKPEPN  273



>ref|XP_011076653.1| PREDICTED: transcription factor UNE12-like [Sesamum indicum]
Length=304

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP+  VE+E G  +   Q  WEKWSN+ TER+VAKLMEE+VGAAMQ
Sbjct  209  RLGGAGAVAQLVADIPLQAVEDETGEISN--QHVWEKWSNEETEREVAKLMEEDVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            +LQSK+LCIMPISLAS IY S   D + LVKPE   PS
Sbjct  267  YLQSKSLCIMPISLASLIYPSNQSDDSTLVKPEPPAPS  304



>gb|KHN22077.1| Transcription factor UNE12 [Glycine soja]
Length=327

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV D+P+S VE +   E    + AW+KWSNDGTE+QVAKLMEE+VGAAMQFL
Sbjct  233  GGAGAVAQLVADVPLSAVEGDQDIEGVSNEQAWDKWSNDGTEQQVAKLMEEDVGAAMQFL  292

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALCIMPISLAS+I+     + +  +KPE+N
Sbjct  293  QSKALCIMPISLASSIFCMPQSEASTGIKPESN  325



>gb|EEE60096.1| hypothetical protein OsJ_12958 [Oryza sativa Japonica Group]
Length=294

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  201  GGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  258

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  259  QSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>ref|XP_010274209.1| PREDICTED: transcription factor UNE12 isoform X2 [Nelumbo nucifera]
Length=298

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 2/76 (3%)
 Frame = -2

Query  652  GSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAP  473
            GSE   +Q AWEKWSNDGTERQVAKLMEE+VGAAMQFLQSKALCIMP+SLA+AIYH+  P
Sbjct  223  GSEGRSSQRAWEKWSNDGTERQVAKLMEEDVGAAMQFLQSKALCIMPMSLAAAIYHTHPP  282

Query  472  D--TTPLVKPETNPPS  431
            +  TTP+VKPE++ PS
Sbjct  283  EAPTTPIVKPESSAPS  298



>ref|NP_001051563.1| Os03g0797600 [Oryza sativa Japonica Group]
 gb|AAP44685.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99356.1| Lipoamide dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13477.1| Os03g0797600 [Oryza sativa Japonica Group]
 dbj|BAG96659.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76334.1| hypothetical protein OsI_13903 [Oryza sativa Indica Group]
Length=294

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  201  GGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  258

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  259  QSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>ref|XP_010936096.1| PREDICTED: transcription factor UNE12 isoform X1 [Elaeis guineensis]
Length=310

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+ +  E   SE+GR Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  217  GGAGAVAQLVADIPLPVEGE--ASESGRKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  274

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +        VKPE N
Sbjct  275  QSKALCMMPISLAMAIYDTHNQPEGHTVKPEPN  307



>gb|ADX60279.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=294

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 72/96 (75%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  201  GGAGAVAQLVADIPLSVKGE--ASDSGGNQQIWEKWSTDGTERQVAKLMEEDIGAAMQFL  258

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +Q       VK E N PS
Sbjct  259  QSKALCMMPISLAMAIYDTQQTQDGQPVKHEPNTPS  294



>gb|ABB16991.1| unknown [Solanum tuberosum]
Length=304

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVA LV DIP+  VE + G E+   Q  W+KWSN  TER+VAKLMEE+VGAAMQ
Sbjct  208  RLGGASAVAQLVADIPLQSVEGDSG-ESRSNQHIWDKWSNVDTEREVAKLMEEDVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            +LQSK+LCIMPISLA+ IY +Q PD   LVKPE   PS
Sbjct  267  YLQSKSLCIMPISLAALIYPTQLPDDQSLVKPEAAAPS  304



>gb|EMS63234.1| Transcription factor UNE12 [Triticum urartu]
Length=189

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV+DIP+S+  E   S+ G  Q  WEKWS DGTE+QVAKLM+E++GAAMQFL
Sbjct  96   GGAGAVAQLVSDIPLSVKGE--ASDGGSKQQIWEKWSTDGTEKQVAKLMDEDIGAAMQFL  153

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MP+SLA AIY +Q       VKPE N
Sbjct  154  QSKALCMMPVSLAMAIYDTQHSQDGQPVKPEPN  186



>ref|XP_010228376.1| PREDICTED: transcription factor UNE12-like isoform X2 [Brachypodium 
distachyon]
Length=282

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   S++G  Q  WEKWS DGTERQVAKLM+E++GAAMQFL
Sbjct  189  GGAGAVAQLVADIPLSVKGE--ASDSGSNQQIWEKWSTDGTERQVAKLMDEDIGAAMQFL  246

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +Q       VKPE N
Sbjct  247  QSKALCMMPISLAMAIYDTQHSQDGQPVKPEPN  279



>ref|XP_008786085.1| PREDICTED: transcription factor UNE12-like isoform X2 [Phoenix 
dactylifera]
Length=310

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAAMQ L
Sbjct  217  GGAGAVAQLVADIPLSVEGE--ASESGSNQQVWEKWSTDGTERQVAKLMEEDIGAAMQLL  274

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +        VKPE N PS
Sbjct  275  QSKALCMMPISLAMAIYDTHDQPEGHAVKPEPNTPS  310



>ref|XP_008786084.1| PREDICTED: transcription factor UNE12-like isoform X1 [Phoenix 
dactylifera]
Length=321

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAAMQ L
Sbjct  228  GGAGAVAQLVADIPLSVEGE--ASESGSNQQVWEKWSTDGTERQVAKLMEEDIGAAMQLL  285

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSKALC+MPISLA AIY +        VKPE N PS
Sbjct  286  QSKALCMMPISLAMAIYDTHDQPEGHAVKPEPNTPS  321



>ref|XP_004247636.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
Length=304

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVA LV DIP+  VE + G E+   Q  W+KWSN  TER+VAKLMEE+VGAAMQ
Sbjct  208  RLGGASAVAQLVADIPLQSVEGDSG-ESRSNQHIWDKWSNVDTEREVAKLMEEDVGAAMQ  266

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            +LQSK+LCIMPISLA+ IY +Q PD   LVKPE   PS
Sbjct  267  YLQSKSLCIMPISLAALIYPTQQPDDQSLVKPEAAAPS  304



>ref|XP_010923486.1| PREDICTED: transcription factor UNE12-like isoform X2 [Elaeis 
guineensis]
Length=311

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  218  GGAGAVAQLVADIPLSVEGE--ASESGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  275

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +        VKPE N
Sbjct  276  QSKALCMMPISLAMAIYDTHHQPEGHTVKPEPN  308



>ref|XP_010923485.1| PREDICTED: transcription factor UNE12-like isoform X1 [Elaeis 
guineensis]
Length=322

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+S+  E   SE+G  Q  WEKWS DGTERQVAKLMEE++GAAMQFL
Sbjct  229  GGAGAVAQLVADIPLSVEGE--ASESGSKQQVWEKWSTDGTERQVAKLMEEDIGAAMQFL  286

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +        VKPE N
Sbjct  287  QSKALCMMPISLAMAIYDTHHQPEGHTVKPEPN  319



>gb|EMT27472.1| Transcription factor UNE12 [Aegilops tauschii]
Length=219

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV+DIP+S+  E   S+ G  Q  WEKWS DGTE+QVAKLM+E++GAAMQFL
Sbjct  126  GGAGAVAQLVSDIPLSVKGE--ASDGGSKQQIWEKWSTDGTEKQVAKLMDEDIGAAMQFL  183

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MP+SLA AIY +Q       VKPE N
Sbjct  184  QSKALCMMPVSLAMAIYDTQHSQDGQPVKPEPN  216



>ref|XP_003561348.1| PREDICTED: transcription factor UNE12-like isoform X1 [Brachypodium 
distachyon]
Length=288

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA L+ DIP+S+  EE     G+ Q  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  194  GGAGAVAQLIADIPLSVKGEEASDSGGKQQ-IWEKWSTDGTEKQVAKLMEEDIGAAMQFL  252

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +Q       +KPE N
Sbjct  253  QSKALCMMPISLAMAIYDTQHLQDGHSMKPEPN  285



>ref|XP_010553329.1| PREDICTED: transcription factor bHLH7-like [Tarenaya hassleriana]
Length=332

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G  GAVA LV D+P+  VE   G + G ++PAWE+WSNDGTE QVAKLMEE+VGAAMQ
Sbjct  234  RLGATGAVAQLVADVPLPSVE---GDDGGTSEPAWERWSNDGTEEQVAKLMEEDVGAAMQ  290

Query  544  FLQSKALCIMPISLASAIY--HSQ-APDTTPLV-KPETNPP  434
            FLQSKALCIMP+SLASAI+  H Q + D  P++ KPE N P
Sbjct  291  FLQSKALCIMPVSLASAIFSTHPQPSSDQPPMIPKPEMNNP  331



>gb|EPS57409.1| hypothetical protein M569_17409, partial [Genlisea aurea]
Length=286

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 74/107 (69%), Gaps = 18/107 (17%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEE--EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            + GGAGAVAPLVTDIPIS      EGG        AWEKWS+DGTERQVAKLMEENVGAA
Sbjct  187  RLGGAGAVAPLVTDIPISSSSSSIEGG--------AWEKWSSDGTERQVAKLMEENVGAA  238

Query  550  MQFLQSKALCIMPISLASAIYHSQAP--------DTTPLVKPETNPP  434
            MQ LQSKALCIMP+SLASAIYH             ++ +  PE NPP
Sbjct  239  MQLLQSKALCIMPVSLASAIYHHHHHAHPPPPPESSSSITNPEFNPP  285



>ref|NP_001274947.1| uncharacterized LOC102577469 [Solanum tuberosum]
 gb|AFW90609.1| basic helix-loop-helix protein BHLH3 [Solanum tuberosum]
Length=303

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVA LV DIP+  VE + G E+   Q  W+KWSN  TE++VAKLMEE+VGAAMQ+L
Sbjct  209  GGASAVAQLVADIPLQSVEGDSG-ESRSNQRIWDKWSNVDTEQEVAKLMEEDVGAAMQYL  267

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LCIMPISLA+ IY +Q PD   LVKPE   PS
Sbjct  268  QSKSLCIMPISLAALIYPTQQPDDQLLVKPEAAAPS  303



>ref|XP_010228286.1| PREDICTED: transcription factor UNE12-like isoform X2 [Brachypodium 
distachyon]
Length=286

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA L+ DIP+S    E  S++G  Q  WEKWS DGTE+QVAKLMEE++GAAMQFL
Sbjct  194  GGAGAVAQLIADIPLS---GEEASDSGGKQQIWEKWSTDGTEKQVAKLMEEDIGAAMQFL  250

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            QSKALC+MPISLA AIY +Q       +KPE N
Sbjct  251  QSKALCMMPISLAMAIYDTQHLQDGHSMKPEPN  283



>ref|XP_006356051.1| PREDICTED: transcription factor UNE12-like [Solanum tuberosum]
Length=119

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVA LV DIP+  VE +   E+   Q  WEKWS+  TE++VAKLMEE+VG AMQ+L
Sbjct  25   GGASAVAQLVADIPLQSVEGDS-CESRSNQHVWEKWSDSETEQEVAKLMEEDVGTAMQYL  83

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LCIMP+SLA+ IY +Q  D   +VKPE   PS
Sbjct  84   QSKSLCIMPVSLAALIYPTQQTDNQSMVKPEPTAPS  119



>ref|XP_009762993.1| PREDICTED: transcription factor UNE12-like [Nicotiana sylvestris]
Length=339

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVA LV DIP+  VE +  +E+   Q  WEKWSN  TE++VAKLMEE+VGAAMQ
Sbjct  243  RLGGASAVAQLVADIPLQSVEGDS-AESRSNQHIWEKWSNVDTEQEVAKLMEEDVGAAMQ  301

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            +LQSK+LCIMPISLA+ IY +Q PD   +VKPE   PS
Sbjct  302  YLQSKSLCIMPISLAALIYPTQQPDDLSMVKPEPAAPS  339



>emb|CDP20692.1| unnamed protein product [Coffea canephora]
Length=304

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGAGAVA LV DIP+  VE + G E    Q  WEKWSN+ TER+VAKLMEE+VGAAMQ+L
Sbjct  210  GGAGAVAQLVADIPLQTVEGDTG-ENITNQQVWEKWSNEETEREVAKLMEEDVGAAMQYL  268

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            QSK+LCIMPISLA+ IY +   +   LVKPE   PS
Sbjct  269  QSKSLCIMPISLAALIYPTLQSEEPALVKPEPPAPS  304



>gb|ACF82186.1| unknown [Zea mays]
 tpg|DAA59786.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=193

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 8/105 (8%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAG-----RTQPAWEKWSNDGTERQVAKLMEENV  560
            + GGAGAVA LV DIP+S V+ E G   G     + Q  WEKWS DGTE+QVAKLMEE++
Sbjct  90   RLGGAGAVAQLVADIPLS-VKGEAGDGGGAPQQQQQQHVWEKWSTDGTEKQVAKLMEEDI  148

Query  559  GAAMQFLQSKALCIMPISLASAIYHSQAP--DTTPLVKPETNPPS  431
            GAAMQFLQSKALC+MP+SLA AIY +Q P       +KPE N  S
Sbjct  149  GAAMQFLQSKALCMMPVSLAMAIYDTQHPLDGHGHSLKPEPNASS  193



>ref|XP_006838881.1| hypothetical protein AMTR_s00002p00267570 [Amborella trichopoda]
 gb|ERN01450.1| hypothetical protein AMTR_s00002p00267570 [Amborella trichopoda]
Length=307

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 8/101 (8%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGAGAVA LV DIP  L  +EG     + + AWE+WS +GTER+VAKLMEE+VGAAMQ
Sbjct  207  RMGGAGAVAQLVADIP--LPADEGDGSGCKEEQAWERWSTEGTEREVAKLMEEDVGAAMQ  264

Query  544  FLQSKALCIMPISLASAIYHSQAPDT------TPLVKPETN  440
            FLQSKALC+MPI+LAS +YH++   T      T   KPE N
Sbjct  265  FLQSKALCLMPIALASTLYHTRQGSTSSSDGPTSRAKPEPN  305



>ref|XP_009612697.1| PREDICTED: transcription factor UNE12-like [Nicotiana tomentosiformis]
Length=339

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVA LV DIP+  VE +  +E+   Q  WEKWSN  TE++VAKLMEE+VGAAMQ
Sbjct  243  RLGGASAVAQLVADIPLQSVEGDS-AESRSNQHIWEKWSNVDTEQEVAKLMEEDVGAAMQ  301

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            +LQSK+LCIMPISLA+ IY +Q  D   +VKPE   PS
Sbjct  302  YLQSKSLCIMPISLAALIYPTQQLDDPSMVKPEPAAPS  339



>ref|XP_010553760.1| PREDICTED: transcription factor bHLH7-like isoform X2 [Tarenaya 
hassleriana]
Length=310

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 70/98 (71%), Gaps = 6/98 (6%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + G  GAVA LV  +P+S V+   G + G ++P WEKW+ DGTE QVAKLMEE VGAAMQ
Sbjct  213  RLGATGAVAQLVAGVPLSSVK---GDDGGASEPMWEKWTGDGTEEQVAKLMEEEVGAAMQ  269

Query  544  FLQSKALCIMPISLASAIY--HSQAPDTTPLV-KPETN  440
            FLQSK LCIMPISLAS I+  H +  D  P++ KPE N
Sbjct  270  FLQSKELCIMPISLASTIFNTHLRPSDQQPMIPKPEMN  307



>ref|XP_010553759.1| PREDICTED: transcription factor bHLH7-like isoform X1 [Tarenaya 
hassleriana]
Length=311

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 6/96 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            G  GAVA LV  +P+S V+   G + G ++P WEKW+ DGTE QVAKLMEE VGAAMQFL
Sbjct  216  GATGAVAQLVAGVPLSSVK---GDDGGASEPMWEKWTGDGTEEQVAKLMEEEVGAAMQFL  272

Query  538  QSKALCIMPISLASAIY--HSQAPDTTPLV-KPETN  440
            QSK LCIMPISLAS I+  H +  D  P++ KPE N
Sbjct  273  QSKELCIMPISLASTIFNTHLRPSDQQPMIPKPEMN  308



>ref|NP_001140213.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83346.1| unknown [Zea mays]
 gb|ACG37964.1| BHLH transcription factor [Zea mays]
 tpg|DAA59787.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05977.1| bHLH transcription factor, partial [Zea mays]
Length=285

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 72/100 (72%), Gaps = 8/100 (8%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAG-----RTQPAWEKWSNDGTERQVAKLMEENVGA  554
            GGAGAVA LV DIP+S V+ E G   G     + Q  WEKWS DGTE+QVAKLMEE++GA
Sbjct  184  GGAGAVAQLVADIPLS-VKGEAGDGGGAPQQQQQQHVWEKWSTDGTEKQVAKLMEEDIGA  242

Query  553  AMQFLQSKALCIMPISLASAIYHSQAP--DTTPLVKPETN  440
            AMQFLQSKALC+MP+SLA AIY +Q P       +KPE N
Sbjct  243  AMQFLQSKALCMMPVSLAMAIYDTQHPLDGHGHSLKPEPN  282



>gb|AFW90608.1| beta-fructofuranosidase protein [Solanum tuberosum]
Length=298

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GG  AVA LVTDIP+  VE +   E+   Q  WEKWS+  TE++VAKLM E+VG AMQ+L
Sbjct  202  GGTSAVAQLVTDIPLQSVEGDS-CESRSNQHVWEKWSDSETEQEVAKLMGEDVGTAMQYL  260

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            QSK+LCIMP+SLA+ IY +Q  D   +VKP+  P
Sbjct  261  QSKSLCIMPVSLAALIYPTQQTDDQSMVKPDYGP  294



>ref|XP_004234028.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
 ref|XP_010317400.1| PREDICTED: transcription factor UNE12-like [Solanum lycopersicum]
Length=296

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GG  A A +V DIP+  VE +   E+   Q  WEKWS+  TE++VAKLMEE+VG AMQ+L
Sbjct  202  GGTSAAAQVVADIPLQSVEGDT-CESHSNQRVWEKWSDSETEQEVAKLMEEDVGTAMQYL  260

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            QSK+LCIMPISLA+ IY +Q  D   +VKPE   P
Sbjct  261  QSKSLCIMPISLAALIYPTQQSDNQSMVKPEQAAP  295



>ref|XP_009800017.1| PREDICTED: transcription factor UNE12-like, partial [Nicotiana 
sylvestris]
Length=231

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -2

Query  694  LVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIM  515
            L+ D+ IS +      E+   Q  WEKWSN  TE +VAKLMEE+VGAAMQ+LQSK+LCIM
Sbjct  144  LLQDLFISSISMGDSGESRSNQHVWEKWSNVETEEEVAKLMEEDVGAAMQYLQSKSLCIM  203

Query  514  PISLASAIYHSQAPDTTPLVKPETN  440
            PISLA  IY +Q  D   +VKPE++
Sbjct  204  PISLAILIYPTQQTDNQSVVKPESS  228



>ref|XP_009793513.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104240369 
[Nicotiana sylvestris]
Length=415

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 67/99 (68%), Gaps = 3/99 (3%)
 Frame = -2

Query  724  QXGGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQ  545
            + GGA AVA LV DIP+  VE + G E+   Q  W       T ++VAKLMEE+VGAAMQ
Sbjct  295  RLGGASAVAQLVADIPLHSVEGDSG-ESRSNQHVWTSGPMP-TXQEVAKLMEEDVGAAMQ  352

Query  544  FLQSKALCIMPISLASAIYHSQAPDTTPLVKPE-TNPPS  431
            +LQSK+LCIMPISLA+ IY +Q  D   +VKPE   PPS
Sbjct  353  YLQSKSLCIMPISLAALIYPTQQTDDQSVVKPEPAAPPS  391



>ref|XP_010917608.1| PREDICTED: transcription factor UNE12-like [Elaeis guineensis]
Length=135

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = -2

Query  685  DIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPIS  506
            DIP+S VE+   SE G  +P WE+WSN+G + QV KLME +V +AM+FLQS+ALCI+PIS
Sbjct  54   DIPLSSVEK--ISEGGGRKPVWERWSNNGMDEQVVKLME-DVESAMRFLQSEALCIIPIS  110

Query  505  LASAIYHSQAPDTTPLVKPETNPPS  431
            + + I+     +  P  KPE N PS
Sbjct  111  INTTIHQFCHQNEIPAAKPEPNAPS  135



>ref|XP_010265624.1| PREDICTED: transcription factor bHLH66-like [Nelumbo nucifera]
Length=505

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPIS----LVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            GGA AVAPLV DI        V+  GG  A   Q A    S   TE+QVAKLMEE++G+A
Sbjct  367  GGAAAVAPLVADISSDGGGDCVQASGGRSANGAQTASSNDSLTATEQQVAKLMEEDMGSA  426

Query  550  MQFLQSKALCIMPISLASAIY-----HSQAPDTTP--LVKPETNPP  434
            MQ+LQ K LC+MPISLA+AI      HS+ P+ T   LV P  + P
Sbjct  427  MQYLQGKGLCLMPISLATAISTATTCHSRNPNHTHHRLVSPNVDVP  472



>ref|XP_011084002.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH69-like 
[Sesamum indicum]
Length=388

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 16/109 (15%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG-----TERQVAKLMEENVGA  554
            GGA AVAPLV D+       EG S  G  Q A    + DG     TE QVAKLMEE++G+
Sbjct  265  GGAAAVAPLVADM-----SSEGRSGNGTAQTASTSNTKDGGGMTVTEHQVAKLMEEDMGS  319

Query  553  AMQFLQSKALCIMPISLASAI----YHSQAPDTTPLVKPETNPPS*ILT  419
            AMQ+LQ K LC+MPISLA+AI     HS+ P       P T+P   +LT
Sbjct  320  AMQYLQGKGLCLMPISLATAISTATSHSRKPPAA--SNPPTSPSMSVLT  366



>ref|XP_004507723.1| PREDICTED: transcription factor bHLH66-like [Cicer arietinum]
Length=400

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 4/92 (4%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEE----EGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            GGAGAVAPLV D+   +V +     G        P     S   TE+QVAKLMEE++G+A
Sbjct  269  GGAGAVAPLVADMSSEVVSDCVQANGNPRNSTGNPKTANESLTMTEQQVAKLMEEDMGSA  328

Query  550  MQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            MQ+LQ K LC+MPISLA+AI  +   +  PL+
Sbjct  329  MQYLQGKGLCLMPISLATAISTATCHNRNPLM  360



>ref|XP_010275766.1| PREDICTED: transcription factor bHLH66 [Nelumbo nucifera]
Length=507

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 60/106 (57%), Gaps = 10/106 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPIS----LVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAA  551
            GGA AVAPLV DI        ++  GG      Q A    S   TE QVAKLMEE++G+A
Sbjct  370  GGAAAVAPLVADISSDGGGDCIQASGGRSGNGNQTASSNDSLTMTEHQVAKLMEEDMGSA  429

Query  550  MQFLQSKALCIMPISLASAIY----HSQAPD--TTPLVKPETNPPS  431
            MQ+LQ K LC+MPISLA+AI     H++ P     PL+      PS
Sbjct  430  MQYLQGKGLCLMPISLATAISTATCHTRNPTNGNNPLLSSNAEGPS  475



>ref|XP_009358465.1| PREDICTED: transcription factor bHLH66-like [Pyrus x bretschneideri]
Length=469

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 62/111 (56%), Gaps = 21/111 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGA AVAPLV D+       EGG +           GR+    +    SND     TE Q
Sbjct  321  GGAAAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  375

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            VAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL++   N P
Sbjct  376  VAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLLQNSNNNP  426



>ref|XP_008367760.1| PREDICTED: transcription factor bHLH66-like [Malus domestica]
Length=472

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 62/111 (56%), Gaps = 21/111 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGA AVAPLV D+       EGG +           GR+    +    SND     TE Q
Sbjct  324  GGAAAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  378

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPP  434
            VAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL++   N P
Sbjct  379  VAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLLQNSNNNP  429



>ref|XP_009366166.1| PREDICTED: transcription factor bHLH66-like [Pyrus x bretschneideri]
Length=468

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 62/109 (57%), Gaps = 21/109 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGAGAVAPLV D+       EGG +           GR+    +    SND     TE Q
Sbjct  319  GGAGAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  373

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            VAKLM+E++G+AMQ+LQ K LC+MPISLA+AI  +      PL+   +N
Sbjct  374  VAKLMKEDMGSAMQYLQGKGLCLMPISLATAISSATCHSRNPLLHNNSN  422



>ref|XP_004287121.1| PREDICTED: transcription factor bHLH66-like [Fragaria vesca subsp. 
vesca]
Length=459

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPIS------LVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVG  557
            GGAGAVAPLV D+              GG+     Q A    S   TE QVAKLMEE++G
Sbjct  311  GGAGAVAPLVADMSSEGGGDCIQTSGNGGTRGRSNQTASSNDSMTVTEHQVAKLMEEDMG  370

Query  556  AAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            +AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  371  SAMQYLQGKGLCLMPISLATAISTATCHTRNPL  403



>gb|KHG24512.1| Transcription factor bHLH66 -like protein [Gossypium arboreum]
Length=485

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 58/98 (59%), Gaps = 9/98 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIP------ISLVEEEGGS---EAGRTQPAWEKWSNDGTERQVAKLMEE  566
            GGA AVAPLV D+P      +      GGS    +   QP+    S   TE QVAKLMEE
Sbjct  338  GGAAAVAPLVADMPSEGGDCVQTTAGGGGSLQRNSNGNQPSANNDSLTETEHQVAKLMEE  397

Query  565  NVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            ++G+AMQ+LQ K LC+MPISLA+AI  +      P++ 
Sbjct  398  DMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPMIN  435



>ref|XP_007011960.1| LJRHL1-like 1 [Theobroma cacao]
 gb|EOY29579.1| LJRHL1-like 1 [Theobroma cacao]
Length=469

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPIS------LVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEE  566
            GGA AVAPLV D+P             GGS    +       SND    TE+QVAKLMEE
Sbjct  319  GGAAAVAPLVADMPSEGGGDCIQTSANGGSLPRNSNGNQTSSSNDSLTVTEQQVAKLMEE  378

Query  565  NVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            ++G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  379  DMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPMI  415



>gb|KJB54936.1| hypothetical protein B456_009G055200 [Gossypium raimondii]
Length=450

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 13/95 (14%)
 Frame = -2

Query  718  GGAGAVAPLVTDIP------ISLVEEEGGS---EAGRTQPAWEKWSNDGTERQVAKLMEE  566
            GGA AVAPLV D+P      +      GGS    +   QP+    S   TE QVAKLMEE
Sbjct  303  GGAAAVAPLVADMPPEGGDCVQTTAGGGGSLQRNSNGNQPSANNDSLTVTEHQVAKLMEE  362

Query  565  NVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            ++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  363  DMGSAMQYLQGKGLCLMPISLATAISTATCHSRNP  397



>ref|XP_008242964.1| PREDICTED: transcription factor bHLH66-like [Prunus mume]
Length=485

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 60/109 (55%), Gaps = 21/109 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGA AVAPLV D     V  EGG +           GR+    +    SND     TE Q
Sbjct  335  GGAAAVAPLVAD-----VSSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  389

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            VAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL+    N
Sbjct  390  VAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPLIHNNHN  438



>ref|XP_006343666.1| PREDICTED: transcription factor bHLH66-like [Solanum tuberosum]
Length=444

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG-----TERQVAKLMEENVGA  554
            GGA AVAPLV D+     E  G    GR        S++      TE QVAKLMEE++G+
Sbjct  325  GGAAAVAPLVADMS---SEGRGEGNVGRGGNGTAASSSNSETMTVTEHQVAKLMEEDMGS  381

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS  431
            AMQ+LQ K LC+MPISLA+AI  S      PL+ PE   P+
Sbjct  382  AMQYLQGKGLCLMPISLATAISTST---RIPLLSPEATSPT  419



>ref|XP_009394940.1| PREDICTED: transcription factor bHLH82-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=440

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAPLV D+   + +   G +      A    S   TE QVAK+MEE++G+AMQ+L
Sbjct  306  GGAAAVAPLVADMASEVGQSGAGRDGANGGAAGSSDSLTVTEHQVAKMMEEDMGSAMQYL  365

Query  538  QSKALCIMPISLASAIY--------HSQAPDTTPLVKPETNPPS  431
            Q K LC+MPISLASAI         H   P   P   P  + PS
Sbjct  366  QGKGLCLMPISLASAISSATAGHLGHGLVPGVLPPPNPSGDAPS  409



>ref|XP_003610348.1| Transcription factor bHLH66 [Medicago truncatula]
 gb|AES92545.1| BHLH transcription factor [Medicago truncatula]
Length=400

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPI----SLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            GGAGAVAPLV D+        V+  G        P     SN+    TE QVAKLMEE++
Sbjct  264  GGAGAVAPLVADMSSEGVSDCVQTNGNGGVHPRNPKTASSSNESLTMTEHQVAKLMEEDM  323

Query  559  GAAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            G+AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  324  GSAMQYLQGKGLCLMPISLATAISTATCHTRNPL  357



>ref|XP_007154897.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
 gb|ESW26891.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
Length=396

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 13/95 (14%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW---SNDG---TERQVAKLMEENVG  557
            GGA AVAPLV DI       EGG +    QP        SND    TE+QVAKLMEE++G
Sbjct  276  GGAAAVAPLVADI-----SSEGGGDC--VQPKSNNANGNSNDTLATTEQQVAKLMEEDMG  328

Query  556  AAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            +AMQ+LQ K LC+MPISLA+AI  +      P + 
Sbjct  329  SAMQYLQGKGLCLMPISLATAISKATCHARNPFIN  363



>ref|XP_003610347.1| Transcription factor bHLH66 [Medicago truncatula]
 gb|AES92544.1| BHLH transcription factor [Medicago truncatula]
Length=403

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPI----SLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENV  560
            GGAGAVAPLV D+        V+  G        P     SN+    TE QVAKLMEE++
Sbjct  267  GGAGAVAPLVADMSSEGVSDCVQTNGNGGVHPRNPKTASSSNESLTMTEHQVAKLMEEDM  326

Query  559  GAAMQFLQSKALCIMPISLASAIYHSQAPDTTPL  458
            G+AMQ+LQ K LC+MPISLA+AI  +      PL
Sbjct  327  GSAMQYLQGKGLCLMPISLATAISTATCHTRNPL  360



>ref|XP_007154896.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
 gb|ESW26890.1| hypothetical protein PHAVU_003G157100g [Phaseolus vulgaris]
Length=388

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 13/95 (14%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKW---SNDG---TERQVAKLMEENVG  557
            GGA AVAPLV DI       EGG +    QP        SND    TE+QVAKLMEE++G
Sbjct  268  GGAAAVAPLVADI-----SSEGGGDC--VQPKSNNANGNSNDTLATTEQQVAKLMEEDMG  320

Query  556  AAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            +AMQ+LQ K LC+MPISLA+AI  +      P + 
Sbjct  321  SAMQYLQGKGLCLMPISLATAISKATCHARNPFIN  355



>ref|XP_006857186.1| hypothetical protein AMTR_s00065p00184910 [Amborella trichopoda]
 gb|ERN18653.1| hypothetical protein AMTR_s00065p00184910 [Amborella trichopoda]
Length=473

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 58/97 (60%), Gaps = 18/97 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA------GRTQPAWEKWSNDG---TERQVAKLMEE  566
            GGA AVAPLV DI       EGG +       GR     +  + D    TE QVAKLMEE
Sbjct  339  GGAAAVAPLVADI-----SSEGGGDCIQANGIGRNASGGQTPTQDSLTVTEHQVAKLMEE  393

Query  565  NVGAAMQFLQSKALCIMPISLASAIY----HSQAPDT  467
            ++G+AMQ+LQ K LC+MPISLASAI     H++ P +
Sbjct  394  DMGSAMQYLQGKGLCLMPISLASAISSATCHTRNPSS  430



>ref|XP_009795099.1| PREDICTED: transcription factor bHLH66-like [Nicotiana sylvestris]
Length=387

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPI------SLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVG  557
            GGA AVAPLV D         S     GG  + RT       S   TE QVAKLMEE++G
Sbjct  253  GGAAAVAPLVADRSSEGGGGDSAQANGGGRGSNRTTSLANNDSMTMTEHQVAKLMEEDMG  312

Query  556  AAMQFLQSKALCIMPISLASAIY----HSQAPDTTPLV  455
            +AMQ+LQ K LC+MPISLA+AI     HS  P+  PL+
Sbjct  313  SAMQYLQGKGLCLMPISLATAISTATCHSMKPN-NPLL  349



>ref|NP_001141950.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACN26773.1| unknown [Zea mays]
 tpg|DAA40065.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05429.1| bHLH transcription factor, partial [Zea mays]
Length=470

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 13/79 (16%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGAAM  548
            GGA AVAPLV D+          S  GR   A    S+DG   TE+QVAKLMEE++G AM
Sbjct  307  GGAAAVAPLVADM----------SSEGRGGVAVAAGSDDGLAVTEQQVAKLMEEDMGTAM  356

Query  547  QFLQSKALCIMPISLASAI  491
            Q+LQ K LC+MP+SLASAI
Sbjct  357  QYLQGKGLCLMPVSLASAI  375



>ref|XP_008667581.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 tpg|DAA40064.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=471

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 13/79 (16%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGAAM  548
            GGA AVAPLV D+          S  GR   A    S+DG   TE+QVAKLMEE++G AM
Sbjct  308  GGAAAVAPLVADM----------SSEGRGGVAVAAGSDDGLAVTEQQVAKLMEEDMGTAM  357

Query  547  QFLQSKALCIMPISLASAI  491
            Q+LQ K LC+MP+SLASAI
Sbjct  358  QYLQGKGLCLMPVSLASAI  376



>ref|XP_007204332.1| hypothetical protein PRUPE_ppa005254mg [Prunus persica]
 gb|EMJ05531.1| hypothetical protein PRUPE_ppa005254mg [Prunus persica]
Length=470

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 59/105 (56%), Gaps = 21/105 (20%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGA AVAPLV D     V  EGG +           GR+    +    SND     TE Q
Sbjct  316  GGAAAVAPLVAD-----VSSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  370

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVK  452
            VAKLMEE++G+AMQ+LQ K LC+MPISLA+AI  +      PL+ 
Sbjct  371  VAKLMEEDMGSAMQYLQGKGLCLMPISLATAISTATCHTRNPLIH  415



>ref|XP_010929149.1| PREDICTED: uncharacterized protein LOC105050721 isoform X1 [Elaeis 
guineensis]
Length=514

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAP+V+D+P   +  +G S       A    S   TE QVAKLMEE++G+AMQ+L
Sbjct  353  GGAAAVAPVVSDMPSERLAVQGQSGRSGINGAAGNDSLTVTEHQVAKLMEEDMGSAMQYL  412

Query  538  QSKALCIMPISLASAI  491
            Q K LC+MPISLASAI
Sbjct  413  QGKGLCLMPISLASAI  428



>ref|XP_004251756.1| PREDICTED: transcription factor bHLH66-like [Solanum lycopersicum]
Length=387

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 58/103 (56%), Gaps = 21/103 (20%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA-----------GRTQPAWEKWSNDGTERQVAKLM  572
            GGA AVAPLV D        EGG +            G T  A    S   TE QVAKLM
Sbjct  254  GGAAAVAPLVAD-----RSSEGGGDCVQGNVGRGGSNGTTSSANNDSSMTMTEHQVAKLM  308

Query  571  EENVGAAMQFLQSKALCIMPISLASAIY----HSQAPDTTPLV  455
            EE++G+AMQ+LQ K LC+MPISLA+AI     HS  P+  PL+
Sbjct  309  EEDMGSAMQYLQGKGLCLMPISLATAISTSTCHSMKPN-NPLL  350



>ref|XP_009394942.1| PREDICTED: transcription factor bHLH82-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=439

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 60/108 (56%), Gaps = 17/108 (16%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQP-AWEKWSNDG---TERQVAKLMEENVGAA  551
            GGA AVAPLV D+       EG S AGR         S+D    TE QVAK+MEE++G+A
Sbjct  306  GGAAAVAPLVADM-----ASEGQSGAGRDGANGGAAGSSDSLTVTEHQVAKMMEEDMGSA  360

Query  550  MQFLQSKALCIMPISLASAIY--------HSQAPDTTPLVKPETNPPS  431
            MQ+LQ K LC+MPISLASAI         H   P   P   P  + PS
Sbjct  361  MQYLQGKGLCLMPISLASAISSATAGHLGHGLVPGVLPPPNPSGDAPS  408



>gb|KJB65757.1| hypothetical protein B456_010G112200 [Gossypium raimondii]
Length=447

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEE--EGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGA  554
            GGA AVAPLV++     ++    GGS    +       +ND    TE QVAKLMEE++G+
Sbjct  304  GGAAAVAPLVSEGGGDCIQTSANGGSHPRNSNGDQTPSANDRLTMTEHQVAKLMEEDMGS  363

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            AMQ+LQ K LC+MPISLA+AI  + +    P++  E NP
Sbjct  364  AMQYLQEKGLCLMPISLATAISSATSRSRNPMINHE-NP  401



>ref|XP_008343903.1| PREDICTED: transcription factor bHLH66-like [Malus domestica]
Length=478

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 61/109 (56%), Gaps = 21/109 (19%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWE--KWSNDG----TERQ  587
            GGA AVAPLV D+       EGG +           GR+    +    SND     TE Q
Sbjct  329  GGAAAVAPLVADM-----SSEGGGDCIQASANGGTRGRSSNGNQTASSSNDNSMTVTEHQ  383

Query  586  VAKLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETN  440
            VAKLME+++G+AMQ+LQ K LC+MPISLA+AI  +      PL+   +N
Sbjct  384  VAKLMEKDMGSAMQYLQGKGLCLMPISLATAISTATCHSRNPLLHNNSN  432



>gb|KJB65759.1| hypothetical protein B456_010G112200 [Gossypium raimondii]
Length=469

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEE--EGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGA  554
            GGA AVAPLV++     ++    GGS    +       +ND    TE QVAKLMEE++G+
Sbjct  326  GGAAAVAPLVSEGGGDCIQTSANGGSHPRNSNGDQTPSANDRLTMTEHQVAKLMEEDMGS  385

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            AMQ+LQ K LC+MPISLA+AI  + +    P++  E NP
Sbjct  386  AMQYLQEKGLCLMPISLATAISSATSRSRNPMINHE-NP  423



>emb|CAN75431.1| hypothetical protein VITISV_021146 [Vitis vinifera]
Length=486

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 58/101 (57%), Gaps = 24/101 (24%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSE-----------AGR-TQPAWEKWSNDG---TERQV  584
            GGA AVAPLV D+       EGG +            GR T       SND    TE QV
Sbjct  328  GGAAAVAPLVADM-----SSEGGGDCIQASGTSGPTGGRATNGTQTXTSNDSLTVTEHQV  382

Query  583  AKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            AKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  383  AKLMEEDMGSAMQYLQGKGLCLMPISLATAISTTTCHSRNP  423



>ref|XP_002308393.2| hypothetical protein POPTR_0006s20070g [Populus trichocarpa]
 gb|EEE91916.2| hypothetical protein POPTR_0006s20070g [Populus trichocarpa]
Length=448

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 58/104 (56%), Gaps = 10/104 (10%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL------VEEEGGSEAGRTQPAWEKWSNDG----TERQVAKLME  569
            GGA AVAPLV D+              GGS A  T       +ND     TE QVAKLME
Sbjct  307  GGAAAVAPLVADMSSEAGGDCIQANANGGSIARTTNGNQTASTNDSSLTVTEHQVAKLME  366

Query  568  ENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            E++G+AMQ+LQ K LC+MPISLA+AI  +   + T  +    NP
Sbjct  367  EDMGSAMQYLQGKGLCLMPISLATAISTATCHNRTSGIINSHNP  410



>gb|KHG27662.1| Transcription factor bHLH66 -like protein [Gossypium arboreum]
Length=428

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 6/99 (6%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEE--EGGSEAGRTQPAWEKWSNDG---TERQVAKLMEENVGA  554
            GGA AVAPLV++     ++    GGS    +       +ND    TE QVAKLMEE++G+
Sbjct  284  GGAAAVAPLVSEGGGDCIQTSANGGSHPRNSNGDQTPSANDRLTMTEHQVAKLMEEDMGS  343

Query  553  AMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            AMQ+LQ K LC+MPISLA+AI  + +    P++  E NP
Sbjct  344  AMQYLQGKGLCLMPISLATAISTATSRSRNPMINHE-NP  381



>ref|XP_010656597.1| PREDICTED: transcription factor UNE12-like isoform X2 [Vitis 
vinifera]
Length=506

 Score = 74.3 bits (181),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 58/101 (57%), Gaps = 24/101 (24%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSE-----------AGR-TQPAWEKWSNDG---TERQV  584
            GGA AVAPLV D+       EGG +            GR T       SND    TE QV
Sbjct  348  GGAAAVAPLVADM-----SSEGGGDCIQASGTSGPTGGRATNGTQTTTSNDSLTVTEHQV  402

Query  583  AKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            AKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  403  AKLMEEDMGSAMQYLQGKGLCLMPISLATAISTTTCHSRNP  443


 Score = 23.5 bits (49),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  756  LRLXVKVLSMSRXG  715
            L+L VKVLSMSR G
Sbjct  335  LQLQVKVLSMSRLG  348



>ref|XP_010656596.1| PREDICTED: uncharacterized protein LOC100243222 isoform X1 [Vitis 
vinifera]
Length=511

 Score = 74.3 bits (181),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 58/101 (57%), Gaps = 24/101 (24%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSE-----------AGR-TQPAWEKWSNDG---TERQV  584
            GGA AVAPLV D+       EGG +            GR T       SND    TE QV
Sbjct  353  GGAAAVAPLVADM-----SSEGGGDCIQASGTSGPTGGRATNGTQTTTSNDSLTVTEHQV  407

Query  583  AKLMEENVGAAMQFLQSKALCIMPISLASAIY----HSQAP  473
            AKLMEE++G+AMQ+LQ K LC+MPISLA+AI     HS+ P
Sbjct  408  AKLMEEDMGSAMQYLQGKGLCLMPISLATAISTTTCHSRNP  448


 Score = 23.5 bits (49),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  756  LRLXVKVLSMSRXG  715
            L+L VKVLSMSR G
Sbjct  340  LQLQVKVLSMSRLG  353



>gb|KJB65758.1| hypothetical protein B456_010G112200 [Gossypium raimondii]
Length=478

 Score = 74.3 bits (181),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 15/108 (14%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGG------SEAGRTQPAWEKW-----SNDG---TERQVA  581
            GGA AVAPLV+++   L   +GG      S  G + P          +ND    TE QVA
Sbjct  326  GGAAAVAPLVSELYDFLFLLKGGGDCIQTSANGGSHPRNSNGDQTPSANDRLTMTEHQVA  385

Query  580  KLMEENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNP  437
            KLMEE++G+AMQ+LQ K LC+MPISLA+AI  + +    P++  E NP
Sbjct  386  KLMEEDMGSAMQYLQEKGLCLMPISLATAISSATSRSRNPMINHE-NP  432


 Score = 23.5 bits (49),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  756  LRLXVKVLSMSRXG  715
            L+L VKVLSMSR G
Sbjct  313  LQLQVKVLSMSRLG  326



>ref|XP_002325140.2| hypothetical protein POPTR_0018s11800g [Populus trichocarpa]
 gb|EEF03705.2| hypothetical protein POPTR_0018s11800g [Populus trichocarpa]
Length=455

 Score = 74.3 bits (181),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 12/118 (10%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL------VEEEGGSEAGRTQPAWEKWSNDG----TERQVAKLME  569
            GGA AVAPLV D+             +GGS +  +       +ND     TE QVAKLME
Sbjct  309  GGAAAVAPLVADMSSEAGGDCIQASADGGSLSRTSNGNQTARTNDSSLTVTEHQVAKLME  368

Query  568  ENVGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLVKPETNPPS*ILTNKRCPGCP  395
            E++G+AMQ+LQ K LC+MPISLA+AI  +   + +P +    N  + + +N   P  P
Sbjct  369  EDMGSAMQYLQGKGLCLMPISLATAISTATCHNRSPAIN--NNHHALLQSNGEGPASP  424


 Score = 23.5 bits (49),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -3

Query  756  LRLXVKVLSMSRXG  715
            L+L VKVLSMSR G
Sbjct  296  LQLQVKVLSMSRLG  309



>ref|XP_010942107.1| PREDICTED: transcription factor bHLH66-like [Elaeis guineensis]
Length=512

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAPLV D+       EG S  G +  A    S   TE QVAKLMEE++G+AMQ+L
Sbjct  353  GGAAAVAPLVADM-----SSEGQSGRGGSNGAAGNDSLTVTEHQVAKLMEEDMGSAMQYL  407

Query  538  QSKALCIMPISLASAI  491
            Q K LC+MPISLASAI
Sbjct  408  QGKGLCLMPISLASAI  423



>ref|XP_006473971.1| PREDICTED: transcription factor bHLH66-like [Citrus sinensis]
Length=469

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 12/96 (13%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----GRT-QPAWEKWSNDG---TERQVAKLMEEN  563
            GGA AVAPLV D    +  E GG +     GR    A    +ND    TE QVAKLMEE+
Sbjct  320  GGAAAVAPLVAD----MSSEGGGGDCIQANGRNPNGAQTTSANDSLTVTEHQVAKLMEED  375

Query  562  VGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            +G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  376  MGSAMQYLQGKGLCLMPISLATAISTATCHSRNPII  411



>ref|XP_008799645.1| PREDICTED: transcription factor bHLH66 [Phoenix dactylifera]
Length=505

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 5/76 (7%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA AVAPLV D+       EG S  G +  A    S   TE QVAKLMEE++G+AMQ+L
Sbjct  346  GGAAAVAPLVADM-----SSEGQSGRGGSNGAAGNDSLTVTEHQVAKLMEEDMGSAMQYL  400

Query  538  QSKALCIMPISLASAI  491
            Q K LC+MPISLASAI
Sbjct  401  QGKGLCLMPISLASAI  416



>gb|KDP38664.1| hypothetical protein JCGZ_04017 [Jatropha curcas]
Length=461

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 54/89 (61%), Gaps = 18/89 (20%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----------GRTQPAWEKWSND---GTERQVAK  578
            GGA AVAPLV DI       EGG +            R+  A  +  ND   G E QVAK
Sbjct  302  GGAAAVAPLVADI-----SSEGGGDCIQATANGGSLPRSSNAGSQTPNDSLTGAEHQVAK  356

Query  577  LMEENVGAAMQFLQSKALCIMPISLASAI  491
            LMEE++G+AMQ+LQ K LC+MPISLA+AI
Sbjct  357  LMEEDMGSAMQYLQGKGLCLMPISLATAI  385



>emb|CDY46132.1| BnaA04g14200D [Brassica napus]
Length=176

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 12/71 (17%)
 Frame = -2

Query  673  SLVEEEGGSE-------AGRTQPAWEKWSNDG---TERQVAKLMEENVGAAMQFLQSKAL  524
            S + E GGS        AG  QP     SNDG   TE QVAKLMEE++G+AMQ+LQ K L
Sbjct  43   SQISEAGGSHESASSAVAGGNQPTGN--SNDGLTMTEHQVAKLMEEDMGSAMQYLQGKGL  100

Query  523  CIMPISLASAI  491
            C+MPISLA+AI
Sbjct  101  CLMPISLATAI  111



>ref|XP_011033445.1| PREDICTED: transcription factor bHLH66-like [Populus euphratica]
Length=453

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 10/86 (12%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISL------VEEEGGSEAGRTQPAWEKWSNDG----TERQVAKLME  569
            GGA AVAPLV D+              GGS A  T  +    +ND     TE QVAKLME
Sbjct  308  GGAAAVAPLVADMSSEAGGDCIQANANGGSIARTTNGSQTASTNDSSLTVTEHQVAKLME  367

Query  568  ENVGAAMQFLQSKALCIMPISLASAI  491
            E++G+AMQ+LQ K LC+MPISLA+AI
Sbjct  368  EDMGSAMQYLQGKGLCLMPISLATAI  393



>ref|XP_010438099.1| PREDICTED: transcription factor bHLH69 isoform X1 [Camelina sativa]
 ref|XP_010438100.1| PREDICTED: transcription factor bHLH69 isoform X2 [Camelina sativa]
Length=313

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA +V+        S + E+ G     T  + E  +   TE QVAKLMEE++G+AMQ+L
Sbjct  198  GGAASVS--------SQISEDAGGSHENTSSSGENQTAKMTEHQVAKLMEEDMGSAMQYL  249

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVK  452
            Q K LC+MPISLA+ I  +  P   P VK
Sbjct  250  QGKGLCLMPISLATTISTATCPSRNPFVK  278



>ref|XP_010432917.1| PREDICTED: transcription factor bHLH69-like [Camelina sativa]
Length=310

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEAGRTQPAWEKWSNDGTERQVAKLMEENVGAAMQFL  539
            GGA +V+        S + E+ G     T  + E  +   TE QVAKLMEE++G+AMQ+L
Sbjct  195  GGAASVS--------SQISEDAGGSHENTSSSGENQTAKMTEHQVAKLMEEDMGSAMQYL  246

Query  538  QSKALCIMPISLASAIYHSQAPDTTPLVK  452
            Q K LC+MPISLA+ I  +  P   P VK
Sbjct  247  QGKGLCLMPISLATTISTATCPSRNPFVK  275



>ref|XP_006453668.1| hypothetical protein CICLE_v10008192mg [Citrus clementina]
 gb|ESR66908.1| hypothetical protein CICLE_v10008192mg [Citrus clementina]
Length=469

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 11/96 (11%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGSEA----GRT-QPAWEKWSNDG---TERQVAKLMEEN  563
            GGA AVAPLV D+     E  GG +     GR    A    +ND    TE QVAKLMEE+
Sbjct  319  GGAAAVAPLVADMS---SEGGGGGDCIQANGRNPNGAQTTSANDSLTVTEHQVAKLMEED  375

Query  562  VGAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            +G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  376  MGSAMQYLQGKGLCLMPISLATAISTATCHSRNPII  411



>gb|KDO59404.1| hypothetical protein CISIN_1g012156mg [Citrus sinensis]
Length=469

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 10/95 (11%)
 Frame = -2

Query  718  GGAGAVAPLVTDIPISLVEEEGGS--EAGRTQP--AWEKWSNDG---TERQVAKLMEENV  560
            GGA AVAPLV D+     E  GG   +A    P  A    +ND    TE QVAKLMEE++
Sbjct  320  GGAAAVAPLVADMS---SEVRGGDCIQANGRNPNGAQTTSANDSLTVTEHQVAKLMEEDM  376

Query  559  GAAMQFLQSKALCIMPISLASAIYHSQAPDTTPLV  455
            G+AMQ+LQ K LC+MPISLA+AI  +      P++
Sbjct  377  GSAMQYLQGKGLCLMPISLATAISTATCHSRNPII  411



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260