BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF003C05

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    374   1e-121   Nicotiana tomentosiformis
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    370   9e-121   Nicotiana sylvestris
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    364   4e-118   Solanum tuberosum [potatoes]
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    364   6e-118   Solanum lycopersicum
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    363   1e-117   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     362   3e-117   Vitis vinifera
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   358   3e-116   Citrus sinensis [apfelsine]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    359   6e-116   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             358   9e-116   
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                352   7e-114   Erythranthe guttata [common monkey flower]
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    350   4e-113   Solanum tuberosum [potatoes]
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    350   6e-113   Solanum lycopersicum
ref|XP_007051240.1|  TolB protein-related isoform 1                     348   1e-111   
ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    347   4e-111   
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    344   6e-111   Cucumis melo [Oriental melon]
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             344   8e-111   
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     343   2e-110   Eucalyptus grandis [rose gum]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    344   3e-110   Eucalyptus grandis [rose gum]
gb|AAM13860.1|  unknown protein                                         342   6e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             340   6e-110   
ref|NP_192096.1|  tolB-related protein                                  342   7e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             342   7e-110   Capsella rubella
ref|XP_002515212.1|  conserved hypothetical protein                     342   1e-109   Ricinus communis
emb|CDP01464.1|  unnamed protein product                                343   1e-109   Coffea canephora [robusta coffee]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    340   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    340   4e-109   Camelina sativa [gold-of-pleasure]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         340   8e-109   Jatropha curcas
gb|KCW58167.1|  hypothetical protein EUGRSUZ_H008852                    326   1e-108   Eucalyptus grandis [rose gum]
emb|CDX74396.1|  BnaA03g26510D                                          337   4e-108   
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    337   5e-108   Arabis alpina [alpine rockcress]
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    337   7e-108   Elaeis guineensis
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    336   1e-107   Brassica rapa
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    336   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    335   2e-107   Cucumis sativus [cucumbers]
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    335   3e-107   Tarenaya hassleriana [spider flower]
ref|XP_010091406.1|  hypothetical protein L484_013861                   335   3e-107   
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     334   8e-107   Eucalyptus grandis [rose gum]
gb|KJB09508.1|  hypothetical protein B456_001G146700                    335   1e-106   Gossypium raimondii
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    333   3e-106   Fragaria vesca subsp. vesca
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             330   2e-105   
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    329   8e-105   Sesamum indicum [beniseed]
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    328   7e-104   Prunus mume [ume]
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    323   1e-102   Phoenix dactylifera
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    316   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    315   3e-99    
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    310   3e-97    Brachypodium distachyon [annual false brome]
ref|NP_001060406.1|  Os07g0638100                                       308   5e-97    
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    306   4e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ04851.1|  hypothetical protein OsI_27029                          305   8e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010456117.1|  PREDICTED: uncharacterized protein LOC104737601    297   3e-95    
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          303   5e-95    
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    302   2e-94    Zea mays [maize]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    302   2e-94    Cicer arietinum [garbanzo]
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             302   2e-94    Phaseolus vulgaris [French bean]
gb|EPS68684.1|  hypothetical protein M569_06083                         300   9e-94    Genlisea aurea
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    301   1e-93    Glycine max [soybeans]
dbj|BAJ89339.1|  predicted protein                                      298   4e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          298   1e-92    Sorghum bicolor [broomcorn]
dbj|BAJ94262.1|  predicted protein                                      296   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    293   7e-91    Setaria italica
ref|XP_003637686.1|  Protein tolB                                       288   2e-89    
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          286   2e-88    Amborella trichopoda
gb|AJD80981.1|  ABA-activated 1 protein                                 283   2e-87    Lupinus luteus
ref|XP_002515210.1|  conserved hypothetical protein                     278   1e-85    
ref|XP_003637684.1|  Protein tolB                                       279   1e-85    
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             238   3e-70    
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782             217   5e-62    Selaginella moellendorffii
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             217   8e-62    
gb|ABR17080.1|  unknown                                                 213   2e-60    Picea sitchensis
dbj|BAJ88545.1|  predicted protein                                      211   6e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    207   2e-58    Zea mays [maize]
ref|XP_003630471.1|  Protein tolB                                       205   9e-58    
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             204   3e-57    Phaseolus vulgaris [French bean]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    204   6e-57    
ref|XP_001780675.1|  predicted protein                                  203   7e-57    
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                201   3e-56    
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    201   3e-56    Glycine max [soybeans]
ref|NP_001051846.1|  Os03g0840200                                       201   4e-56    
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          201   5e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    200   7e-56    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB29176.1|  hypothetical protein B456_005G088400                    200   7e-56    Gossypium raimondii
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    199   1e-55    Setaria italica
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753    199   1e-55    Solanum tuberosum [potatoes]
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    199   1e-55    Arabis alpina [alpine rockcress]
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          199   2e-55    Sorghum bicolor [broomcorn]
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...    199   2e-55    Tarenaya hassleriana [spider flower]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...    199   2e-55    Tarenaya hassleriana [spider flower]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    198   4e-55    Nelumbo nucifera [Indian lotus]
emb|CDP10971.1|  unnamed protein product                                198   5e-55    Coffea canephora [robusta coffee]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    197   5e-55    Sesamum indicum [beniseed]
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    197   6e-55    Cicer arietinum [garbanzo]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                197   6e-55    Erythranthe guttata [common monkey flower]
emb|CDP10970.1|  unnamed protein product                                197   7e-55    Coffea canephora [robusta coffee]
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505    197   1e-54    Camelina sativa [gold-of-pleasure]
gb|EAY92514.1|  hypothetical protein OsI_14253                          196   2e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg             197   2e-54    Citrus clementina [clementine]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    196   2e-54    Solanum lycopersicum
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058    196   2e-54    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg             196   2e-54    Capsella rubella
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    196   3e-54    Elaeis guineensis
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406             196   3e-54    
emb|CDY08186.1|  BnaA06g15400D                                          195   3e-54    Brassica napus [oilseed rape]
emb|CDY04662.1|  BnaC05g17000D                                          196   3e-54    
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    196   4e-54    Populus euphratica
ref|XP_002520326.1|  conserved hypothetical protein                     195   4e-54    Ricinus communis
emb|CDX84088.1|  BnaC08g07650D                                          195   4e-54    
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    195   5e-54    Brassica rapa
ref|XP_010269111.1|  PREDICTED: uncharacterized protein LOC104605872    194   5e-54    Nelumbo nucifera [Indian lotus]
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    195   5e-54    Citrus sinensis [apfelsine]
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    195   6e-54    Populus euphratica
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             195   7e-54    Populus trichocarpa [western balsam poplar]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   195   7e-54    Citrus sinensis [apfelsine]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   194   7e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    194   8e-54    Vitis vinifera
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880    194   9e-54    Nicotiana tomentosiformis
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978    194   1e-53    Nicotiana sylvestris
emb|CAN73514.1|  hypothetical protein VITISV_037210                     194   1e-53    Vitis vinifera
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             193   2e-53    Eutrema salsugineum [saltwater cress]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   4e-53    Eucalyptus grandis [rose gum]
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    192   8e-53    Cucumis melo [Oriental melon]
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288    192   8e-53    Camelina sativa [gold-of-pleasure]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         191   1e-52    Jatropha curcas
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474    191   2e-52    Fragaria vesca subsp. vesca
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890    190   3e-52    Pyrus x bretschneideri [bai li]
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg             188   3e-52    
ref|XP_004160721.1|  PREDICTED: protein TolB-like                       187   4e-51    
ref|XP_004149439.1|  PREDICTED: protein TolB-like                       187   5e-51    Cucumis sativus [cucumbers]
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783    186   7e-51    Prunus mume [ume]
ref|XP_010095431.1|  hypothetical protein L484_013388                   186   8e-51    
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727    186   1e-50    
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          183   6e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652005.1|  PREDICTED: uncharacterized protein LOC102702184    167   2e-45    
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673    167   3e-44    Tarenaya hassleriana [spider flower]
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    164   6e-43    
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    158   7e-41    Camelina sativa [gold-of-pleasure]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    157   2e-40    Camelina sativa [gold-of-pleasure]
ref|NP_564146.1|  uncharacterized protein                               157   2e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    157   2e-40    Camelina sativa [gold-of-pleasure]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    157   2e-40    
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             155   5e-40    Arabidopsis lyrata subsp. lyrata
gb|EAY93383.1|  hypothetical protein OsI_15178                          149   2e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    150   5e-38    Coccomyxa subellipsoidea C-169
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             150   6e-38    Eutrema salsugineum [saltwater cress]
emb|CBI18981.3|  unnamed protein product                                146   5e-37    Vitis vinifera
emb|CDY04661.1|  BnaC05g16990D                                          147   8e-37    
ref|XP_002520327.1|  conserved hypothetical protein                     144   3e-36    
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008    145   3e-36    Brassica rapa
emb|CDY08187.1|  BnaA06g15390D                                          145   3e-36    Brassica napus [oilseed rape]
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                    144   5e-36    Arabis alpina [alpine rockcress]
gb|EMT16880.1|  hypothetical protein F775_15390                         131   5e-32    
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     130   1e-31    Eucalyptus grandis [rose gum]
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     128   4e-30    Eucalyptus grandis [rose gum]
ref|NP_001173830.1|  Os04g0278101                                       125   7e-30    
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140          126   3e-29    
gb|AEW08691.1|  hypothetical protein CL1213Contig1_01                   111   4e-27    Pinus lambertiana
gb|EMT08438.1|  hypothetical protein F775_30261                         119   6e-27    
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930          117   2e-26    Sorghum bicolor [broomcorn]
ref|XP_004963491.1|  PREDICTED: uncharacterized protein LOC101774581    117   3e-26    Setaria italica
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779    116   7e-26    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010102639.1|  hypothetical protein L484_010931                   116   7e-26    Morus notabilis
ref|XP_002519807.1|  conserved hypothetical protein                     114   2e-25    
ref|XP_002519802.1|  conserved hypothetical protein                     114   3e-25    Ricinus communis
dbj|BAJ92843.1|  predicted protein                                      114   3e-25    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEW08692.1|  hypothetical protein CL1213Contig1_01                   105   4e-25    Pinus radiata
ref|XP_004960704.1|  PREDICTED: uncharacterized protein LOC101777811    114   4e-25    Setaria italica
gb|AFG48602.1|  hypothetical protein CL1213Contig1_01                   105   5e-25    Pinus taeda
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407    114   5e-25    Zea mays [maize]
gb|EAY89757.1|  hypothetical protein OsI_11300                          114   5e-25    Oryza sativa Indica Group [Indian rice]
ref|NP_001049934.1|  Os03g0314500                                       114   5e-25    
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772    113   1e-24    Beta vulgaris subsp. vulgaris [field beet]
gb|EAY90391.1|  hypothetical protein OsI_11968                          113   1e-24    Oryza sativa Indica Group [Indian rice]
ref|XP_002524160.1|  conserved hypothetical protein                     112   1e-24    Ricinus communis
ref|WP_041858684.1|  hypothetical protein                               112   2e-24    
gb|ABJ88479.1|  WD40 domain protein beta Propeller                      112   2e-24    Candidatus Solibacter usitatus Ellin6076
ref|XP_010097765.1|  hypothetical protein L484_023906                   112   2e-24    Morus notabilis
gb|AFG48601.1|  hypothetical protein CL1213Contig1_01                   103   2e-24    Pinus taeda
gb|EAZ27259.1|  hypothetical protein OsJ_11196                          112   3e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002524154.1|  conserved hypothetical protein                     111   3e-24    Ricinus communis
ref|NP_001050324.1|  Os03g0403400                                       111   5e-24    
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220          110   8e-24    Sorghum bicolor [broomcorn]
ref|XP_010676033.1|  PREDICTED: uncharacterized protein LOC104891943    110   1e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT14934.1|  hypothetical protein F775_30553                         109   1e-23    
ref|XP_010676032.1|  PREDICTED: uncharacterized protein LOC104891942    108   3e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMS49561.1|  hypothetical protein TRIUR3_11240                       107   4e-23    Triticum urartu
dbj|BAK07068.1|  predicted protein                                      107   7e-23    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780    107   8e-23    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT19136.1|  hypothetical protein F775_12749                         107   1e-22    
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773    107   1e-22    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010105408.1|  hypothetical protein L484_008562                   103   3e-22    
gb|EMT29283.1|  hypothetical protein F775_17496                         105   4e-22    
ref|XP_004980674.1|  PREDICTED: uncharacterized protein LOC101756594    106   4e-22    Setaria italica
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313    105   6e-22    
ref|XP_010087211.1|  hypothetical protein L484_006140                   105   6e-22    Morus notabilis
gb|AFB33555.1|  hypothetical protein 2_7121_02                        98.2    1e-21    Pinus mugo [mountain pine]
ref|XP_003575792.1|  PREDICTED: uncharacterized protein LOC100821131    103   2e-21    Brachypodium distachyon [annual false brome]
gb|AFB33549.1|  hypothetical protein 2_7121_02                        97.4    2e-21    Abies alba [abete-blanco]
gb|EMS54560.1|  hypothetical protein TRIUR3_19354                     97.1    2e-21    Triticum urartu
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501    103   2e-21    Brachypodium distachyon [annual false brome]
gb|AFG49274.1|  hypothetical protein 2_7121_02                        97.1    3e-21    Pinus taeda
gb|AEW08359.1|  hypothetical protein 2_7121_02                        97.1    3e-21    Pinus radiata
ref|XP_010102640.1|  hypothetical protein L484_010932                   102   6e-21    Morus notabilis
gb|EJL34752.1|  periplasmic component of the Tol biopolymer trans...    101   7e-21    Caulobacter sp. AP07
ref|XP_010097467.1|  hypothetical protein L484_024672                   102   7e-21    
ref|XP_010097483.1|  hypothetical protein L484_024689                   100   2e-20    Morus notabilis
gb|EMT06488.1|  hypothetical protein F775_06751                       99.8    4e-20    
gb|AEW08360.1|  hypothetical protein 2_7121_02                        93.6    5e-20    Pinus lambertiana
ref|WP_035092853.1|  hypothetical protein                             99.0    5e-20    Caulobacter henricii
gb|AFB33553.1|  hypothetical protein 2_7121_02                        93.2    7e-20    Pinus cembra [Arve]
gb|AFB33550.1|  hypothetical protein 2_7121_02                        92.4    1e-19    Larix decidua
emb|CDM86908.1|  unnamed protein product                              97.4    3e-19    Triticum aestivum [Canadian hard winter wheat]
ref|WP_035205184.1|  hypothetical protein                             95.9    7e-19    Acidovorax
gb|EJE50504.1|  periplasmic component of the Tol biopolymer trans...  95.9    7e-19    Acidovorax sp. CF316
ref|WP_020604165.1|  hypothetical protein                             95.1    9e-19    Spirosoma spitsbergense
ref|WP_006298539.1|  hypothetical protein                             94.7    1e-18    
ref|WP_029915040.1|  hypothetical protein                             93.2    4e-18    Caulobacter sp. UNC358MFTsu5.1
gb|KFY81759.1|  hypothetical protein V500_11119                       93.2    5e-18    Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFZ03462.1|  hypothetical protein V502_10931                       93.2    6e-18    Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|NP_001066679.1|  Os12g0431300                                     92.8    9e-18    
gb|KFY12538.1|  hypothetical protein V491_06750                       92.4    1e-17    Pseudogymnoascus sp. VKM F-3775
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738  91.7    1e-17    Oryza brachyantha
ref|WP_043399319.1|  tolB protein precursor protein                   87.8    6e-17    
gb|KFY42678.1|  hypothetical protein V495_04387                       89.4    1e-16    Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY02373.1|  hypothetical protein O988_02191                       88.6    2e-16    Pseudogymnoascus sp. VKM F-3808
gb|KFX90155.1|  hypothetical protein V490_06619                       88.6    2e-16    Pseudogymnoascus sp. VKM F-3557
ref|XP_001545913.1|  hypothetical protein BC1G_15641                  88.2    2e-16    Botrytis cinerea B05.10
ref|WP_035035180.1|  hypothetical protein                             87.8    3e-16    
gb|KFY15902.1|  hypothetical protein V492_01680                       87.8    3e-16    Pseudogymnoascus sp. VKM F-4246
gb|KFZ05841.1|  hypothetical protein V501_07970                       86.7    9e-16    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
ref|WP_034400879.1|  translocation protein TolB                       85.5    1e-15    
ref|WP_020383615.1|  hypothetical protein                             84.3    1e-15    
gb|KFY39698.1|  hypothetical protein V494_03875                       85.9    1e-15    Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|AFK45973.1|  unknown                                               79.7    2e-15    Medicago truncatula
gb|KFY74302.1|  hypothetical protein V499_05663                       85.5    2e-15    Pseudogymnoascus sp. VKM F-103
gb|ENH85242.1|  WD40 domain protein beta propeller                    85.5    2e-15    
ref|WP_041305462.1|  hypothetical protein                             80.5    4e-15    
ref|WP_027978304.1|  hypothetical protein                             84.0    6e-15    
ref|XP_007914327.1|  putative tat pathway signal sequence domain-...  84.0    6e-15    Phaeoacremonium minimum UCRPA7
gb|ETI58852.1|  hypothetical protein C100_22665                       83.6    7e-15    Sphingobium sp. C100
ref|WP_031310342.1|  hypothetical protein                             83.6    8e-15    Sphingobium sp. C100
gb|ESZ89568.1|  hypothetical protein SBOR_10048                       83.2    1e-14    Sclerotinia borealis F-4128
emb|CAE05101.3|  OSJNBa0009K15.21                                     78.2    1e-14    Oryza sativa Japonica Group [Japonica rice]
ref|WP_025438063.1|  hypothetical protein                             82.8    1e-14    Komagataeibacter xylinus
gb|AHI25037.1|  hypothetical protein H845_1092                        82.8    1e-14    Komagataeibacter xylinus E25
dbj|GAA89133.1|  tat pathway signal sequence domain-containing pr...  82.8    1e-14    Aspergillus kawachii IFO 4308
gb|ABX03625.1|  WD40 domain protein beta Propeller                    80.1    2e-14    Herpetosiphon aurantiacus DSM 785
ref|WP_033378529.1|  MULTISPECIES: hypothetical protein               79.7    3e-14    
ref|XP_007835900.1|  hypothetical protein PFICI_09128                 82.0    3e-14    Pestalotiopsis fici W106-1
gb|KEQ78669.1|  tricorn protease N-terminal domain-containing pro...  82.0    3e-14    Aureobasidium pullulans EXF-150
ref|WP_030901696.1|  hypothetical protein                             81.6    4e-14    Streptomyces sp. NRRL F-5126
ref|XP_001395414.2|  hypothetical protein ANI_1_1672104               81.6    4e-14    Aspergillus niger CBS 513.88
gb|EHA25732.1|  hypothetical protein ASPNIDRAFT_50375                 81.6    4e-14    Aspergillus niger ATCC 1015
ref|WP_015838788.1|  translocation protein TolB                       80.5    4e-14    Geobacter sp. M21
gb|EKD68537.1|  Periplasmic component of the Tol biopolymer trans...  81.3    5e-14    uncultured bacterium
ref|WP_026159723.1|  hypothetical protein                             79.3    5e-14    
gb|KEZ20905.1|  Periplasmic component of the Tol biopolymer trans...  81.3    5e-14    Sphingobium yanoikuyae
ref|WP_037517431.1|  hypothetical protein                             81.3    5e-14    Sphingobium yanoikuyae
ref|WP_015754374.1|  translocation protein TolB                       79.0    5e-14    Robiginitalea biformata
ref|WP_020384321.1|  hypothetical protein                             79.0    5e-14    
emb|CAI78611.1|  tolB protein                                         80.5    6e-14    uncultured delta proteobacterium
gb|EJK81239.1|  periplasmic component of the Tol biopolymer trans...  80.9    7e-14    Sphingobium sp. AP49
ref|WP_037486764.1|  hypothetical protein                             80.5    7e-14    
ref|WP_020383554.1|  hypothetical protein                             79.0    8e-14    
ref|WP_019091574.1|  hypothetical protein                             80.5    8e-14    Komagataeibacter europaeus
ref|WP_040479380.1|  translocation protein TolB                       78.6    8e-14    
gb|EMS34061.1|  tolB protein precursor, periplasmic protein invol...  78.6    8e-14    Mariniradius saccharolyticus AK6
ref|WP_019086650.1|  hypothetical protein                             80.5    8e-14    Komagataeibacter europaeus
ref|XP_007798560.1|  putative tat pathway signal sequence domain-...  80.5    9e-14    
ref|WP_010509656.1|  hypothetical protein                             80.5    9e-14    Komagataeibacter europaeus
ref|XP_010091904.1|  hypothetical protein L484_001053                 77.0    9e-14    
ref|WP_041576117.1|  translocation protein TolB                       79.7    1e-13    
ref|WP_012831477.1|  hypothetical protein                             79.0    1e-13    Haliangium ochraceum
ref|WP_026842125.1|  translocation protein TolB                       79.0    1e-13    Geobacter bremensis
gb|AGH96540.1|  adventurous gliding motility protein W                79.3    1e-13    Bdellovibrio exovorus JSS
ref|WP_041978883.1|  hypothetical protein                             78.2    1e-13    
ref|WP_041569562.1|  hypothetical protein                             77.8    1e-13    
emb|CDM66426.1|  periplasmic component of the Tol biopolymer tran...  78.6    1e-13    Pyrinomonas methylaliphatogenes
dbj|GAD95313.1|  hypothetical protein ANI_1_1672104                   79.7    2e-13    Byssochlamys spectabilis No. 5
ref|WP_020383555.1|  hypothetical protein                             77.4    2e-13    
gb|AEP11793.1|  Periplasmic component of the Tol biopolymer trans...  77.8    2e-13    Chloracidobacterium thermophilum B
ref|WP_015718924.1|  translocation protein TolB                       78.2    2e-13    
ref|XP_007595649.1|  TOXD                                             79.3    3e-13    
ref|WP_012531942.1|  translocation protein TolB                       77.8    4e-13    
ref|XP_007588104.1|  putative tat pathway signal sequence domain-...  78.6    4e-13    
ref|WP_044021394.1|  hypothetical protein                             78.2    4e-13    
gb|EDT09480.1|  hypothetical protein BgramDRAFT_3858                  78.2    4e-13    
ref|WP_029968882.1|  hypothetical protein                             78.2    4e-13    
gb|EKG10177.1|  Six-bladed beta-propeller TolB-like protein           78.2    5e-13    
ref|WP_000615434.1|  hypothetical protein                             76.3    5e-13    
emb|CAK46110.1|  unnamed protein product                              77.8    6e-13    
ref|XP_003040341.1|  hypothetical protein NECHADRAFT_34811            77.8    7e-13    
ref|WP_013226661.1|  translocation protein TolB                       78.2    7e-13    
ref|WP_033198113.1|  WD40 domain protein beta propeller               75.5    7e-13    
ref|WP_036546999.1|  hypothetical protein                             74.7    7e-13    
dbj|GAK58097.1|  WD40-like Beta Propeller                             77.0    8e-13    
ref|WP_044595669.1|  hypothetical protein                             75.9    8e-13    
ref|WP_035474624.1|  hypothetical protein                             77.4    9e-13    
ref|WP_035954400.1|  hypothetical protein                             77.0    1e-12    
ref|WP_039218915.1|  hypothetical protein                             77.0    1e-12    
ref|WP_027818119.1|  hypothetical protein                             77.0    1e-12    
ref|WP_006399669.1|  hypothetical protein                             77.0    1e-12    
ref|WP_006403962.1|  hypothetical protein                             77.0    1e-12    
gb|EKD55533.1|  WD40-like protein Beta Propeller                      77.4    1e-12    
ref|WP_020384323.1|  hypothetical protein                             75.1    1e-12    
ref|XP_010262814.1|  PREDICTED: uncharacterized protein LOC104601238  70.5    1e-12    
ref|XP_007828048.1|  hypothetical protein PFICI_01276                 76.6    1e-12    
ref|WP_039744998.1|  translocation protein TolB                       76.3    1e-12    
gb|EQB54739.1|  hypothetical protein CGLO_05391                       76.6    1e-12    
ref|WP_015250253.1|  Tol biopolymer transport system periplasmic ...  75.1    1e-12    
ref|XP_007275047.1|  WD40 domain protein beta propeller               76.6    2e-12    
emb|CBE67573.1|  Protein tolB precursor                               75.9    2e-12    
ref|WP_027716026.1|  translocation protein TolB                       75.9    2e-12    
emb|CBH22796.1|  TolB protein precursor                               76.3    2e-12    
ref|WP_043201552.1|  hypothetical protein                             76.3    2e-12    
ref|WP_020384320.1|  hypothetical protein                             73.9    2e-12    
gb|KIL85442.1|  hypothetical protein FAVG1_11399                      76.3    2e-12    
dbj|BAL54994.1|  TolB protein                                         74.3    2e-12    
ref|WP_020258740.1|  hypothetical protein                             74.3    2e-12    
gb|AHG92466.1|  WD40-like beta Propeller containing protein           75.9    3e-12    
ref|WP_027211084.1|  hypothetical protein                             75.9    3e-12    
ref|WP_012115032.1|  beta-propeller repeat-containing to-pal syst...  75.1    3e-12    
ref|WP_026181509.1|  MULTISPECIES: translocation protein TolB         74.7    4e-12    
gb|KGO45093.1|  WD40-like Beta Propeller                              75.1    4e-12    
dbj|BAJ63516.1|  hypothetical protein ANT_14880                       73.2    4e-12    
ref|WP_038036308.1|  translocation protein TolB                       74.7    5e-12    
ref|WP_044188701.1|  tolB protein precursor protein                   73.9    5e-12    
gb|KGO53636.1|  WD40-like Beta Propeller                              75.1    5e-12    
ref|WP_042305737.1|  hypothetical protein                             75.1    5e-12    
ref|WP_029877303.1|  translocation protein TolB                       74.3    6e-12    
ref|WP_033260684.1|  translocation protein TolB                       75.1    6e-12    
ref|WP_029557867.1|  translocation protein TolB                       73.9    7e-12    
ref|WP_043431595.1|  tolB protein precursor protein                   73.6    7e-12    
ref|WP_038053671.1|  translocation protein TolB                       73.9    7e-12    
ref|WP_004513696.1|  translocation protein TolB                       73.9    7e-12    
gb|EKV04294.1|  hypothetical protein PDIP_88020                       74.7    7e-12    
gb|EPX59664.1|  tolB protein precursor, periplasmic protein           73.6    8e-12    
ref|WP_040334620.1|  hypothetical protein                             73.2    9e-12    
gb|AIO73947.1|  hypothetical protein DM80_3777                        73.9    1e-11    
emb|CDM26673.1|  Six-bladed beta-propeller, TolB-like                 73.9    1e-11    
ref|WP_038283157.1|  translocation protein TolB                       73.6    1e-11    
gb|EMD82160.1|  TolB protein precursor                                73.6    1e-11    
ref|WP_015828440.1|  hypothetical protein                             73.6    1e-11    
dbj|GAA92300.1|  tat pathway signal sequence domain-containing pr...  73.6    1e-11    
ref|WP_040889071.1|  WD40 domain protein beta propeller               71.6    2e-11    
gb|EYE99209.1|  TolB, C-terminal domain-containing protein            73.6    2e-11    
ref|WP_043539896.1|  translocation protein TolB                       72.8    2e-11    
ref|XP_008082401.1|  DPP6 N-terminal                                  73.2    2e-11    
ref|WP_025779649.1|  hypothetical protein                             70.5    2e-11    
gb|KGO75694.1|  WD40-like Beta Propeller                              73.2    2e-11    
ref|WP_035992689.1|  hypothetical protein                             73.2    2e-11    
ref|WP_043949727.1|  translocation protein TolB                       72.8    2e-11    
ref|WP_035513763.1|  hypothetical protein                             73.2    2e-11    
ref|WP_043436880.1|  hypothetical protein                             72.8    2e-11    
ref|WP_012973608.1|  TolB protein                                     72.4    3e-11    
ref|WP_040747138.1|  translocation protein TolB                       72.4    3e-11    
ref|WP_011550484.1|  hypothetical protein                             72.0    3e-11    
dbj|GAK49571.1|  WD40-like Beta Propeller                             71.2    3e-11    
gb|EMH80413.1|  tol-pal system beta propeller repeat protein TolB     72.4    3e-11    
dbj|GAM35983.1|  hypothetical protein TCE0_018f04727                  72.8    3e-11    
ref|WP_038454721.1|  hypothetical protein                             72.8    3e-11    
ref|WP_013942199.1|  translocation protein TolB                       72.0    3e-11    
ref|WP_023399162.1|  periplasmic component of the Tol biopolymer ...  71.2    3e-11    
gb|EHA23695.1|  hypothetical protein ASPNIDRAFT_180130                72.4    4e-11    
ref|XP_010094534.1|  hypothetical protein L484_024827                 69.7    4e-11    
ref|WP_042703626.1|  translocation protein TolB                       71.2    4e-11    
dbj|BAQ44058.1|  translocation protein TolB                           71.6    4e-11    
ref|WP_014247215.1|  periplasmic protein of the Tol-Pal system        71.6    4e-11    
ref|WP_040095900.1|  translocation protein TolB                       71.6    4e-11    
ref|WP_041872499.1|  translocation protein TolB                       71.6    4e-11    
gb|ABW31820.1|  WD40-like Beta Propeller, putative                    71.2    5e-11    
ref|WP_038321358.1|  hypothetical protein                             70.9    5e-11    
ref|WP_020678259.1|  hypothetical protein                             71.6    5e-11    
ref|WP_043785949.1|  translocation protein TolB                       72.4    5e-11    
ref|WP_022817416.1|  translocation protein TolB                       72.4    5e-11    
ref|WP_015930945.1|  Tol-Pal system beta propeller repeat-contain...  71.2    6e-11    
gb|KIN05407.1|  hypothetical protein OIDMADRAFT_39656                 71.6    6e-11    
ref|WP_043623202.1|  translocation protein TolB                       71.2    6e-11    
gb|AEB09960.1|  Protein tolB                                          71.2    6e-11    
ref|WP_035277427.1|  hypothetical protein                             71.2    6e-11    
ref|WP_034806253.1|  translocation protein TolB                       71.2    6e-11    
ref|WP_036196430.1|  hypothetical protein                             69.7    7e-11    
ref|WP_002615693.1|  hypothetical protein                             70.9    7e-11    
ref|WP_012640704.1|  translocation protein TolB                       71.2    7e-11    
ref|WP_039647551.1|  translocation protein TolB                       71.2    7e-11    
ref|WP_010921063.1|  translocation protein TolB                       70.9    7e-11    
ref|WP_034427159.1|  hypothetical protein                             70.5    7e-11    
ref|WP_041187541.1|  hypothetical protein                             70.1    7e-11    
ref|WP_041726769.1|  hypothetical protein                             69.7    7e-11    
ref|XP_003570812.2|  PREDICTED: uncharacterized protein LOC100837266  71.6    7e-11    
ref|WP_026331166.1|  translocation protein TolB                       70.9    8e-11    
ref|WP_002638920.1|  translocation protein TolB                       70.9    8e-11    
ref|WP_012169055.1|  twin-arginine translocation pathway signal       70.9    8e-11    
ref|WP_017943217.1|  hypothetical protein                             70.9    8e-11    
ref|WP_029206303.1|  translocation protein TolB                       70.9    9e-11    
ref|WP_014240516.1|  periplasmic protein of the Tol-Pal system        70.9    9e-11    
ref|WP_019872746.1|  hypothetical protein                             70.5    1e-10    
ref|WP_025306923.1|  translocation protein TolB                       70.9    1e-10    
ref|XP_002559211.1|  Pc13g07820                                       71.2    1e-10    
ref|XP_002378780.1|  hypothetical protein AFLA_060360                 68.2    1e-10    
ref|WP_038037302.1|  MULTISPECIES: translocation protein TolB         70.5    1e-10    
ref|WP_038035303.1|  MULTISPECIES: translocation protein TolB         70.5    1e-10    
ref|WP_028484711.1|  translocation protein TolB                       70.5    1e-10    
ref|WP_006000501.1|  translocation protein TolB                       70.5    1e-10    
ref|XP_001391151.1|  hypothetical protein ANI_1_1414064               70.9    1e-10    
gb|ETW93507.1|  hypothetical protein ETSY1_38930                      70.1    1e-10    
ref|WP_030055158.1|  MULTISPECIES: hypothetical protein               70.5    1e-10    
ref|WP_041870465.1|  hypothetical protein                             68.9    1e-10    
gb|EQB62921.1|  hypothetical protein RBG1_1C00001G0500                70.5    1e-10    
ref|WP_007678383.1|  TolB protein                                     68.2    1e-10    
gb|ADU66304.1|  TolB protein                                          70.5    1e-10    
ref|WP_036514540.1|  translocation protein TolB                       70.5    1e-10    
gb|EGL66673.1|  translocation protein                                 70.1    1e-10    
emb|CBK43047.1|  Protein TolB precursor                               70.1    1e-10    
ref|WP_026091053.1|  translocation protein TolB                       70.1    1e-10    
ref|WP_015345983.1|  beta-propeller repeat-containing to-pal syst...  69.7    1e-10    
ref|WP_011555707.1|  translocation protein TolB                       70.1    1e-10    
ref|WP_018288388.1|  hypothetical protein                             69.7    1e-10    
ref|WP_040498617.1|  translocation protein TolB                       70.1    1e-10    
ref|WP_028318597.1|  hypothetical protein                             70.1    1e-10    
ref|WP_029010378.1|  translocation protein TolB                       70.1    2e-10    
ref|WP_038028868.1|  translocation protein TolB                       70.1    2e-10    
ref|WP_010973273.1|  MULTISPECIES: translocation protein TolB         70.1    2e-10    
ref|WP_034307572.1|  translocation protein TolB                       70.9    2e-10    
ref|WP_009521907.1|  translocation protein TolB                       69.7    2e-10    
ref|WP_038527217.1|  translocation protein TolB                       69.7    2e-10    
ref|WP_024348846.1|  translocation protein TolB                       69.7    2e-10    
ref|WP_009208751.1|  tolB protein, periplasmic component, biopoly...  69.7    2e-10    
ref|WP_041787794.1|  translocation protein TolB                       69.7    2e-10    
ref|WP_029638152.1|  translocation protein TolB                       69.7    2e-10    
gb|ADP72488.1|  Tol-Pal system beta propeller repeat protein TolB     69.7    2e-10    
ref|WP_044278321.1|  tolB protein precursor protein                   69.3    2e-10    
ref|WP_012187572.1|  WD40 domain-containing protein                   70.1    2e-10    
ref|WP_034426092.1|  hypothetical protein                             69.7    2e-10    
ref|WP_010813737.1|  MULTISPECIES: translocation protein TolB         69.7    2e-10    
ref|WP_022563044.1|  Protein tolB precursor                           69.7    2e-10    
ref|WP_024902097.1|  translocation protein TolB                       69.7    2e-10    
gb|AIE98934.1|  WD40-like beta propeller repeat-containing protei...  69.7    2e-10    
ref|WP_004445729.1|  MULTISPECIES: tol-pal system beta propeller ...  69.3    2e-10    
ref|WP_006697167.1|  MULTISPECIES: translocation protein TolB         69.3    2e-10    
ref|WP_043262479.1|  hypothetical protein                             69.7    2e-10    
dbj|GAK88347.1|  TolB protein precursor                               69.3    2e-10    
ref|WP_029131120.1|  translocation protein TolB                       69.3    2e-10    
gb|ADG09198.1|  Tol-Pal system beta propeller repeat protein TolB     69.3    2e-10    
ref|WP_013088521.1|  MULTISPECIES: translocation protein TolB         69.3    2e-10    
ref|WP_041538454.1|  translocation protein TolB                       69.3    2e-10    
ref|WP_042291254.1|  hypothetical protein                             69.3    3e-10    
ref|WP_025585162.1|  translocation protein TolB                       69.3    3e-10    
ref|WP_012353553.1|  translocation protein TolB                       69.3    3e-10    
ref|WP_025322946.1|  hypothetical protein                             68.9    3e-10    
ref|WP_006929797.1|  surface antigen (D15)                            70.1    3e-10    
ref|WP_011582484.1|  translocation protein TolB                       69.3    3e-10    
ref|WP_018038465.1|  translocation protein TolB                       69.3    3e-10    
gb|EYE95611.1|  dipeptidyl peptidase IV/CD26, N-terminal domain-c...  69.7    3e-10    
ref|WP_003511387.1|  MULTISPECIES: translocation protein TolB         69.3    3e-10    
dbj|GAK55986.1|  protein tolB                                         69.3    3e-10    
gb|EFF88542.1|  tat pathway signal sequence domain-containing pro...  69.7    3e-10    
ref|WP_036002953.1|  translocation protein TolB                       69.3    3e-10    
emb|CBH39656.1|  conserved hypothetical secreted protein, contain...  68.6    3e-10    
gb|ADY66818.1|  protein tolB precursor                                69.3    3e-10    
ref|WP_007068778.1|  translocation protein TolB precursor             69.3    3e-10    
ref|WP_007584949.1|  MULTISPECIES: translocation protein TolB         69.3    3e-10    
ref|WP_036316959.1|  translocation protein TolB                       68.9    3e-10    
ref|WP_038523674.1|  translocation protein TolB                       69.7    3e-10    
ref|WP_038032937.1|  MULTISPECIES: translocation protein TolB         68.9    3e-10    
ref|WP_028371949.1|  translocation protein TolB                       68.9    3e-10    
ref|WP_038045813.1|  translocation protein TolB                       68.9    3e-10    
ref|WP_020383553.1|  hypothetical protein                             67.4    3e-10    
ref|WP_007661449.1|  tol-pal system beta propeller repeat protein...  68.9    3e-10    
ref|WP_006726830.1|  translocation protein TolB                       68.9    3e-10    
ref|WP_012401832.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_028223068.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_026279915.1|  translocation protein TolB                       68.9    4e-10    
gb|ACI99197.1|  protein TolB precursor                                68.9    4e-10    
ref|WP_020402308.1|  hypothetical protein                             69.3    4e-10    
ref|WP_035680557.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_041785250.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_026353894.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_003506242.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_035459582.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_013957626.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_003523242.1|  translocation protein TolB                       68.9    4e-10    
ref|WP_026364039.1|  MULTISPECIES: translocation protein TolB         68.6    4e-10    
ref|WP_041455426.1|  hypothetical protein                             66.2    4e-10    
ref|WP_041970151.1|  translocation protein TolB                       68.6    4e-10    
dbj|GAK58088.1|  WD40-like Beta Propeller                             68.2    4e-10    
ref|WP_030247898.1|  hypothetical protein                             68.6    4e-10    
dbj|GAK98792.1|  TolB protein precursor                               68.6    5e-10    
dbj|GAM34283.1|  hypothetical protein TCE0_015r01756                  68.9    5e-10    
ref|WP_023666083.1|  translocation protein TolB                       68.6    5e-10    
ref|WP_026190563.1|  translocation protein TolB                       68.6    5e-10    
ref|WP_026330517.1|  translocation protein TolB                       68.6    5e-10    
ref|WP_027390703.1|  hypothetical protein                             68.6    5e-10    
ref|WP_012333176.1|  beta-propeller repeat-containing to-pal syst...  68.6    5e-10    
ref|WP_012431818.1|  translocation protein TolB                       68.6    5e-10    
ref|WP_019612057.1|  translocation protein TolB                       68.6    5e-10    
ref|WP_026287985.1|  MULTISPECIES: translocation protein TolB         68.2    6e-10    
gb|KGO38400.1|  WD40-like Beta Propeller                              68.6    6e-10    
ref|WP_018143958.1|  translocation protein TolB                       68.2    6e-10    
ref|WP_018168450.1|  MULTISPECIES: translocation protein TolB         68.2    6e-10    
dbj|GAK52271.1|  WD40-like Beta Propeller                             68.2    6e-10    
ref|WP_029914308.1|  translocation protein TolB                       68.2    6e-10    



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   374 bits (959),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 200/225 (89%), Gaps = 4/225 (2%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            +D + EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSGRSGHKNLYI+D++ GEL+GG 
Sbjct  477  EDCAREIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSGRSGHKNLYIVDAVKGELEGGE  536

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            I QLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGLRRIHVAG EG
Sbjct  537  ICQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGLRRIHVAGPEG  596

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S+EV++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GLQRL
Sbjct  597  SDEVDKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLQRL  656

Query  163  TWNGYENGTPAWHPKA--EVDLARLSLGKSGEKLRGKFDEPLWIN  35
            TWNGYENGTPAWHP A   VD+ R  L   G+KLRG+FD+ LW+N
Sbjct  657  TWNGYENGTPAWHPSATITVDVKRSLL--VGDKLRGEFDDVLWMN  699



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   370 bits (950),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 195/223 (87%), Gaps = 0/223 (0%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            +D + EIPVEIKVLTKE TGNNAFPSCSPDGKH+VFRSGRSGHKNLYI+D++ GEL+GG 
Sbjct  440  EDCAGEIPVEIKVLTKEETGNNAFPSCSPDGKHVVFRSGRSGHKNLYIVDAIKGELEGGE  499

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLT G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYVV PDGTGLRRI+VAG EG
Sbjct  500  IRQLTKGPWIDTMPSWSPDGKLIAFSSNRHNPDNITCFSIYVVHPDGTGLRRIYVAGPEG  559

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S+E ++ERLNHVCFS D EW+LFTANLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GLQRL
Sbjct  560  SDEADKERLNHVCFSKDCEWLLFTANLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLQRL  619

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            TWNGYENGTPAWHP A   +        G+KLRG+FD+ LW+N
Sbjct  620  TWNGYENGTPAWHPSATTTVEVKRSLLVGDKLRGEFDDVLWMN  662



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   364 bits (935),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 200/226 (88%), Gaps = 4/226 (2%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            +DD  +IPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSGRSGHKNLYI+D++ GEL+GGG
Sbjct  473  NDDCGKIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIMDAVKGELEGGG  532

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIHVAG EG
Sbjct  533  IRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEG  592

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GL+RL
Sbjct  593  SDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLRRL  652

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWIN  35
            T N YENGTPAWHP A + +  L + ++   G+KLRG+FD+ LW+N
Sbjct  653  TCNAYENGTPAWHPSA-MPMTALDIERNVIVGDKLRGEFDDVLWMN  697



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   364 bits (934),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 198/227 (87%), Gaps = 6/227 (3%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            +DD  EIPVEI+VLTKE TGNNAFPSCSPDGKHIVFRSGRSGHKNLYI+DS+ GEL+GGG
Sbjct  472  NDDCGEIPVEIEVLTKEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIMDSVKGELEGGG  531

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N  CFSIYV+ P+GTGLRRIHVAG EG
Sbjct  532  IRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNVTCFSIYVIHPNGTGLRRIHVAGPEG  591

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S+EV++ERLNHVCFS D EW+LFT NLGGVTAEPVS+PNQ+QPYGDLY+++LDG+GL++L
Sbjct  592  SDEVDKERLNHVCFSKDCEWLLFTGNLGGVTAEPVSLPNQYQPYGDLYLVKLDGSGLRQL  651

Query  163  TWNGYENGTPAWHPK----AEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            T N YENGTPAWHP       +D+ R  +   G+KLRG+FD+ LW+N
Sbjct  652  TCNAYENGTPAWHPSGTPMTALDIERNVI--VGDKLRGEFDDVLWMN  696



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   363 bits (931),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DDD ++IP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID++NGEL+GG 
Sbjct  452  DDDREDIPADVKILTREETGNNAFPSCSPDGKSVVFRSGRSGNKNLYIIDAVNGELEGG-  510

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ LRR++VAG+EG
Sbjct  511  IRQLTEGPWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDLRRVYVAGSEG  570

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+RER+NHVCFS+D EW+LF ANLGG+TAEP+S+PNQFQPYGDL+++RLDG+GL+RL
Sbjct  571  SVDVDRERINHVCFSADCEWLLFAANLGGMTAEPISLPNQFQPYGDLFVVRLDGSGLKRL  630

Query  163  TWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  26
            TWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  631  TWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   362 bits (928),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 204/227 (90%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DDD ++IP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID++NGEL+GG 
Sbjct  452  DDDREDIPADVKILTREETGNNAFPSCSPDGKSVVFRSGRSGNKNLYIIDAVNGELEGG-  510

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLT+G WIDTMPSWSPDGKLIAFSSNRHNP N + FSIYV+RPDG+ LRR++VAG+EG
Sbjct  511  IRQLTEGXWIDTMPSWSPDGKLIAFSSNRHNPDNLNAFSIYVIRPDGSDLRRVYVAGSEG  570

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+RER+NHVCFS+D EW+LF ANLGG TAEP+S+PNQFQPYGDL+++RLDG+GL+RL
Sbjct  571  SVDVDRERINHVCFSADCEWLLFAANLGGXTAEPISLPNQFQPYGDLFVVRLDGSGLKRL  630

Query  163  TWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  26
            TWNGYENGTPAWH   EVD+ R+ LG ++G+KL G+FDEPLWI+ + 
Sbjct  631  TWNGYENGTPAWHTGNEVDMGRMCLGSENGDKLTGEFDEPLWISCEL  677



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   358 bits (918),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 199/227 (88%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  
Sbjct  417  DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-  475

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EG
Sbjct  476  IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEG  535

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RL
Sbjct  536  SGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRL  595

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  26
            TWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  596  TWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  642



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   359 bits (921),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 199/227 (88%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  
Sbjct  475  DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-  533

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EG
Sbjct  534  IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEG  593

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RL
Sbjct  594  SGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRL  653

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  26
            TWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  654  TWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   358 bits (920),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 199/227 (88%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            D++ +EIP ++K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D++NGE +G  
Sbjct  475  DNNREEIPCDVKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLFVLDAVNGEFNGD-  533

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IRQLTDG WIDTMPSWSP G LIAFSSNRHNP N + FS+YV++PDG+GLRRIHVAG EG
Sbjct  534  IRQLTDGPWIDTMPSWSPKGDLIAFSSNRHNPDNVEAFSLYVIKPDGSGLRRIHVAGPEG  593

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+RER+NHVCFS+D EW+LFTANLG V AEPVS PNQFQPYGDLY+++LDG+GL+RL
Sbjct  594  SGDVDRERINHVCFSADGEWLLFTANLGAVMAEPVSWPNQFQPYGDLYVVKLDGSGLRRL  653

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  26
            TWNGYENGTPAWHP  ++DL +L L    G+KLRG+FDEPLWI+ DF
Sbjct  654  TWNGYENGTPAWHPGNQLDLGKLRLEDDIGDKLRGQFDEPLWISCDF  700



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 7/228 (3%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD DEIPVEIK+LTKE TGNNAFP CSPDGK +VFRSGRSGHKNLYI+D++NGEL+GG +
Sbjct  431  DDRDEIPVEIKILTKEETGNNAFPCCSPDGKSVVFRSGRSGHKNLYIMDAVNGELEGGMV  490

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            RQLTDG WIDTMPSWSPDGKLIAFSSNRHNP N   F IY+V P+G G+RR+ VA  E  
Sbjct  491  RQLTDGNWIDTMPSWSPDGKLIAFSSNRHNPENEGAFGIYLVEPNGKGVRRVQVAVIE--  548

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            EE  RERLNHVCFS+D EW+LFT+NLGGVTAEPVSIPNQFQPYGD+Y++RLDG+GLQRLT
Sbjct  549  EE--RERLNHVCFSADGEWLLFTSNLGGVTAEPVSIPNQFQPYGDMYLVRLDGSGLQRLT  606

Query  160  WNGYENGTPAWHPKAEVDLARLSL--GKSGE-KLRGKFDEPLWINSDF  26
            WNGYENGTPAWHP   + L+ LSL   K GE KL+G+FDEPLWI  D 
Sbjct  607  WNGYENGTPAWHPTPGLSLSALSLEGNKDGEDKLKGQFDEPLWILCDL  654



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   350 bits (899),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 195/224 (87%), Gaps = 8/224 (4%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  512
            DEIPV+IKVLT E TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIID++NGE++GG IRQL
Sbjct  435  DEIPVDIKVLTGEETGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDAVNGEMEGGEIRQL  494

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
            T+GAWIDTMP+WSPDGKLIAFSSN HNP + +CFSIYVV PDG+GLRRI+VAG EGSEEV
Sbjct  495  TNGAWIDTMPNWSPDGKLIAFSSNMHNPDDINCFSIYVVHPDGSGLRRIYVAGPEGSEEV  554

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  152
            ++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT NG
Sbjct  555  DKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTCNG  614

Query  151  YENGTPAWHPKAEVDLARLSLGKS------GEKLRGKFDEPLWI  38
            YENGTPAWH  +       + G++      GEKL+G+FD+ LW+
Sbjct  615  YENGTPAWH--SSTMPMETTTGETERNVLVGEKLKGEFDDVLWM  656



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 196/228 (86%), Gaps = 12/228 (5%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            +SDEIPVEIKVLT E TGNNAFPSCSPDGKH+VFRSGRSG+KNLYIID +NGE++GG +R
Sbjct  435  NSDEIPVEIKVLTGEETGNNAFPSCSPDGKHLVFRSGRSGYKNLYIIDGVNGEMEGGEVR  494

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            QLT+GAWIDTMP+WSPDGKLIAFSSNRHNP + + FSIYVV PDG+GLRRI+VAG EGSE
Sbjct  495  QLTNGAWIDTMPNWSPDGKLIAFSSNRHNPNDINRFSIYVVHPDGSGLRRIYVAGPEGSE  554

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            EV++ERLNHVCFS DSEW+LFT NL GVTAEPVS+PNQFQPYGDLY+++LDG+GL+RLT 
Sbjct  555  EVDKERLNHVCFSKDSEWLLFTGNLSGVTAEPVSLPNQFQPYGDLYVVKLDGSGLRRLTC  614

Query  157  NGYENGTPAWHPKA--------EVDLARLSLGKSGEKLRGKFDEPLWI  38
            NGYENGTPAWHP          E + + L     GEKL+G+FD+ LW+
Sbjct  615  NGYENGTPAWHPSTMPMETTAGETERSVL----VGEKLKGEFDDLLWM  658



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 194/229 (85%), Gaps = 2/229 (1%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D + D +EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE +G
Sbjct  476  DFNGDLEEIPCDVKMLTREDTGNNAFPSCSPDGKSLVFRSGRSGHKNLYILDAVNGEFNG  535

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            G IR+LTDG WIDTMPSWSP G LIAFSSN HNP   D FSIYV++PDG+ LRRI VAG 
Sbjct  536  G-IRKLTDGPWIDTMPSWSPSGDLIAFSSNMHNPDRVDAFSIYVIKPDGSDLRRIFVAGP  594

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
             GS +V+RER+NHVCFS D EW+LF  N+GGVT EPVS PNQFQPYGDLY++RLDG+GL+
Sbjct  595  RGSSDVDRERINHVCFSQDGEWLLFATNIGGVTVEPVSWPNQFQPYGDLYVVRLDGSGLR  654

Query  169  RLTWNGYENGTPAWHPKAEVDLARLSLG-KSGEKLRGKFDEPLWINSDF  26
            RLTWNG+ENGTPAWHP +E+D+ RL LG ++G KL+G F+EPLWI  DF
Sbjct  655  RLTWNGFENGTPAWHPWSELDMGRLCLGNEAGVKLKGDFEEPLWITCDF  703



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   347 bits (889),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 195/228 (86%), Gaps = 5/228 (2%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD ++IP E+K+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D+++GE +GG I
Sbjct  488  DDREDIPAEVKILTKEETGNNAFPSCSPDGKFVVFRSGRSGHKNLYIMDAVDGEFNGG-I  546

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            RQLTDG WIDTMP+WSPDGKLI FSSNRHNP N + FSIY++RPDGT LRR++VAG EGS
Sbjct  547  RQLTDGPWIDTMPNWSPDGKLIVFSSNRHNPSNVEAFSIYLIRPDGTDLRRVYVAGVEGS  606

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
             E  RER+NHVCFS DS W++FTANLGGV  EPVS+PNQFQPYGDLY++RLDG+GL+RLT
Sbjct  607  AEAERERINHVCFSPDSLWLVFTANLGGVLTEPVSMPNQFQPYGDLYVVRLDGSGLKRLT  666

Query  160  WNGYENGTPAWHP---KAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  29
            WNGYENGTP W+    + ++D+ RLS+    G++L G+FDEPLWI+ D
Sbjct  667  WNGYENGTPTWNSTTGEMDMDMDRLSVETVVGDRLMGQFDEPLWISCD  714



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 192/230 (83%), Gaps = 3/230 (1%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELD  533
            D  D DSDE+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D++ GE +
Sbjct  419  DLKDGDSDEVSSEVKILTKDDTGNNAFPACSPDGKFLVFRSGRSGHKNLYIVDAVKGEFE  478

Query  532  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
            G  +R+LTDGAWIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG
Sbjct  479  GE-LRRLTDGAWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAG  537

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
             EGS EV+RER+NHVCFS D +W+LFTANL GVTAEPVS PNQFQPYGDL+++RLDGTGL
Sbjct  538  PEGSSEVDRERINHVCFSRDGKWLLFTANLSGVTAEPVSWPNQFQPYGDLFVVRLDGTGL  597

Query  172  QRLTWNGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  29
             RLTWNGYENGTP W+  +EV L+ LSL     GEKL+G FDEPLWI  D
Sbjct  598  SRLTWNGYENGTPTWYYGSEVALSGLSLKDEVVGEKLKGNFDEPLWITFD  647



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   344 bits (883),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 192/224 (86%), Gaps = 1/224 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P ++K+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR
Sbjct  428  DKEELPCDVKILTLENTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIR  487

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G WIDTMP WSP G LI FSSNRHNP N D F  YVVRPDG+GLRRI ++G EGSE
Sbjct  488  RLTEGPWIDTMPCWSPKGDLIGFSSNRHNPANIDAFGAYVVRPDGSGLRRILISGPEGSE  547

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQPYGDLY+++LDGTGL+RLTW
Sbjct  548  EAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQPYGDLYVVKLDGTGLRRLTW  607

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            NGYE+GTP WH   E+DL+R+SL G+ G+KL G+F+EPLWI+ D
Sbjct  608  NGYEDGTPTWHTADELDLSRMSLNGQDGDKLDGQFEEPLWISCD  651



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 192/223 (86%), Gaps = 5/223 (2%)
 Frame = -2

Query  685  IPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  506
            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTD
Sbjct  436  VKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTD  494

Query  505  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            G WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+R
Sbjct  495  GPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDR  554

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
            ER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+E
Sbjct  555  ERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFE  614

Query  145  NGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  29
            NGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  615  NGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  657



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 192/223 (86%), Gaps = 5/223 (2%)
 Frame = -2

Query  685  IPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  506
            +  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNLY +D++NGE  GGGIRQLTD
Sbjct  480  VKCDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLYAVDAVNGEF-GGGIRQLTD  538

Query  505  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            G WIDTMPSWSP+G LIAFSSNRHNP N + FSIY+++PDG+GLRR+HVAG EGS EV+R
Sbjct  539  GPWIDTMPSWSPNGDLIAFSSNRHNPDNVNAFSIYLIKPDGSGLRRVHVAGPEGSPEVDR  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
            ER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GLQRLTWNG+E
Sbjct  599  ERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLQRLTWNGFE  658

Query  145  NGTPAWHPKAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  29
            NGTPAWH   +V  + L  G S    G+KLRG+F+EPLWI+ D
Sbjct  659  NGTPAWHSSDDVSPSDLRSGISEDWDGDKLRGQFEEPLWISCD  701



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +++P ++K+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR
Sbjct  433  DKEDLPCDVKILTLENTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIR  492

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LTDG WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDGTGLRRI ++G EGSE
Sbjct  493  RLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFGAYVVRPDGTGLRRIQISGPEGSE  552

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++F ANL GVTAEPV++PNQFQPYGDLY+++LDGTGL+RLTW
Sbjct  553  EAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPNQFQPYGDLYVVKLDGTGLRRLTW  612

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            NGYE+GTP WH   E+DL++L+L G+ G+KL G+F+EPLWI+ D
Sbjct  613  NGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEEPLWISCD  656



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 190/225 (84%), Gaps = 3/225 (1%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLY++D++NGE DG  IR
Sbjct  379  DKEELPCEVKYLTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYVVDAVNGESDG--IR  436

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LTDG WIDTMP WSP G LI FSSNRHNP N + F +YVVRPDG+GLRRI VAG EGSE
Sbjct  437  RLTDGPWIDTMPCWSPKGDLIGFSSNRHNPANTEAFGVYVVRPDGSGLRRIQVAGPEGSE  496

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++FTANLGGV AEPV++PNQFQPYG+LY+++LDGTGL+RLTW
Sbjct  497  EAARERVNHVSFNKDGDWLVFTANLGGVMAEPVAMPNQFQPYGELYVVKLDGTGLRRLTW  556

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  26
            NGYENGTP WH   +VDL++LSL G+ G+KL G+F+EPLWI+ D 
Sbjct  557  NGYENGTPTWHTVDDVDLSQLSLNGQDGDKLEGQFEEPLWISCDI  601



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +++P ++K+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D++NGE +GGGIR
Sbjct  428  DKEDLPCDVKILTLENTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIVDAVNGESNGGGIR  487

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LTDG WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDGTGLRRI ++G EGSE
Sbjct  488  RLTDGPWIDTMPCWSPKGDLIGFSSNRHNPENTAVFGAYVVRPDGTGLRRIQISGPEGSE  547

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++F ANL GVTAEPV++PNQFQPYGDLY+++LDGTGL+RLTW
Sbjct  548  EAARERVNHVSFNKDGDWLVFAANLSGVTAEPVTMPNQFQPYGDLYVVKLDGTGLRRLTW  607

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            NGYE+GTP WH   E+DL++L+L G+ G+KL G+F+EPLWI+ D
Sbjct  608  NGYEDGTPTWHTADELDLSQLNLNGQDGDKLEGQFEEPLWISCD  651



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P ++K+LT + TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D++NGE DGG IR
Sbjct  426  DKEELPCDVKILTLDNTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIVDAVNGESDGGEIR  485

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G WIDTMP WSP G LI FSSNRHNP +   F  YVVRPDG+GLRRI +AG EGSE
Sbjct  486  RLTEGEWIDTMPCWSPKGDLIGFSSNRHNPADTSAFGAYVVRPDGSGLRRIQIAGPEGSE  545

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++FTANL G+TAEPV++PNQFQPYGDLY+++LDGTGL+RLTW
Sbjct  546  EAARERVNHVSFNKDGDWLVFTANLCGITAEPVAMPNQFQPYGDLYVVKLDGTGLRRLTW  605

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            NGYE+GTP WH   E+DL+RLSL G+ G+KL G+F+EPLWI+ D
Sbjct  606  NGYEDGTPTWHTVDELDLSRLSLNGQDGDKLEGQFEEPLWISCD  649



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 191/228 (84%), Gaps = 2/228 (1%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D   D +E+  ++K+LT+E TGNNAFPSCSPDG+ +VFRSGRSGHKNLYIID++ GE +G
Sbjct  439  DLKSDHNEVSCDVKILTREDTGNNAFPSCSPDGESLVFRSGRSGHKNLYIIDAVEGEFNG  498

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            G IRQLT+G WIDTMPSWSP G LIAFSSNRHNP N + FSIYV+RPDG+GL+RIHVAG+
Sbjct  499  G-IRQLTEGPWIDTMPSWSPKGDLIAFSSNRHNPNNVNAFSIYVIRPDGSGLKRIHVAGS  557

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            EGS E  R R+NHVCFS D EW+LFT NLG VTAEPVS PNQFQPYGDL++ RLDG+GL 
Sbjct  558  EGSSEGERGRINHVCFSRDGEWLLFTGNLGSVTAEPVSWPNQFQPYGDLHVTRLDGSGLS  617

Query  169  RLTWNGYENGTPAWHPKAEVDLARLSLGKSGE-KLRGKFDEPLWINSD  29
            RLTWNG+ENGTPAWHP++E++L  L L +  E KL G+FD+PLWIN D
Sbjct  618  RLTWNGFENGTPAWHPRSELELDSLCLDEDVEDKLTGQFDDPLWINCD  665



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 195/229 (85%), Gaps = 7/229 (3%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D   EIPV+IK+LT E TGNNAFPSCSPDGK IVFRSGRSGHKNLYI+D++NGE +GG I
Sbjct  491  DRDAEIPVDIKILTNEDTGNNAFPSCSPDGKFIVFRSGRSGHKNLYIVDAVNGEFNGGSI  550

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LTDG WIDTMPSWSPDGK IAFSSN HNP + + FSIYV+  DG+GLRRI +AG EGS
Sbjct  551  RRLTDGPWIDTMPSWSPDGKWIAFSSNMHNPDDVEHFSIYVIGADGSGLRRIRIAGNEGS  610

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
              ++RERLNHVC+S+D EW+LFTANLGGVTAEPVS+PNQFQPYGDLYM+R+DGTGL+RLT
Sbjct  611  GRLDRERLNHVCWSADCEWLLFTANLGGVTAEPVSLPNQFQPYGDLYMVRVDGTGLRRLT  670

Query  160  WNGYENGTPAWHPK---AEVDLARL-SLGKS---GEKLRGKFDEPLWIN  35
            WNGYENGTPAW+P     E+D+ RL +L +S   G+KL+G F EPLW++
Sbjct  671  WNGYENGTPAWYPTGGDVELDMGRLMNLKRSETVGDKLKGDFIEPLWLH  719



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P ++K+LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE +GGGIR
Sbjct  427  DKEELPCDVKILTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILDAVNGESNGGGIR  486

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI +AG EGSE
Sbjct  487  RLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQIAGPEGSE  546

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W++FTANL G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTW
Sbjct  547  EAARERVNHVSFNKDGDWLVFTANLCGITAEPVAIPNQFQPYGDLYIVKVDGTGLRRLTW  606

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            NGYE+GTP WH   E+DL RLSL G+ G+KL G+F+EPLWI+ D
Sbjct  607  NGYEDGTPTWHTVDELDLTRLSLNGQDGDKLGGQFEEPLWISCD  650



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 189/225 (84%), Gaps = 1/225 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P ++K+LT   TGNNAFPSCSPDGK IVFRSGRSGHKNLYIID++NGE +GGGIR
Sbjct  427  DKEELPCDVKILTLANTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIIDAVNGESNGGGIR  486

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI +AG EGSE
Sbjct  487  RLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQIAGPEGSE  546

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ + +W++FTANL G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTW
Sbjct  547  EAARERVNHVSFNKEGDWIVFTANLCGITAEPVAIPNQFQPYGDLYVVKVDGTGLRRLTW  606

Query  157  NGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  26
            NGYE+GTP WH   E+DL +LSL G+ G+KL G+F+EPLWI+ D 
Sbjct  607  NGYEDGTPTWHTVDELDLTQLSLNGQDGDKLEGQFEEPLWISCDI  651



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   340 bits (873),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 189/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +EIP E+K+LT+E TGNNAFPSCSPDGK IVFRSGRSGHKNLYIID++ GE +G  +R
Sbjct  480  DREEIPSEVKILTREDTGNNAFPSCSPDGKSIVFRSGRSGHKNLYIIDTVYGEFNGT-VR  538

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            QLT+GAWIDTMPSWSP G LIAFSSNRHNP N   FSIYV++PDG+ LRRIHVAGAEGS 
Sbjct  539  QLTNGAWIDTMPSWSPKGDLIAFSSNRHNPDNPAVFSIYVIKPDGSDLRRIHVAGAEGSS  598

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            EV RER+NHVCFS D EW+LF +NL  VTAEPVS  NQFQPYGDL+++RLDG+GL+RLT 
Sbjct  599  EVVRERINHVCFSKDGEWLLFASNLDSVTAEPVSWANQFQPYGDLHVVRLDGSGLRRLTC  658

Query  157  NGYENGTPAWHPKAEVDLARLSLGKS-GEKLRGKFDEPLWINSDF  26
            NGYENGTPAW    E+DL RLSL K  G+KL G+FDEPLWI+ D 
Sbjct  659  NGYENGTPAWFSGNELDLDRLSLDKQVGDKLTGQFDEPLWISCDL  703



>gb|KCW58167.1| hypothetical protein EUGRSUZ_H008852, partial [Eucalyptus grandis]
Length=276

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 187/225 (83%), Gaps = 5/225 (2%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            ++  ++KVLT+E TGNNAFP+CSPDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLT
Sbjct  53   DVACDVKVLTREDTGNNAFPACSPDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLT  111

Query  508  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  329
            DG WIDTMPSWSP+  LIAFSSNRHN G+A  FSIY++RPDG+ LRR+H+AG EGS EV+
Sbjct  112  DGPWIDTMPSWSPNNDLIAFSSNRHNSGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVD  171

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  149
            RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY+ RLDG+GL+RLTWNG+
Sbjct  172  RERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVARLDGSGLKRLTWNGF  231

Query  148  ENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSDF  26
            ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ + 
Sbjct  232  ENGTPAWHSTHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCNI  276



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 190/226 (84%), Gaps = 2/226 (1%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-G  524
            DD DE+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE +GG G
Sbjct  424  DDRDEVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILDAVNGESEGGEG  483

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IR+LT+GAWIDTMP WSP G LI FSSNRH+P N   F  YVVRPDG+GLRRI +AG EG
Sbjct  484  IRRLTEGAWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYVVRPDGSGLRRIEIAGPEG  543

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            SEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+++LDGTGL+RL
Sbjct  544  SEEAARERVNHVSFNKDGDWLVFTANLGGITAEPVAIPNQFQPYGDLYVVKLDGTGLRRL  603

Query  163  TWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            TWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLWI  D
Sbjct  604  TWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLWITCD  649



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 190/225 (84%), Gaps = 2/225 (1%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-GI  521
            D +EIP E+K LT E TGNNAFPSCSPDGK +VFRSGRSG+KNLYI+D++NGE +GG GI
Sbjct  423  DKEEIPCEVKFLTLENTGNNAFPSCSPDGKSVVFRSGRSGYKNLYILDAVNGESNGGDGI  482

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G WIDTMP WSP G LI FSSNRHNP N + F  YVVRPDG+GLRRI +AG EGS
Sbjct  483  RRLTEGPWIDTMPCWSPKGDLIGFSSNRHNPTNTEAFGAYVVRPDGSGLRRIEIAGPEGS  542

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            EE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY++++DGTGL+RLT
Sbjct  543  EEAARERVNHVSFNKDGDWLVFTANLGGITAEPVTIPNQFQPYGDLYVVKVDGTGLKRLT  602

Query  160  WNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            WNGYE+GTP WH   ++DL+ LSL G+ G+KL G+F+EPLWI  D
Sbjct  603  WNGYEDGTPTWHSVDDLDLSGLSLNGQDGDKLEGQFEEPLWITCD  647



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 190/231 (82%), Gaps = 3/231 (1%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELD  533
            +D  DD +E+PV +K+LT+   GNNAFP+CSPDGK +VFRSGRSG KNLYI+D++NGE D
Sbjct  425  NDLTDDREEVPVAVKILTRSDAGNNAFPACSPDGKSLVFRSGRSGQKNLYILDAVNGESD  484

Query  532  GG-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  356
            GG GIRQLT+G W DTMP+WSPDG+LIAFSSNRH P N D FSIY++RPDGTGLRR+HVA
Sbjct  485  GGEGIRQLTEGKWTDTMPTWSPDGELIAFSSNRHAPSNPDVFSIYLIRPDGTGLRRVHVA  544

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  176
            G  GS  V+RER+NHVCFS DS+W+LFTANLG VT+EPVS PNQFQPYGDLY+ RLDGTG
Sbjct  545  GPAGSSYVDRERINHVCFSPDSKWLLFTANLGSVTSEPVSWPNQFQPYGDLYVCRLDGTG  604

Query  175  LQRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            L+RLT   YENGTPAW  +    DL  LSL   +G+KLRG+FDEPLWI  D
Sbjct  605  LRRLTCGSYENGTPAWSSRGGPDDLGSLSLRSPTGDKLRGQFDEPLWITCD  655



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 189/226 (84%), Gaps = 2/226 (1%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG-G  524
            DD DE+P E+K LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE +GG G
Sbjct  424  DDRDEVPCEVKFLTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILDAVNGESEGGEG  483

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IR+LT+G WIDTMP WSP G LI FSSNRH+P N   F  YVVRPDG+GLRRI +AG EG
Sbjct  484  IRRLTEGPWIDTMPCWSPKGDLIGFSSNRHDPSNDAAFGAYVVRPDGSGLRRIEIAGPEG  543

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            SEE  RER+NHV F+ D +W++FTANLGG+TAEPV+IPNQFQPYGDLY+++LDGTGL+RL
Sbjct  544  SEEAARERVNHVSFNKDGDWIVFTANLGGITAEPVAIPNQFQPYGDLYVVKLDGTGLRRL  603

Query  163  TWNGYENGTPAWHPKAEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            TWNGYE+GTP WH   ++ L+ LSL G+ G+KL G+F+EPLWI  D
Sbjct  604  TWNGYEDGTPTWHTVDDLGLSGLSLNGQDGDKLEGQFEEPLWITCD  649



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 185/229 (81%), Gaps = 3/229 (1%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            DG  D +E+  E+KVLT+   GNNAF +CSPDG+++VFRSGRSGHKNLYI+D++ GE  G
Sbjct  428  DGSRD-EEVKTEMKVLTRADAGNNAFAACSPDGRYLVFRSGRSGHKNLYIVDAVEGETSG  486

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            GG+R+LT+G WIDTMP WSPDG+LIAFSSNRH+P N D F IY+VRPDGTGLRR+HVAG 
Sbjct  487  GGVRRLTEGEWIDTMPVWSPDGELIAFSSNRHDPSNPDVFGIYLVRPDGTGLRRVHVAGP  546

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
             GS EV RERLNHVCFS DS W++F ANLG VTAEPVS+PN FQPYGDLY  RLDGTGL 
Sbjct  547  PGSAEVGRERLNHVCFSPDSRWLVFAANLGAVTAEPVSLPNHFQPYGDLYACRLDGTGLT  606

Query  169  RLTWNGYENGTPAWHPKAEV-DLARLSLGKS-GEKLRGKFDEPLWINSD  29
            RLT+N YENGTP WH   +V  L  LSLG   GEKLRG+FDEPLWI  D
Sbjct  607  RLTYNCYENGTPTWHSGGDVPSLGSLSLGPHVGEKLRGQFDEPLWITFD  655



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 188/225 (84%), Gaps = 3/225 (1%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            DSDE+  E+K+LTK+ TGNNAFP+CSPDGK +VFRSGR+GHKNLYI+D++ GE +G  +R
Sbjct  419  DSDEVSNEVKILTKDNTGNNAFPACSPDGKFLVFRSGRTGHKNLYIVDAMKGEFEGE-LR  477

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            QLTDG WIDTMP+WSP G LI FSSN HNP N + FSIYV+RPDG+GLRR++VAG EGS 
Sbjct  478  QLTDGPWIDTMPNWSPRGDLIVFSSNMHNPKNTEAFSIYVIRPDGSGLRRVYVAGPEGSS  537

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            EV+RER+NHVCFS D  W+LFTANL GVTAEPVS+PNQFQPYGDL+++RLDGTGL+RLT 
Sbjct  538  EVDRERINHVCFSRDGNWLLFTANLSGVTAEPVSLPNQFQPYGDLFVVRLDGTGLRRLTC  597

Query  157  NGYENGTPAWHPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSD  29
            N YENGTP W+  +E+ L+ LSL     GEKL+G FDEPLWI  D
Sbjct  598  NAYENGTPTWYYGSELALSGLSLKDEVVGEKLKGDFDEPLWIKFD  642



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   335 bits (859),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 190/230 (83%), Gaps = 4/230 (2%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D  DD +EIP E+K+LT+E TGNNAFPSCSPDGK +VFRSGRS HKNLYI+D++ GE   
Sbjct  422  DLTDDKEEIPCEVKILTEEDTGNNAFPSCSPDGKSVVFRSGRSSHKNLYIVDAIAGE--S  479

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            GGIR+LT+G WIDTMP WSP G LIAFSSNRHN GN + F  YVVRPDG+G+RRI VAG 
Sbjct  480  GGIRRLTEGPWIDTMPCWSPKGDLIAFSSNRHNQGNTEGFGAYVVRPDGSGVRRIKVAGT  539

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            EGSEE  RER+NH+ FS D EW++FTANLGGVT EPV++PNQFQPYG++Y++R+DGTGL+
Sbjct  540  EGSEEAERERINHLSFSKDGEWLVFTANLGGVTVEPVAVPNQFQPYGEVYVVRVDGTGLR  599

Query  169  RLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSDF  26
            RLTWNGYE+GTP WH    E+DL RLSL G+ G+KL G+ DEPLWI+ D 
Sbjct  600  RLTWNGYEDGTPTWHTADDELDLTRLSLDGQDGDKLTGQIDEPLWISCDL  649



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   335 bits (860),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 191/233 (82%), Gaps = 6/233 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            +GD    +I  ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE DG
Sbjct  429  NGDRGDKDITCDVKILTREETGNNAFPSCSPDGKSLVFRSGRSGHKNLYILDAVNGEFDG  488

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            G +RQLTDG WIDTMP WSP G LIAFSSNRHNP + + F+IYV+  DG+ LRRI++AG 
Sbjct  489  GSLRQLTDGPWIDTMPCWSPKGDLIAFSSNRHNPDDVNAFNIYVITSDGSELRRIYLAGP  548

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            EGS + +RER+NHVCFS D EW+LFTANLGGVTAEPV+ PNQFQPYGDLYM+RLDG+GL+
Sbjct  549  EGSGDADRERINHVCFSEDGEWLLFTANLGGVTAEPVTWPNQFQPYGDLYMVRLDGSGLR  608

Query  169  RLTWNGYENGTPAWHP--KAEVDLARLSLGKS----GEKLRGKFDEPLWINSD  29
            RLTWNGYENGTPAW    + +VD+  LSL       GE+LRG+FDEPLWI  D
Sbjct  609  RLTWNGYENGTPAWKNFGRDDVDMGPLSLAGDDRLVGEELRGQFDEPLWITCD  661



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 189/224 (84%), Gaps = 5/224 (2%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            ++  ++KVLT+E TGNNAFPSCSPDGK +VFRSGR+GHKNL+I+D+ NGE DGG IRQLT
Sbjct  425  DVACDVKVLTREDTGNNAFPSCSPDGKWLVFRSGRTGHKNLFIVDAANGEFDGG-IRQLT  483

Query  508  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  329
            DG WIDTMPSWSP+  LIAFSSNRHNPG+A  FSIY++RPDG+ LRR+H+AG EGS EV+
Sbjct  484  DGPWIDTMPSWSPNNDLIAFSSNRHNPGDASTFSIYLIRPDGSDLRRVHLAGPEGSPEVD  543

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  149
            RER+NHVCFS D EW+LFTANLGGVTAEPVS PNQFQPYG+LY++RLDG+GL+RLTWNG+
Sbjct  544  RERINHVCFSRDGEWLLFTANLGGVTAEPVSWPNQFQPYGELYVVRLDGSGLKRLTWNGF  603

Query  148  ENGTPAWHPKAEVDL----ARLSLGKSGEKLRGKFDEPLWINSD  29
            ENGTPAWH    V L    +    G   +KLRG+F+EPLWI+ D
Sbjct  604  ENGTPAWHSMHAVGLGDPWSATGEGWDEDKLRGQFEEPLWISCD  647



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 189/227 (83%), Gaps = 2/227 (1%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            + D  EIP ++K+LT+E TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE + G 
Sbjct  484  NSDLQEIPCDVKILTREDTGNNAFPSCSPDGKSLVFRSGRSGHKNLYILDAVNGEFNDG-  542

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            IR+LT G WIDTMPSWSP+G LIAFSSN HNP N D FSIYV++PDG+ LRRI+ AG +G
Sbjct  543  IRKLTAGPWIDTMPSWSPNGDLIAFSSNMHNPNNVDAFSIYVIKPDGSDLRRIYAAGPKG  602

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
            S +V+ ER+NHVCFS + EW++F AN+GGVTAEPVS PNQFQPYGDLY+MRLDG+GL+RL
Sbjct  603  SSDVDMERINHVCFSPNGEWLVFAANIGGVTAEPVSFPNQFQPYGDLYVMRLDGSGLRRL  662

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSDF  26
            T +GYENGTP WH   E+D+ RL LG  +G +L G FDEPLWI SDF
Sbjct  663  TCDGYENGTPTWHFGGELDMRRLCLGNDAGVELTGGFDEPLWITSDF  709



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 193/230 (84%), Gaps = 8/230 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D + D ++IP  +K+LT+E TGNNAF SCSPDGK +VFRSGR+G+KNLY++D++NGE +G
Sbjct  460  DLNGDKEDIPCTVKILTREDTGNNAFASCSPDGKSLVFRSGRTGNKNLYVVDAVNGEFNG  519

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            G I +LT+G  IDTMPSWSP G LIAFSSNRH P +A  FSIYV++PDG+GLRRIHVAG 
Sbjct  520  G-IHRLTEGPCIDTMPSWSPKGDLIAFSSNRHKPEDAAVFSIYVIKPDGSGLRRIHVAG-  577

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
               ++V+RER+NHVCFS+D EW+LFTANLGGVTAEPVS PNQFQPYGDLY MRLDG+GL 
Sbjct  578  ---DDVDRERINHVCFSNDGEWLLFTANLGGVTAEPVSFPNQFQPYGDLYTMRLDGSGLT  634

Query  169  RLTWNGYENGTPAWHPKAEVDLARLSLGKS---GEKLRGKFDEPLWINSD  29
            RLTWNGYENGTP WH   +VDL RL LG++   G+KL+G+FDEPLWI+ D
Sbjct  635  RLTWNGYENGTPTWHTGDDVDLGRLRLGEACEVGDKLKGQFDEPLWISCD  684



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/231 (69%), Positives = 190/231 (82%), Gaps = 8/231 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D D D +EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSGR+GHKNLYIID++NGE +G
Sbjct  436  DLDGDKEEIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSGRTGHKNLYIIDAVNGEFNG  495

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
               R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GLRR+H AG 
Sbjct  496  DA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGLRRVHAAG-  553

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
               ++V RER+NHVCFS D EW+LFTANLGGVTAEPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  554  ---DDVERERINHVCFSKDGEWLLFTANLGGVTAEPVSLPNQFQPYGDLYVVRLDGSGLR  610

Query  169  RLTWNGYENGTPAWHPKAE-VDLARLSLGKS--GEKLRGKFDEPLWINSDF  26
            RLTWNGYENGTPAW    E VD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  611  RLTWNGYENGTPAWLEGDEVVDMGRLRLENEVGGDKLKGRFEEPLWISCDF  661



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 192/234 (82%), Gaps = 14/234 (6%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            +D D+IPV+IK+LTKE TGNN FPSCSPDGK +VFRSGRSGHKNLYI+D++ GE++GG I
Sbjct  431  NDRDKIPVDIKILTKEETGNNGFPSCSPDGKSVVFRSGRSGHKNLYIVDAIKGEVEGG-I  489

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            RQLT+G WIDTMPSWSP+G+LIAFSSNRHNP N D F IY+++PDGTGLRR+ VA  E  
Sbjct  490  RQLTEGPWIDTMPSWSPNGELIAFSSNRHNPDNVDAFGIYLIKPDGTGLRRVKVA--EFE  547

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            EE  RERLNHVCFS D EW+LF ANLGGVT EPV++PN FQPYGDLY++RLDG+GL+RLT
Sbjct  548  EE--RERLNHVCFSGDGEWLLFAANLGGVTVEPVALPNHFQPYGDLYLVRLDGSGLRRLT  605

Query  160  WNGYENGTPAWHPK------AEVDLARLSLGKSG---EKLRGKFDEPLWINSDF  26
            WNGYENGTPAWHP        E+ L  LSLG      E+L+G+FDEPLWI  DF
Sbjct  606  WNGYENGTPAWHPNRVLGGAEELKLCGLSLGGGKKGEEELKGQFDEPLWIKCDF  659



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   328 bits (840),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 189/231 (82%), Gaps = 8/231 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D D D +EIP  +K+LTKE TGNNAFPSCSPDGK +VFRSGR+GHKNLYIID++NGE +G
Sbjct  487  DLDGDKEEIPCNVKILTKEDTGNNAFPSCSPDGKSLVFRSGRTGHKNLYIIDAVNGEFNG  546

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
               R+LT+G  IDTMPSWSP G LIAFSSNRHNP +   F IYV++PDG+GLRR++ AG 
Sbjct  547  DA-RRLTEGQCIDTMPSWSPKGDLIAFSSNRHNPDDVAVFGIYVIKPDGSGLRRVYAAG-  604

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
               ++V RER+NHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++RLDG+GL+
Sbjct  605  ---DDVERERINHVCFSKDGEWLLFTANLGGVIAEPVSLPNQFQPYGDLYVVRLDGSGLR  661

Query  169  RLTWNGYENGTPAW-HPKAEVDLARLSLGKS--GEKLRGKFDEPLWINSDF  26
            RLTWNGYENGTPAW     EVD+ RL L     G+KL+G+F+EPLWI+ DF
Sbjct  662  RLTWNGYENGTPAWLEGDEEVDMGRLRLDNEVGGDKLKGQFEEPLWISCDF  712



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 187/230 (81%), Gaps = 3/230 (1%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D  DD + +PV +K+LT+   GNNAFP+CSPDGK +VFRSGRSGHKNLYI+D++NGE DG
Sbjct  426  DLTDDREVVPVAVKILTRSDAGNNAFPACSPDGKSLVFRSGRSGHKNLYILDAVNGESDG  485

Query  529  G-GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
              GIR+LT+G W DTMP WSPDG+LIAFSSNRH P + D FSIY++RPDGTGLRR+HVAG
Sbjct  486  REGIRRLTEGEWTDTMPCWSPDGELIAFSSNRHAPTSPDVFSIYLIRPDGTGLRRVHVAG  545

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
              GS  V++ER+NHVCFS DS+W+LFTANLG VTAEPVS PN FQPYGDL++ RLDGTGL
Sbjct  546  PAGSCYVDKERVNHVCFSQDSKWLLFTANLGSVTAEPVSWPNHFQPYGDLFLCRLDGTGL  605

Query  172  QRLTWNGYENGTPAWHPK-AEVDLARLSL-GKSGEKLRGKFDEPLWINSD  29
            +RLT + YENGTPAW  +    DL  LSL   +G+KL+G+FDEPLWI  D
Sbjct  606  RRLTCDPYENGTPAWSSRGGPDDLETLSLRSPTGDKLQGQFDEPLWITCD  655



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 186/231 (81%), Gaps = 8/231 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D D D +++P  +K+LTKE TGNNAFPSCSPDG  +VFRSGR+GHKNLYIID+++GE + 
Sbjct  490  DLDGDKEDVPCNVKMLTKEETGNNAFPSCSPDGMSLVFRSGRTGHKNLYIIDAVDGEFND  549

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
              +RQLT+G  IDTMPSWSP G LI FSSNRHNP +A  F IYVV+PDGT LRRI VAG 
Sbjct  550  S-VRQLTEGPCIDTMPSWSPKGDLIVFSSNRHNPDDAAVFGIYVVKPDGTDLRRIPVAGN  608

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            E     +RER+NHVCFS D EW+LFTANL GVTAEPVS PNQFQPYG+LY++RLDG+GL+
Sbjct  609  ES----HRERINHVCFSKDGEWLLFTANLSGVTAEPVSWPNQFQPYGELYVVRLDGSGLR  664

Query  169  RLTWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  26
            RLTWNGYENGTPAWH    E+D+  L LG    G++L+G+F+EPLWI+ DF
Sbjct  665  RLTWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGRFEEPLWISCDF  715



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 185/231 (80%), Gaps = 8/231 (3%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D D D +++P  +K LT E TGNNAFPSCSPDG  +VFRSGR+GHKNLYIID+++GE +G
Sbjct  436  DJDGDKEDVPCNVKXLTXEETGNNAFPSCSPDGMSLVFRSGRTGHKNLYIIDAVDGEFNG  495

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
              +RQLT+G  IDTMPSWSP G LIAFSSNRHNP +A  F IYVV+PDGTGLRRI VAG 
Sbjct  496  S-VRQLTEGPCIDTMPSWSPKGDLIAFSSNRHNPDDAAVFGIYVVKPDGTGLRRIPVAGN  554

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            E     +RER+NHVCFS D EW+LFTANL GV AEPVS+PNQFQPYGDLY++R DG+GL+
Sbjct  555  ES----HRERINHVCFSKDXEWLLFTANLSGVIAEPVSLPNQFQPYGDLYVVRXDGSGLR  610

Query  169  RLTWNGYENGTPAWHPKA-EVDLARLSLGKS--GEKLRGKFDEPLWINSDF  26
            RLTWNGYENGTPAWH    E+D+  L LG    G++L+G+F++P WI+ DF
Sbjct  611  RLTWNGYENGTPAWHEGGDELDMGGLRLGNEVGGDELKGQFEDPHWISCDF  661



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 183/230 (80%), Gaps = 5/230 (2%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            D+++D++ V +KVLT+   GN+AFP+ SP G+ +VFRSGRSGHKNLYIID+ +GE +   
Sbjct  444  DNNNDKVDVALKVLTRPEAGNDAFPAVSPCGRWVVFRSGRSGHKNLYIIDAAHGENEPAT  503

Query  523  --IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
              I++LTDG WIDTMP W+PDGKL+AFSSNRH+PGNA  FSIY+VRPDGTGLRR+HVAG 
Sbjct  504  APIQRLTDGEWIDTMPCWAPDGKLVAFSSNRHDPGNAAVFSIYLVRPDGTGLRRVHVAGP  563

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
             GSEE ++ER+NHVCFS D EW+LFTANLGGV AEPVS PNQFQPYGDLY+ RLDG+GL 
Sbjct  564  PGSEEADKERINHVCFSPDGEWLLFTANLGGVNAEPVSGPNQFQPYGDLYVCRLDGSGLV  623

Query  169  RLTWNGYENGTPAWHPKAEVDLARLSLG---KSGEKLRGKFDEPLWINSD  29
            RLT N YENGTPAW P  +++    SLG    + E   G+FDEPLW+  D
Sbjct  624  RLTCNAYENGTPAWGPALDLEDGVGSLGLGNPAAEDSLGEFDEPLWLTCD  673



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   308 bits (790),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 177/227 (78%), Gaps = 6/227 (3%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG---I  521
            DE+   +KVLT+   GN+AFP+ SP GK +VFRSGRSGHKNLYI+D+ +GE  G G   I
Sbjct  432  DEVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSGRSGHKNLYIVDAAHGEDVGAGEGTI  491

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  FSIY+VRPDG+GLRR+HVAG  GS
Sbjct  492  RRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGPAGS  551

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
               +RER+NHVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT
Sbjct  552  AAADRERINHVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLT  611

Query  160  WNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  29
             N YENGTPAW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  612  CNAYENGTPAWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  658



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 179/230 (78%), Gaps = 19/230 (8%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
            V+IK++TK+ TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D++ GE D   IRQLT+G 
Sbjct  446  VKIKIMTKQDTGNNAFPACSPDGKLVVFRSGRSGHKNLYIMDAVEGE-DSNNIRQLTNGP  504

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  320
            WIDTMPSWSPDGKLIAFSSNRH+P N   F IY+V  DG+ L+R+HV+      +V  ER
Sbjct  505  WIDTMPSWSPDGKLIAFSSNRHDPSNMVTFGIYLVAVDGSDLKRVHVS------DVAMER  558

Query  319  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  140
            +NHVCFS + EW+LFTAN+GGVTAEPVS PNQFQPYGDL++ +LDGTGL+RLTW+GYENG
Sbjct  559  INHVCFSPNGEWLLFTANMGGVTAEPVSFPNQFQPYGDLFIAKLDGTGLRRLTWSGYENG  618

Query  139  TPAWHPKAEVDLARLSLGKSG------------EKLRGKFDEPLWINSDF  26
            TPAWH +  +D+   +L   G            +KL+GKFDEPLWI  DF
Sbjct  619  TPAWHSRQLLDIPLGNLSLEGIEKADAHHQVDADKLKGKFDEPLWITCDF  668



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 176/227 (78%), Gaps = 6/227 (3%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG---I  521
            DE+   +KVLT+   GN+AFP+ SP GK +VFRSGRSGHKNLYI+D+ +GE  G G   I
Sbjct  432  DEVAATLKVLTRPEAGNDAFPAVSPCGKWVVFRSGRSGHKNLYIVDAAHGEDVGAGEGTI  491

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LTDG WIDTMPSWSPDG LIAFSSNRH+P NA  FSIY+VRPDG+GLRR+HVAG  GS
Sbjct  492  RRLTDGEWIDTMPSWSPDGSLIAFSSNRHDPTNAAVFSIYLVRPDGSGLRRVHVAGPAGS  551

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
               +RER+NHVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT
Sbjct  552  AAADRERINHVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLT  611

Query  160  WNGYENGTPAWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  29
             N YENGTPAW P +     L  LSL   +G++  G+FDEPLW+  D
Sbjct  612  CNAYENGTPAWGPASSPAAGLESLSLVPGAGDESLGEFDEPLWLTCD  658



>ref|XP_010456117.1| PREDICTED: uncharacterized protein LOC104737601 [Camelina sativa]
Length=426

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D +E+P ++K+LT + TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D++NGE +GGGIR
Sbjct  229  DKEELPCDVKILTLDNTGNNAFPSCSPDGKSVVFRSGRSGHKNLYILDAVNGESNGGGIR  288

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G WIDTMP WSP G LI FSSNRHNP N   F  YVVRPDG+GLRRI +AG EGSE
Sbjct  289  RLTEGPWIDTMPCWSPKGDLIGFSSNRHNPENTAAFGAYVVRPDGSGLRRIQIAGLEGSE  348

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
            E  RER+NHV F+ D +W +FTANL G+TAEPV+IPNQFQPYGDLY++++DGTGL+RLTW
Sbjct  349  EAARERVNHVSFNKDGDWTVFTANLCGITAEPVAIPNQFQPYGDLYVVKVDGTGLRRLTW  408

Query  157  NGYENGT  137
            NGYE+GT
Sbjct  409  NGYEDGT  415



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 173/222 (78%), Gaps = 8/222 (4%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D  ++I  +IK+LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNLYI+D+ NGE   GGI
Sbjct  426  DSQEDITAKIKILTKEETGNNAFPSCSPDGKFLVFRSGRSGHKNLYIMDATNGE--DGGI  483

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            RQLT+G WIDTMPSWSPDGK IAFSSNRH+P N + F IYV+ PDGTGLRR+HVA     
Sbjct  484  RQLTEGPWIDTMPSWSPDGKFIAFSSNRHSPENTEVFGIYVIHPDGTGLRRVHVA-----  538

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            E+++  R NHVCFS DS+W+LFTAN G V+AEP+S+PNQFQPYGDLY+  L+GT L+RLT
Sbjct  539  EDMDMVRTNHVCFSPDSKWLLFTANFGAVSAEPISLPNQFQPYGDLYVCGLEGTHLKRLT  598

Query  160  WNGYENGTPAWHP-KAEVDLARLSLGKSGEKLRGKFDEPLWI  38
             N YENGTPAWH      D+  L L   GE L+G F EP W+
Sbjct  599  CNAYENGTPAWHSGDGGPDIGSLCLNDVGEDLKGDFGEPHWL  640



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 181/231 (78%), Gaps = 5/231 (2%)
 Frame = -2

Query  715  TDDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL  536
            TDDG  +  E+   ++ LT+   GN+AFP+ SP G+ +VFRSGR+GHKNLY++D+  GE 
Sbjct  439  TDDGRGEG-EVRATVRPLTRPEAGNDAFPAVSPCGRWLVFRSGRTGHKNLYVVDTARGE-  496

Query  535  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  356
              GG+R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+GLRR++VA
Sbjct  497  -EGGVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSGLRRVYVA  555

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  176
            GAEGS E ++ER+NHVCFS DS+W+LFTANLG V AEP+S PNQFQPYGDLY+ RLDG+ 
Sbjct  556  GAEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQFQPYGDLYVCRLDGSD  615

Query  175  LQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDEPLWINSD  29
            L+RLT N YENGTP W P  A + L  LS+G  SGE   G+FDEPLW+  D
Sbjct  616  LRRLTCNAYENGTPVWGPASAGLGLESLSMGPPSGEDALGQFDEPLWLTCD  666



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 177/225 (79%), Gaps = 7/225 (3%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            +D +EIP  I +LT+E TGNNAFPSCSPDGK +VFRSGRSG+KNLYI+D+L+GE +GG +
Sbjct  434  EDCEEIPFTINILTREETGNNAFPSCSPDGKFVVFRSGRSGYKNLYIMDALDGEFNGG-L  492

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA-GAEG  344
            R+LT+G WIDTMP WSP G  IAFSSNRH+ GN++ F IYVVRPDG+ LRR+ V  G +G
Sbjct  493  RRLTEGEWIDTMPCWSPKGDWIAFSSNRHDAGNSEVFGIYVVRPDGSDLRRVEVGKGVDG  552

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                 RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDL+++RLDG+GL+RL
Sbjct  553  E----RERLNHVCFSGDGEWLLFTANLGGVMAEPVSMPNQFQPYGDLFVVRLDGSGLKRL  608

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  29
            T N YENGTP WH +    L R   G   + L+G F+EPLWI  +
Sbjct  609  TCNAYENGTPMWHAREGAALLRSGKGDE-DVLKGGFEEPLWITCE  652



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 179/228 (79%), Gaps = 10/228 (4%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD +E+P ++ +LT+E TGNNAFP+CSPDGK +VFRSGRSGHKNLYI+D + GE +GG I
Sbjct  465  DDREEVPFKLTILTREETGNNAFPACSPDGKSVVFRSGRSGHKNLYIVDGVEGEFNGG-I  523

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA-GAEG  344
            R+LT+GAWIDTMP WSP G LIAFSSNRH P N++ F IY+VRPDG+GLRR+ VA G EG
Sbjct  524  RRLTEGAWIDTMPCWSPKGDLIAFSSNRHEPKNSEVFGIYLVRPDGSGLRRVEVAMGVEG  583

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                 RERLNHV FS D EW++FTANLGGVTAEP+ +PNQFQPYGDLY++R+DG+GL+RL
Sbjct  584  G----RERLNHVSFSGDGEWLVFTANLGGVTAEPIGLPNQFQPYGDLYVVRVDGSGLRRL  639

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGE---KLRGKFDEPLWINSD  29
            T N YENGTP WH   ++ L  +     GE   KL+ +F EPLWI  D
Sbjct  640  TCNAYENGTPTWH-NGDLVLCHVDGDGEGENWDKLKAEFAEPLWITCD  686



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   300 bits (767),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 176/228 (77%), Gaps = 16/228 (7%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D  DD DEIPV+IK LTKE TGNNAFPSCSPDGK +VFRSGRSGHKNL+++D+L GE  G
Sbjct  421  DLSDDRDEIPVDIKFLTKENTGNNAFPSCSPDGKSVVFRSGRSGHKNLFVVDALEGEF-G  479

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
            G IRQLTDG WIDTMP WSPDGKLIAFSSNRH       F IY++  DG+GLRR+  AG+
Sbjct  480  GDIRQLTDGPWIDTMPCWSPDGKLIAFSSNRHT-SKEGAFGIYLINSDGSGLRRVKFAGS  538

Query  349  EGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQ  170
            +  EE  RERLNHVCFS DSEW+LFT+N  GVTAEPVS+PN FQPYGDLY  RLDG+GL+
Sbjct  539  D--EE--RERLNHVCFSPDSEWLLFTSNFAGVTAEPVSLPNHFQPYGDLYTARLDGSGLR  594

Query  169  RLTWNGYENGTPAWHPKAEVDLARLSLGKSG----EKLRGKFDEPLWI  38
            RLT+NGYENGTPAW      D   L + K      ++L G+F+EPLW+
Sbjct  595  RLTFNGYENGTPAW------DREFLQVSKRHAADEDELEGQFEEPLWL  636



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 181/232 (78%), Gaps = 16/232 (7%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            +D +E+P ++ +LT+E TGNNAFPSCSPDGK IVFRSGR G+KNLYI+D++ GE DGG I
Sbjct  480  NDREEVPFKLTILTREDTGNNAFPSCSPDGKSIVFRSGREGYKNLYIVDAVKGEFDGG-I  538

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA-GAEG  344
            R+LT+G WIDTMP WSP G LIAFSSNRH+P N++ F IY+V P+G+GLRR+ VA G EG
Sbjct  539  RRLTEGEWIDTMPCWSPKGDLIAFSSNRHDPKNSEVFGIYLVGPNGSGLRRVEVAKGVEG  598

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                 +ERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDLY++RLDG+GL+RL
Sbjct  599  M----KERLNHVCFSRDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLYVVRLDGSGLRRL  654

Query  163  TWNGYENGTPAWHPKAEVDLARLSL-------GKSGEKLRGKFDEPLWINSD  29
            T N YENGTP WH     DLA  +        G+  +KL+G+F EPLWI  D
Sbjct  655  TCNAYENGTPTWH---HGDLALCAPREDDGEGGQDWDKLKGEFQEPLWITCD  703



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 174/225 (77%), Gaps = 6/225 (3%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD  ++ V +K LT+   GN+AFP+ SP G+ +VFRSGRSGHKNLYI+D+  GE     I
Sbjct  434  DDRGDVDVAVKELTRPEAGNDAFPAVSPCGRWVVFRSGRSGHKNLYIVDAARGEET---I  490

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSIY+VRPDGTGLRR+HVAG  GS
Sbjct  491  RRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSIYLVRPDGTGLRRVHVAGPAGS  550

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
             E ++ER+NHVCFS D +W+LFTANLGGV AEP+S PNQFQPYGDLY+ RLDG+G+ RLT
Sbjct  551  AEADKERINHVCFSPDGQWLLFTANLGGVMAEPISGPNQFQPYGDLYVCRLDGSGVLRLT  610

Query  160  WNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  29
             N YENGTP W P   VD   LSLG  + +   G+FDEPLW+  +
Sbjct  611  CNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEPLWLTCN  653



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 182/233 (78%), Gaps = 6/233 (3%)
 Frame = -2

Query  715  TDDGDDDSD-EIPVE-IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNG  542
             D  DDDS  E+ V  ++ LT+   GN+AFP+ SP G+ +VFRSGR+GHKNLY++D+  G
Sbjct  438  ADLTDDDSRVEVGVATVRPLTRPEAGNDAFPAVSPCGRWLVFRSGRTGHKNLYVVDTARG  497

Query  541  ELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIH  362
            E   GG+ +LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+GLRR++
Sbjct  498  E--DGGVLRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSGLRRVY  555

Query  361  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDG  182
            VAG EGS E ++ER+NHVCFS DS+W+LFTANLG V AEP+S PNQFQPYGDLY+ RLDG
Sbjct  556  VAGPEGSAEADKERINHVCFSPDSQWLLFTANLGSVVAEPISGPNQFQPYGDLYVCRLDG  615

Query  181  TGLQRLTWNGYENGTPAWHP-KAEVDLARLSLG-KSGEKLRGKFDEPLWINSD  29
            +GL+RLT N YENGTPAW P  A + L  L++G  +GE   G+FDEPLW+  D
Sbjct  616  SGLRRLTCNAYENGTPAWGPASAGLGLESLAIGPPAGEDALGQFDEPLWLTCD  668



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 173/225 (77%), Gaps = 6/225 (3%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD  ++ V +K LT+   GN+AFP+ SP G+ +VFRSGRSGHKNLYI+D+  GE     I
Sbjct  434  DDRGDVDVAVKELTRPEAGNDAFPAVSPCGRWVVFRSGRSGHKNLYIVDAARGEET---I  490

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R++TDG WIDTMPSWSPDG+LIAFSSNRH P NA  FSIY+VRPDGTGLRR+HVAG  GS
Sbjct  491  RRVTDGEWIDTMPSWSPDGELIAFSSNRHEPANAAVFSIYLVRPDGTGLRRVHVAGPAGS  550

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
             E ++ER+NHVCFS D +W+LFTA LGGV AEP+S PNQFQPYGDLY+ RLDG+G+ RLT
Sbjct  551  AEADKERINHVCFSPDGQWLLFTATLGGVMAEPISGPNQFQPYGDLYVCRLDGSGVLRLT  610

Query  160  WNGYENGTPAWHPKAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  29
             N YENGTP W P   VD   LSLG  + +   G+FDEPLW+  +
Sbjct  611  CNAYENGTPTWGPALGVD--SLSLGAPAADDSLGQFDEPLWLTCN  653



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   293 bits (749),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 176/230 (77%), Gaps = 5/230 (2%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG--  530
            DD  +     ++ LT+   GN+AFP+ SP G+ +VFRSGR+GHKNLY+ID+  GE +   
Sbjct  436  DDRKEVSAATVRALTRPEAGNDAFPAVSPCGRWLVFRSGRTGHKNLYVIDTARGEEEEGG  495

Query  529  -GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
               +R+LT+G WIDTMPSWSPDG LIAFSSNRH+P N   FSIY+VRPDG+ LRR++VAG
Sbjct  496  GAAVRRLTEGEWIDTMPSWSPDGSLIAFSSNRHDPANPAVFSIYLVRPDGSRLRRVYVAG  555

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
             EGS E ++ER+NHVCFS DS W+LFTANLGGV AEPVS PNQFQPYGDLY+ RLDG+GL
Sbjct  556  PEGSAEADKERINHVCFSPDSRWLLFTANLGGVMAEPVSGPNQFQPYGDLYVCRLDGSGL  615

Query  172  QRLTWNGYENGTPAWHP-KAEVDLARLSLGK-SGEKLRGKFDEPLWINSD  29
            QRLT N YENGTPAW P  A + +  +SLG  +GE   G+FDEPLW+  D
Sbjct  616  QRLTCNAYENGTPAWGPSSAGLGVEAMSLGAPAGEDPMGQFDEPLWLTCD  665



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 171/232 (74%), Gaps = 8/232 (3%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELD  533
            D    D +EIP  +K+LTK  +GNNAFPSCSPDGK IVFRSGR+G KNLYI+D++NGE  
Sbjct  422  DHLSKDREEIPFTLKILTKYDSGNNAFPSCSPDGKFIVFRSGRTGFKNLYIVDAVNGEEV  481

Query  532  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
             GG+R+LT+G WIDTMP WSP G LIAFSSNRH+  N++ F IYVV  DG+G+RR+ +  
Sbjct  482  DGGLRRLTEGEWIDTMPCWSPKGDLIAFSSNRHDAKNSEVFGIYVVNVDGSGVRRVEIGK  541

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
                E   RERLNHVCFS D EW+LFTANLGGV+AEPV +PNQFQPYGDL++++LDG+GL
Sbjct  542  GVDGE---RERLNHVCFSGDGEWLLFTANLGGVSAEPVGLPNQFQPYGDLFVVKLDGSGL  598

Query  172  QRLTWNGYENGTPAWHPKAEVDLA----RLSLGKSGEKLRGKFDEPLWINSD  29
            +RLT N YENGTP WH   E+ L             +KL+G F EPLWI  D
Sbjct  599  RRLTCNAYENGTPTWH-HGELLLCNDGDEDGDNGDWDKLKGAFQEPLWITCD  649



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 173/230 (75%), Gaps = 11/230 (5%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D  DEI   +K+LTKE TGNNAFPSCSPDGK +VFRSGRSG+KNLYIID+++GE   G I
Sbjct  426  DSKDEISTHVKILTKEGTGNNAFPSCSPDGKFLVFRSGRSGYKNLYIIDAIDGE--DGSI  483

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G WIDTMP WSPDGK IAFSSNR +P +   FS+Y+  PDGT L  +HV  A   
Sbjct  484  RRLTEGPWIDTMPHWSPDGKYIAFSSNRESPKSTQGFSVYLTNPDGTDLHHVHVTAASAF  543

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
             E+ +ER+NHVCFS DS+++LFTANLG V AE +S+PNQFQPYGDLY+  LDG+GL+RLT
Sbjct  544  NEMAKERINHVCFSPDSKFLLFTANLGAVNAEAISLPNQFQPYGDLYICGLDGSGLRRLT  603

Query  160  WNGYENGTPAWH-----PKAEVDLARLSLGKSGEKLRGKFDEPLWINSDF  26
             N YE+GTPAW+     P+    L  +     GE+L+G+F+EPLW+ S F
Sbjct  604  CNAYEDGTPAWNSGWWGPEPGSSLEDV----VGEELKGEFEEPLWLGSTF  649



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 170/226 (75%), Gaps = 13/226 (6%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD++EIP  + +LT+  TGNNAFPSCSPDGK IVFRSGRSG    Y +D++NGE +G  +
Sbjct  429  DDNEEIPFTLTILTRNDTGNNAFPSCSPDGKSIVFRSGRSG----YTVDAVNGEFNGS-L  483

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G WIDTMP WSP G +IAFSSN HNP N + F IYVV PDG GLRRI VA     
Sbjct  484  RRLTEGNWIDTMPCWSPKGDVIAFSSNMHNPENGEGFGIYVVGPDGNGLRRIEVAKGV--  541

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
             E  RERLNHVCFS D EW+LFTANLGGV AEPVS+PNQFQPYGDLY++RLDG+GL+RLT
Sbjct  542  -EAERERLNHVCFSGDGEWLLFTANLGGVQAEPVSLPNQFQPYGDLYVVRLDGSGLRRLT  600

Query  160  WNGYENGTPAWHPKAEVDLARLSLGKSG--EKLRGKFDEPLWINSD  29
             N YENGTP WH +   DL   S    G  +K++G+F EPLWI  +
Sbjct  601  CNSYENGTPTWHDR---DLVLCSGDGDGDRDKVKGEFQEPLWITCE  643



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG  530
            D   D +EIP ++K+LT E +GNNAFP+CSPDGK++VFRSGRSGHKNLYI+D++ GE  G
Sbjct  367  DLKPDRNEIPCDVKMLTGEDSGNNAFPACSPDGKYLVFRSGRSGHKNLYIMDAVEGEFKG  426

Query  529  GGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGA  350
              IR LT+GA IDTMP WSP G LIAFSSNRH P +A+ FSIYV++PDG+GLRRIH+ G+
Sbjct  427  D-IRPLTEGACIDTMPCWSPKGDLIAFSSNRHKPEHANPFSIYVIKPDGSGLRRIHLEGS  485

Query  349  EGSEEVN---RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  179
            E   E      ER+NHV FSSD EW+LFTANLGG++AEPV++P Q QPYGD+Y+ RLDG+
Sbjct  486  ERLSEEEREWMERINHVTFSSDGEWLLFTANLGGLSAEPVAVPRQIQPYGDIYVARLDGS  545

Query  178  GLQRLTWNGYENGTPAWHP  122
            GL+RLTWNGYENGTP W+P
Sbjct  546  GLRRLTWNGYENGTPVWYP  564



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 170/231 (74%), Gaps = 12/231 (5%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            +D +EIP  +K+LTK+ +GNNAFPSCSPDGK +VFRSGRSG KNLYI+D++NGE DGG +
Sbjct  428  NDQEEIPYTLKILTKDDSGNNAFPSCSPDGKFVVFRSGRSGFKNLYIVDAVNGEFDGG-L  486

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G WIDTMP WSP G LIAFSSNRH+ GN+  F IYVVR DG+GLRR+ V      
Sbjct  487  RRLTEGEWIDTMPCWSPKGDLIAFSSNRHDGGNSQAFGIYVVRVDGSGLRRVEVGKGVDG  546

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            E   RE LNHV FS D EW+LFT NL G+TAEP SIPNQ+QPYGDL++++LDG+GL+RLT
Sbjct  547  E---REMLNHVRFSGDGEWLLFTGNLVGLTAEPASIPNQYQPYGDLFVVKLDGSGLRRLT  603

Query  160  WNGYENGTPAWH--------PKAEVDLARLSLGKSGEKLRGKFDEPLWINS  32
             N YENGTPAWH           + D          +KL+G F+E LWI +
Sbjct  604  CNAYENGTPAWHYGDLLLSNDDDDDDDDDDGDACDWDKLKGAFEESLWITT  654



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 154/214 (72%), Gaps = 12/214 (6%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            +KVL+K  T NNAFPSCSPDGK++VFRSGRSGHKNLYI+D+  GE   GGIR LT+G W+
Sbjct  457  VKVLSKPGTNNNAFPSCSPDGKNLVFRSGRSGHKNLYIMDAELGE--DGGIRALTEGPWV  514

Query  493  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  314
            DTMP WSPDG  IAFSS+R  P N + F+IY+V PDG+ L R+        E   R R N
Sbjct  515  DTMPCWSPDGNWIAFSSSRDGPSN-EFFAIYLVHPDGSELHRVF------PESSTRGRCN  567

Query  313  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            HVCFS DS+ +LFTA+ GG++AEPVS+ NQFQPYG+L+  +LDG+ L+R T N YE+GTP
Sbjct  568  HVCFSPDSQTLLFTADCGGISAEPVSLANQFQPYGELFSCKLDGSELRRWTHNAYEDGTP  627

Query  133  AWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINS  32
             W P   + L   S+ K G++L   F + LW+++
Sbjct  628  CWGP---LRLDPSSISKQGQELHANFQDCLWLSA  658



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 13/215 (6%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGA  569

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  320
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  319  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  140
            +NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  139  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   217 bits (552),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 148/215 (69%), Gaps = 13/215 (6%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
            V+ K+LTK  T NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+GA
Sbjct  512  VKWKILTKSGTKNNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAIHGE--EASLRRLTEGA  569

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  320
            W DTM SWS DG+ IAFSS+RHNPG    F +Y VRPDG+ L R+  +   G       R
Sbjct  570  WTDTMASWSHDGEWIAFSSDRHNPGGG-SFQLYFVRPDGSQLHRVLNSSTGG-------R  621

Query  319  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  140
            +NH  FS DS  ++FT +  GV+A+P+++P QFQPYG+++M R+DG+ L RLT N YE+G
Sbjct  622  VNHPFFSPDSRSLVFTTDYAGVSADPIAVPAQFQPYGEIFMARIDGSELVRLTHNAYEDG  681

Query  139  TPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            TP+W P   V L   +L   G+K R  F +  W+ 
Sbjct  682  TPSWGP---VKLDSSALTGEGKKARCGFRDTRWLK  713



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 153/220 (70%), Gaps = 15/220 (7%)
 Frame = -2

Query  694  SDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            + E  +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ Q
Sbjct  498  TSESEISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGE--EGGLWQ  553

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            LT+G W DTM +WSPDG+ IAF+S+R +PG+   F++Y + P+GTGL R+  +   G   
Sbjct  554  LTEGPWTDTMCNWSPDGEWIAFASDRDSPGSGG-FAMYFIHPNGTGLHRVLNSSTAG---  609

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
                R+NH  FS DS+ ++FT++  GV+AEP+S+P+QFQPYG+++M R+DG+ LQRLT N
Sbjct  610  ----RVNHPWFSPDSKSLVFTSDYAGVSAEPISVPHQFQPYGEIFMARVDGSELQRLTHN  665

Query  154  GYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
             YE+GTP+W     + +A   L   GE ++  FD+  W+ 
Sbjct  666  AYEDGTPSW---GRIFIAASDLTGEGESVKCDFDDDHWLQ  702



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 143/197 (73%), Gaps = 11/197 (6%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELD  533
            DD DDD     V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE  
Sbjct  471  DDNDDDGSIYQVSIKKLTVGGE-NNAFPSPSPDGKWLVFRSGRSGHKNLYIMDAEEGE--  527

Query  532  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
             GGIR+LTDG W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+ TGLRR+ V  
Sbjct  528  AGGIRRLTDGPWTDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNSTGLRRV-VHS  585

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
            A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GL
Sbjct  586  ADGG------RTNHPWFSPDSKRMVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGL  639

Query  172  QRLTWNGYENGTPAWHP  122
            QRLT N +E+GTP+W P
Sbjct  640  QRLTHNSFEDGTPSWTP  656



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/228 (50%), Positives = 155/228 (68%), Gaps = 21/228 (9%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GD D D+  V IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   G
Sbjct  465  GDGDGDDPSVSIKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AG  521

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            GIR+LT+G W DTM +WSPDG+ IAF+S+RHNPG    F+IY+V P+GTGLRR+ V  A+
Sbjct  522  GIRRLTEGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYMVHPNGTGLRRV-VHSAD  579

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++R
Sbjct  580  GG------RTNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRR  633

Query  166  LTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  35
            LT N +E+GTP+W P        L     GE L+      F++  W+N
Sbjct  634  LTHNSFEDGTPSWTPY------HLKAEDVGETLQASGTCAFEDCHWLN  675



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 148/204 (73%), Gaps = 13/204 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE +G  +++LT+G W DTM +WSPDG
Sbjct  478  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVHGEKNG--LKRLTEGPWSDTMCNWSPDG  535

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+RH+PG+   F IY++ PDGTGLR++  +G+ G       R NH  FS D + 
Sbjct  536  EWIAFASDRHDPGSG-SFEIYLIHPDGTGLRKLIHSGSGG-------RTNHPYFSPDGKS  587

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  588  MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  646

Query  103  ARLSLGKSGEKLRGKFDEPLWINS  32
              + + K G      F++  W+N+
Sbjct  647  VNVEMPKGGPYC--SFEDCHWLNN  668



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE  G  +R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGERKG--LRRLTEGPWTDTMCNWSPDG  541

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            K IAF+S+RH PG+   F++Y++  DG+GLR++  +G+ G       R NH  FS D + 
Sbjct  542  KWIAFASDRHAPGSG-SFALYLIEADGSGLRKVFESGSGG-------RTNHPYFSPDGKS  593

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G+QRLT N YE+GTPAW PK
Sbjct  594  LTFTSDYAGISAEPISNPHHYQPYGEIFSVRLDGSGIQRLTHNSYEDGTPAWSPK  648



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 144/195 (74%), Gaps = 13/195 (7%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GD +S ++ ++   L  +   NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   G
Sbjct  517  GDGESSQVSIKKLTLGGK---NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AG  571

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            GI +LT+G W DTM +WSPDG+ IAF+S+RHNPG    F+IY++ P+GTGLRR+ V  A+
Sbjct  572  GIHRLTNGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFAIYLIHPNGTGLRRL-VHSAD  629

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +QPYG+++ + +DG+GLQR
Sbjct  630  GG------RTNHPWFSPDSKSIVFTSDLAAVSAEPISNPHHYQPYGEIFTINIDGSGLQR  683

Query  166  LTWNGYENGTPAWHP  122
            LT N +E+GTP+W P
Sbjct  684  LTHNSFEDGTPSWTP  698



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 142/222 (64%), Gaps = 12/222 (5%)
 Frame = -2

Query  715  TDDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL  536
            +D  D  +DE     K LTKE TGNNAFP  SPDGK++VFRSGR+G KNLYI+D+  GE 
Sbjct  464  SDTADLGADETSHNYKYLTKEGTGNNAFPCPSPDGKYVVFRSGRTGRKNLYIMDAAGGEE  523

Query  535  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  356
                +R+LT+G W DTMP+WSPD + IAFSSNR +P     FS+Y++RP+GT L  +   
Sbjct  524  KY--LRRLTEGRWRDTMPAWSPDNEWIAFSSNRAHPTGERSFSLYLIRPNGTDLHMLLDT  581

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  176
            G  G          H  FS DS+ + FT+N  GV+AEP+S P+ +QPYG ++++ +DGTG
Sbjct  582  GVGGLAM-------HAVFSPDSKRIAFTSNWAGVSAEPISFPHAYQPYGTIFVINIDGTG  634

Query  175  LQRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDE  50
            L RLT N YE+GTP W     + L + ++   G +    FD+
Sbjct  635  LTRLTHNAYEDGTPTW---GRLPLPKPAISSDGRRSSCDFDD  673



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 131/174 (75%), Gaps = 10/174 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D++ GE   GG+R+LT+G W DTM +WSPDG
Sbjct  501  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDAIEGE--AGGLRRLTEGPWTDTMCNWSPDG  558

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              IAF+S+R NPG+   F +Y++ P+GTGLRR+  +G+ G       R NH  FS D  +
Sbjct  559  DWIAFASDRDNPGSG-SFELYLIHPNGTGLRRLVKSGSAG-------RANHPSFSPDGTY  610

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            V+FT++  G++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  611  VVFTSDFAGISAEPISNPHHYQPYGEIFTIKLDGSDLKRLTHNSYEDGTPTWAP  664



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 146/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+++GE     +R+LT+G W DTM +WSPDG
Sbjct  516  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAVDGE--KKELRRLTEGPWTDTMCNWSPDG  573

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+RH+PG+   F IY++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  574  EWIAFASDRHDPGSGS-FEIYLIHPNGTGLRKLIQSGSGG-------RTNHPYFSPDGKS  625

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            + FT++  G++AEP+S P+ +QPYG+++ +RLDG+G++RLT N YE+GTPAW PK    +
Sbjct  626  LTFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGIKRLTHNSYEDGTPAWSPKY---M  682

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
              +++ K G      FD+  W+N
Sbjct  683  PPVNVPKGGPYC--SFDDCHWLN  703



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   201 bits (510),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 141/193 (73%), Gaps = 11/193 (6%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD DE  + +K LT     NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGI
Sbjct  464  DDDDESTISMKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGI  520

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G 
Sbjct  521  RRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-  578

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT
Sbjct  579  ------RTNHPWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLT  632

Query  160  WNGYENGTPAWHP  122
             N +E+GTP+W P
Sbjct  633  HNSFEDGTPSWTP  645



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 141/193 (73%), Gaps = 11/193 (6%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD DE  + +K LT     NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   GGI
Sbjct  464  DDDDESTISMKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AGGI  520

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            R+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  G 
Sbjct  521  RRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGGSG-  578

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++RLT
Sbjct  579  ------RTNHPWFSPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVDIDGSNIRRLT  632

Query  160  WNGYENGTPAWHP  122
             N +E+GTP+W P
Sbjct  633  HNSFEDGTPSWTP  645



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELD  533
            D+ DDD+      IK LT     NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ GE  
Sbjct  488  DEDDDDAGNAQPSIKKLTTGG-ANNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEGE--  544

Query  532  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
              GI +LT+G W DTM +WSPDG+ IAF+S+R NPG    F+IY+V P+GTGLRR+  +G
Sbjct  545  SAGIHRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGGG-SFAIYMVHPNGTGLRRVVHSG  603

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
            + G       R NH  FS DS+ ++FT++ G V+AEP+S P+ +QPYG+++ + +DG+ +
Sbjct  604  SGG-------RTNHPWFSPDSKSLVFTSDYGAVSAEPISNPHHYQPYGEIFTVGIDGSDI  656

Query  172  QRLTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRG----KFDEPLWIN  35
            +RLT N +E+GTP W P        L      E L+G    +FD+  W+N
Sbjct  657  RRLTHNSFEDGTPTWTPYF------LEPADVAESLQGSAWCEFDDCHWLN  700



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 141/203 (69%), Gaps = 14/203 (7%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D++ GE     I +LTDG W DTM +WSPDG
Sbjct  502  NNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAIEGETSW--IERLTDGPWTDTMCNWSPDG  559

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              IAFSS+RH+PG+   F +Y++ P+GTGLRR+  +G+ G       R+NH  F  D + 
Sbjct  560  DWIAFSSDRHDPGSGS-FELYMIHPNGTGLRRLLRSGSSG-------RVNHPSFRPDGKL  611

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++FT + GG++AEP+S P+ +QPYG+++ M+LDG+ L+RLT N YE+GTP W P   ++ 
Sbjct  612  LVFTTDYGGISAEPISNPHHYQPYGEIFTMKLDGSDLKRLTHNSYEDGTPTWAP-LYINP  670

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
              +   + GE     F++  W+N
Sbjct  671  VDVEWPRKGE---CAFEDCHWLN  690



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 137/181 (76%), Gaps = 12/181 (7%)
 Frame = -2

Query  658  KETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  485
            K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE   GGI +LT+G W DTM
Sbjct  480  KLTTGSENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AGGIHRLTEGPWSDTM  537

Query  484  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  305
             +WSPDG+ IAFSS+RHNPG    F+IY++ P+GTGLRR+ V  A+G       R NH  
Sbjct  538  CNWSPDGEWIAFSSDRHNPGGG-SFAIYMIHPNGTGLRRV-VHSADGG------RTNHPW  589

Query  304  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  125
            FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DGTG++RLT N +E+GTP+W 
Sbjct  590  FSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGTGIRRLTHNSFEDGTPSWT  649

Query  124  P  122
            P
Sbjct  650  P  650



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 132/174 (76%), Gaps = 10/174 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE   GG+R+LT+G W DTM +WSPDG
Sbjct  484  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGE--AGGLRRLTEGPWTDTMCNWSPDG  541

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++
Sbjct  542  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGMGG-------RTNHPYFSPDGKY  593

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  594  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  647



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 143/196 (73%), Gaps = 13/196 (7%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            D D+ +  + ++ LT  T G NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   G
Sbjct  482  DVDAADKALSVRRLT--TNGKNNAFPWPSPDGKRIVFRSGRSGHKNLYLMDAEKGE--AG  537

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            G+  LT+GAW DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ 
Sbjct  538  GLWSLTEGAWSDTMCTWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLIQSGSG  596

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+R
Sbjct  597  G-------RTNHPIFSPDSKTIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRR  649

Query  166  LTWNGYENGTPAWHPK  119
            LT N YE+GTPAW P+
Sbjct  650  LTHNSYEDGTPAWAPR  665



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 152/228 (67%), Gaps = 23/228 (10%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GDDD  ++ ++   +  E   NNAFPS SPDGK +VFRSGRSGHKNLYI+D+ +GE    
Sbjct  468  GDDDDPKVSIKKLTVGGE---NNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAEDGE--AS  522

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            GIR+LT+G W DTM +WSPDG+ IAF+S+RHNPG    F IY+V P+GTGLRR+ V   +
Sbjct  523  GIRRLTEGPWSDTMCNWSPDGEWIAFASDRHNPGGG-SFGIYMVHPNGTGLRRV-VHSTD  580

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++   V+AEP+S P+ +QPYG+++ + +DG+G++R
Sbjct  581  GG------RTNHPWFSPDSKTLVFTSDYAAVSAEPISNPHHYQPYGEIFTVNIDGSGIRR  634

Query  166  LTWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGK----FDEPLWIN  35
            LT N +E+GTP+W P        L     GE L+      F++  W+N
Sbjct  635  LTHNSFEDGTPSWTPH------YLKPEDVGETLQASGTCAFEDCHWLN  676



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 141/194 (73%), Gaps = 13/194 (7%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D+D+    I+ LT  T G NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+
Sbjct  504  DADDPSTSIRKLT--TNGQNNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGL  559

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LTDG W DTM +WSPDG+LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G 
Sbjct  560  FRLTDGPWTDTMCNWSPDGELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-  617

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS D + + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT
Sbjct  618  ------RTNHPIFSPDGQTIAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLT  671

Query  160  WNGYENGTPAWHPK  119
             N +E+GTPAW PK
Sbjct  672  HNSFEDGTPAWAPK  685



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 141/194 (73%), Gaps = 13/194 (7%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D+D+    I+ LT  T G NNAFP  SPDGK IVFRSGRSGHKNLYI+D+  GE   GG+
Sbjct  505  DADDPSTSIRKLT--TNGQNNAFPWPSPDGKRIVFRSGRSGHKNLYIMDTEKGE--SGGL  560

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LTDG W DTM +WSPDG+LIAF+S+R NPG+   F ++++ P+GTG+R++  +G+ G 
Sbjct  561  FRLTDGPWTDTMCNWSPDGELIAFASDRENPGSG-SFELFLIHPNGTGMRKLIQSGSGG-  618

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS D + + FT++ G ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT
Sbjct  619  ------RTNHPIFSPDGQTIAFTSDYGAISAEPISNPHHYQPYGEIFTVKLDGSDLRRLT  672

Query  160  WNGYENGTPAWHPK  119
             N +E+GTPAW PK
Sbjct  673  HNSFEDGTPAWAPK  686



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 145/218 (67%), Gaps = 18/218 (8%)
 Frame = -2

Query  676  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  503
            E     K T G  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+R+LT+G
Sbjct  481  ETGTYKKLTLGGENNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--KGGLRRLTEG  538

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  323
             W DTM SWSPDG+ IAF+S+R NPG    F++Y++ P+GTGL ++  +G  G       
Sbjct  539  PWTDTMCSWSPDGEWIAFASDRDNPGGGG-FALYLIHPNGTGLMKVVHSGEGG-------  590

Query  322  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  143
            R NH  FS D   ++FT++  GV+AEP+S P+ +QPYG++++ R DG+G++RLT N YE+
Sbjct  591  RTNHPSFSPDGRSIVFTSDYVGVSAEPISNPHHYQPYGEIFIARSDGSGIKRLTHNSYED  650

Query  142  GTPAWHPK--AEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            GTPAW P      D+     G+ G      FD+  W+N
Sbjct  651  GTPAWGPTFMRPADVVESPFGEPG----CSFDDCHWLN  684



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 134/179 (75%), Gaps = 10/179 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N+AFPS SPDGK + FRSGRSGHKNLY++D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  515  NDAFPSASPDGKWVAFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGPWSDTMCNWSPDG  572

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + I F+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH CFS D ++
Sbjct  573  EWILFASDRENPGSG-TFELFMVHPNGTGLHKLVQSGSGG-------RANHPCFSPDGKY  624

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVD  107
            V+FT++  GV+AEP+S P+ +QPYG++++++ DG+G++RLT N YE+GTPAW PK   D
Sbjct  625  VVFTSDYAGVSAEPISNPHHYQPYGEIFVIKSDGSGIRRLTHNSYEDGTPAWGPKYMKD  683



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 142/203 (70%), Gaps = 13/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D+LNGE   G + +LT+G W DTM +WSPDG
Sbjct  483  NNAFPSPSPDGKWIVFRSGRTGHKNLYIMDALNGE--AGWLYRLTEGQWTDTMCNWSPDG  540

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G  G       R NH  FS D  +
Sbjct  541  EWIAFASDRENPGSG-SFELFKIHPNGTGLQKVIHSGVGG-------RTNHPWFSPDGNY  592

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++ T++  GV+AEP++ P+ +QPYGD++++R DG+G++RLT N YE+GTPAW PK  +  
Sbjct  593  IVLTSDYAGVSAEPIANPHHYQPYGDIFVIRADGSGIRRLTHNSYEDGTPAWSPKF-LSP  651

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
            A +     G K    FD+  W+N
Sbjct  652  ANVEWPNGGSKC--SFDDCHWLN  672



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 151/223 (68%), Gaps = 15/223 (7%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETT--GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            D   I V+  ++ K T    NNAFPS SPDGK IVFRSGRSGHKNLY++D++ GE    G
Sbjct  462  DIISIDVDRNIVKKLTIDGKNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDAVEGE--KKG  519

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            +R+LT+G W DTM +WSPDG+ IAF+S+R +PG+   F +Y++ P+GTGL+++  +G+ G
Sbjct  520  LRRLTEGPWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYLIHPNGTGLKKLIQSGSGG  578

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                   R NH  FS D + ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RL
Sbjct  579  -------RTNHPYFSPDGKSIVFTSDYSGISAEPISNPHAYQPYGEIFTVRLDGSGLTRL  631

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            T N YE+GTPAW PK  +    +   K G      FD+  W+N
Sbjct  632  THNSYEDGTPAWSPKY-IKPVNVERPKGGPYC--SFDDCHWLN  671



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK +VFRSGR+GHKNLYI+D+LNGE DG  + QLT+G W DTMP+WSP+G
Sbjct  508  NNAFPSPSPDGKRVVFRSGRTGHKNLYIMDALNGEKDG--LYQLTEGPWSDTMPNWSPNG  565

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F ++ + P+GTGL+++  +G+ G       R+NH  FS D + 
Sbjct  566  EWIAFASDRENPGSGG-FELFKIHPNGTGLQKVIQSGSGG-------RVNHPWFSPDGKH  617

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++ T++  GV+AEP+S P+ FQPYGD+++++ DG+ ++RLT N YE+GTP W PK+ +  
Sbjct  618  IVLTSDYAGVSAEPISNPHHFQPYGDIFVIKSDGSWIRRLTHNSYEDGTPTWIPKS-MKP  676

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
              +     G  L+  FD+  W+N
Sbjct  677  GNVEWPNGG--LKCSFDDCHWLN  697



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 132/172 (77%), Gaps = 10/172 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK +VFRSGRSGHKNLYI+D+L GE   GG+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSASPDGKWVVFRSGRSGHKNLYIMDALEGET--GGLSRLTEGPWSDTMCNWSPDG  569

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F +++V P+GTGL ++  +G+ G       R NH  FS DS++
Sbjct  570  EWIAFASDRENPGSG-SFELFMVHPNGTGLHKLIQSGSGG-------RTNHPWFSPDSKY  621

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            V+FT++  GV+AEP+S P+ +QPYGD+++++ DG+G++RLT N YE+GTP W
Sbjct  622  VVFTSDYAGVSAEPISNPHHYQPYGDIFVIKSDGSGIRRLTHNSYEDGTPTW  673



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE  GGG+ +LT+GAW DTM +WSP+G
Sbjct  509  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--GGGLWRLTEGAWTDTMCNWSPNG  566

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  567  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPVFSPDSKS  618

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  619  LVFTSDYAGISAEPISNPHSYQPYGDIFTVKLDGSNLKRLTHNSYEDGTPAWSPR  673



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 13/195 (7%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GDDD + I ++   +  E   NNAFPS SPDGK +VFRSGRSG+KNLYIID+ +GE   G
Sbjct  458  GDDDDETISMKKLTVGGE---NNAFPSPSPDGKWVVFRSGRSGNKNLYIIDAEDGE--AG  512

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            GIR+LT+G W DTM +WSPDG+ IAF+S+RH PG+   F+IY+V P+GTGLRR+  +G  
Sbjct  513  GIRRLTEGPWSDTMCNWSPDGEWIAFASDRHAPGSG-SFAIYMVHPNGTGLRRVVHSGDG  571

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  F  DS+ ++FT++   V+AEPVS P+ +QPYG+++ + +DG+ ++R
Sbjct  572  G-------RTNHPWFGPDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIFTVHIDGSNIRR  624

Query  166  LTWNGYENGTPAWHP  122
            LT N +E+GTP+W P
Sbjct  625  LTHNSFEDGTPSWTP  639



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R+NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRYNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 131/174 (75%), Gaps = 10/174 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+L GE+  GG+R LT+G W DTM +WSPD 
Sbjct  468  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDALEGEV--GGLRPLTEGPWTDTMCNWSPDD  525

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F +Y++ P+GTGL+++  +G  G       R NH  FS D ++
Sbjct  526  EWIAFASDRENPGSG-SFEMYMIHPNGTGLKKVIQSGIGG-------RTNHPYFSPDGKY  577

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            ++FT++   V+AEP+S P+ +QPYGD+Y+++ DG+ ++RLT N YE+GTPAW P
Sbjct  578  IVFTSDYAAVSAEPISNPHHYQPYGDIYVIKSDGSDIRRLTHNSYEDGTPAWGP  631



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 144/203 (71%), Gaps = 13/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE+  GGIR+LT+G W DTM +WSPDG
Sbjct  510  NNAFPSPSPDGKWIVFRSGRSGHKNLYIMDAEEGEI--GGIRRLTEGPWSDTMCNWSPDG  567

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAFSS+R NPG+   F I+++ P+GTGL ++  +G  G       R NH  FS D + 
Sbjct  568  EWIAFSSDRENPGSG-SFEIFMMHPNGTGLHKVIQSGIGG-------RANHPWFSPDGKS  619

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++FT++ GGV+AEP+S P+ +QPYG++++ ++DG+ ++RLT N YE+GTP W P   + L
Sbjct  620  IVFTSDYGGVSAEPISNPHHYQPYGEIFIAKVDGSDIRRLTHNSYEDGTPTWGP---MFL  676

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
            + + + +   + +  F +  W+N
Sbjct  677  SPIDVAEPTSEPKCLFQDCHWLN  699



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 132/175 (75%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  506  NNAFPWPSPDGKLIVFRSGRTGHKNLYIMDAEKGER--GGLWRLTEGAWTDTMCNWSPDG  563

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F ++++ P+GTGL+++  +G  G       R NH  FS DS+ 
Sbjct  564  EWIAFASDRENPGSG-SFELFLIHPNGTGLKKLIQSGTGG-------RTNHPVFSPDSKS  615

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            ++FT++  G++AEP+S P+ FQPYGD++ ++LDG+ L+RLT N YE+GTPAW P+
Sbjct  616  LVFTSDYAGISAEPISNPHHFQPYGDIFTVKLDGSNLRRLTHNSYEDGTPAWSPR  670



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 143/199 (72%), Gaps = 16/199 (8%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGE  539
            ++ DDD +  P+    + K TTG  NNAFPS SPDGK +VFRSGRSGHKNLYI+D++ G 
Sbjct  473  EEDDDDENSQPI----VKKLTTGGENNAFPSPSPDGKWVVFRSGRSGHKNLYIMDAVEG-  527

Query  538  LDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHV  359
             D   +R+LT+G W DTM +WSPDG+ IAF+S+R NPG+   F+IY++ P+GTGLR++  
Sbjct  528  -DSAALRRLTEGPWSDTMCNWSPDGEWIAFASDRDNPGSGS-FAIYMIHPNGTGLRKVVH  585

Query  358  AGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGT  179
            +G  G       R NH  FS DS+ + FT++  GV+AEP+S P+ +QPYG+++ +++DG+
Sbjct  586  SGDGG-------RTNHPWFSPDSKSLAFTSDYAGVSAEPISNPHHYQPYGEIFTVKIDGS  638

Query  178  GLQRLTWNGYENGTPAWHP  122
             ++RLT N +E+GTP W P
Sbjct  639  DIRRLTHNSFEDGTPTWAP  657



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 140/199 (70%), Gaps = 18/199 (9%)
 Frame = -2

Query  691  DEIPVEIKVLTKETT--------GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL  536
            D I +E+    K ++         NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE 
Sbjct  480  DVISIEVDAADKSSSVRRLTTNGKNNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE-  538

Query  535  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  356
              GG+ +LT+GAW DTM +WSPDG+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  539  -SGGLWRLTEGAWTDTMCNWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  596

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  176
            G  G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  597  GTGG-------RTNHPIFSPDSKSLVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  649

Query  175  LQRLTWNGYENGTPAWHPK  119
            L+RLT N YE+GTPAW P+
Sbjct  650  LRRLTHNSYEDGTPAWAPR  668



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 152/224 (68%), Gaps = 13/224 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D D +     V    T G NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+
Sbjct  446  DVDAVDKSSSVRRLTTNGKNNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGL  503

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G 
Sbjct  504  WKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-  561

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT
Sbjct  562  ------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLT  615

Query  160  WNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  29
             N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  616  HNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  657



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 138/194 (71%), Gaps = 11/194 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D D +     V    T G NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+
Sbjct  484  DVDAVDKSSSVRRLTTNGKNNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGL  541

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G 
Sbjct  542  WKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-  599

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT
Sbjct  600  ------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLT  653

Query  160  WNGYENGTPAWHPK  119
             N YE+GTPAW P+
Sbjct  654  HNSYEDGTPAWAPR  667



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 149/223 (67%), Gaps = 15/223 (7%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DDD  +I    K LT     NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG
Sbjct  481  DDDLGQI-NSFKKLTSNGE-NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGG  536

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            + +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G
Sbjct  537  LYRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG  595

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                   R+NH  FS D   + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RL
Sbjct  596  -------RVNHPYFSPDGNSIAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRL  648

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            T N YE+GTPAW P     +    +   G   +  F+E  W+N
Sbjct  649  THNSYEDGTPAWGPTY---IKPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 149/216 (69%), Gaps = 15/216 (7%)
 Frame = -2

Query  676  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  503
            ++    K TT   NNAFP+ SPDGK IVFRSGRSG+KNLYI+D++ GE   GG+ +LT+G
Sbjct  485  QVGSFKKLTTNGKNNAFPAVSPDGKWIVFRSGRSGYKNLYIMDAVEGE--KGGLYRLTEG  542

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  323
             W DTM SWS DG+ IAF+S+R NPG+A  F ++++ P+GTGL+R+  +G  G       
Sbjct  543  PWGDTMCSWSIDGEWIAFASDRENPGSA-SFELFLIHPNGTGLKRLVKSGLGG-------  594

Query  322  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  143
            R NH  FS D + ++FT + GG++AEP+S P+ FQPYG++Y ++LDG+ L+RLT N +E+
Sbjct  595  RTNHPYFSPDGKSIVFTTDYGGISAEPISNPHHFQPYGEIYTVKLDGSDLKRLTHNSFED  654

Query  142  GTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            GTPAW P A ++   L   K G +    FD+  W++
Sbjct  655  GTPAWGP-AYIEPVDLEWPKYGPQC--SFDDCHWLS  687



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 152/224 (68%), Gaps = 13/224 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D D +     V    T G NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+
Sbjct  447  DVDAVDKSSSVRRLTTNGKNNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGL  504

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G 
Sbjct  505  WKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-  562

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT
Sbjct  563  ------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLT  616

Query  160  WNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  29
             N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  617  HNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  658



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 152/224 (68%), Gaps = 13/224 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D D +     V    T G NNAFP  SPDGK IVFRSGRSGHKNLY++D+  GE   GG+
Sbjct  484  DVDAVDKSSSVRRLTTNGKNNAFPWPSPDGKLIVFRSGRSGHKNLYLMDAEKGET--GGL  541

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   + ++++ P+GTGLR++  +G  G 
Sbjct  542  WKLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SYELFLIHPNGTGLRKLIQSGTGG-  599

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ L+RLT
Sbjct  600  ------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNLRRLT  653

Query  160  WNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWINSD  29
             N YE+GTPAW P+  ++ + + L K  +     F++  W+N +
Sbjct  654  HNSYEDGTPAWAPRF-INPSDVVLRKKNDS-SCAFEDCHWLNKN  695



>ref|XP_010269111.1| PREDICTED: uncharacterized protein LOC104605872 [Nelumbo nucifera]
Length=623

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 148/229 (65%), Gaps = 23/229 (10%)
 Frame = -2

Query  676  EIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDG  503
            E+    K T G  NNAFPS SPDGK +VFRSGRSGHKNLY++D+L GE    G+R+LT+G
Sbjct  399  EMGQYKKLTIGGQNNAFPSPSPDGKWVVFRSGRSGHKNLYVMDALEGER--AGVRRLTEG  456

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  323
             W DTM +WSPDG+ IAF+S+R NPG    F+IY + P+GTGL+++  +G  G       
Sbjct  457  PWTDTMCNWSPDGEWIAFASDRDNPGGGS-FAIYFIHPNGTGLKKVVHSGEGG-------  508

Query  322  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYEN  143
            R NH  FS D + ++FT++   V+AEP++ P+ +QPYGD+++ R DG+G++RLT N YE+
Sbjct  509  RTNHPWFSPDGKSLVFTSDYAAVSAEPIANPHHYQPYGDIFIARSDGSGIRRLTHNSYED  568

Query  142  GTPAWHP--KAEVDLARLSLGKSGEKLRGKFDEPLWINSDF*LLLPQNK  2
            GTP+W P     +D+     G      R  FD+  W+      L P NK
Sbjct  569  GTPSWGPMFMRPIDVVESPFGGP----RCSFDDCHWLG-----LRPDNK  608



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG+ +LT+G W DTM +WSPDG
Sbjct  499  NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGGLYRLTEGPWSDTMCNWSPDG  556

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G       R+NH  FS D   
Sbjct  557  EWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG-------RVNHPYFSPDGNS  608

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            + FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE+GTPAW P     +
Sbjct  609  IAFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTHNSYEDGTPAWGPTY---I  665

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
                +   G   +  F+E  W+N
Sbjct  666  KPKDVEWPGHGPQCSFEECHWLN  688



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 149/223 (67%), Gaps = 15/223 (7%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DDD  +I    K LT     NNAFP+ SPDGK +VFRSGRSGHKNLYI+D+  GE   GG
Sbjct  481  DDDLGQI-NSFKKLTSNGE-NNAFPAVSPDGKWVVFRSGRSGHKNLYIMDASEGE--NGG  536

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            + +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F ++++ P+GTGLR++  +G+ G
Sbjct  537  LYRLTEGPWSDTMCNWSPDGEWIAFASDRENPGSG-SFELFLIHPNGTGLRKLVQSGSAG  595

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                   R NH  FS D   ++FT++ GG++AEP+S P+ +QPYG+++ ++LDG+ L+RL
Sbjct  596  -------RANHPYFSPDGNSIVFTSDYGGISAEPISNPHHYQPYGEIFTVKLDGSDLKRL  648

Query  163  TWNGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            T N YE+GTPAW P     +    +   G   +  F+E  W+N
Sbjct  649  THNSYEDGTPAWGPTY---IKPEDVEWPGHGPQCSFEECHWLN  688



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRS R+G+KNLYI+D+  GE  G G+ +LT+G W DTM +WSPDG
Sbjct  512  NNAFPSVSPDGKWIVFRSTRTGYKNLYIMDAEGGE--GYGLHRLTEGPWSDTMCNWSPDG  569

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R NPG+   F +Y++ P+GTGLR++  +G+ G       R NH  FS D + 
Sbjct  570  EWIAFASDRDNPGSG-SFEMYLIHPNGTGLRKLIQSGSAG-------RANHPYFSPDGKS  621

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
            ++FT++ GG++AEP+S P+Q+QPYG+++ ++LDG+ L+RLT N +E+GTPAW P+
Sbjct  622  IVFTSDYGGISAEPISTPHQYQPYGEIFKIKLDGSDLKRLTQNSFEDGTPAWGPR  676



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 144/203 (71%), Gaps = 12/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   GG+ +LT+GAW DTM +WSPDG
Sbjct  504  NNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGE--SGGLWRLTEGAWTDTMCNWSPDG  561

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R +PG+   F ++++ P+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  562  EWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQSGTGG-------RTNHPIFSPDSKS  613

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ ++RLT N YE+GTPAW P+  +  
Sbjct  614  LVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNVRRLTHNSYEDGTPAWAPRF-IHP  672

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
              + L +  +  R  F++  W+N
Sbjct  673  NNVELQRRNDS-RCSFEDCHWLN  694



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 132/183 (72%), Gaps = 12/183 (7%)
 Frame = -2

Query  658  KETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  485
            K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D+++GE   GGI +LT+G W DTM
Sbjct  496  KLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVDGER--GGIHRLTEGPWTDTM  553

Query  484  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  305
             +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G       R NH  
Sbjct  554  CNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG-------RTNHPW  605

Query  304  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  125
            FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE+GTPAW 
Sbjct  606  FSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYEDGTPAWA  665

Query  124  PKA  116
            PK 
Sbjct  666  PKV  668



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 133/177 (75%), Gaps = 12/177 (7%)
 Frame = -2

Query  652  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  479
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  493  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGE--AGGLYRLTEGSWTDTMCN  550

Query  478  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  551  WSPDGDWIAFASDRENPGSGS-FEMFMVHPNGTGLRKVIQSGMGG-------RTNHPYFS  602

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
             D ++++FT++   V+AEP+S P+ +QPYGD+++++ DG+ ++RLT N YE+GTPAW
Sbjct  603  PDGKYIVFTSDYAAVSAEPISNPHHYQPYGDIFVIKSDGSEIRRLTHNSYEDGTPAW  659



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 134/179 (75%), Gaps = 12/179 (7%)
 Frame = -2

Query  652  TTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPS  479
            TTG  NNAFPS SPDGK IVFRSGRSGHKNLY++D+L GE   GG+ +LT+G+W DTM +
Sbjct  489  TTGGQNNAFPSPSPDGKWIVFRSGRSGHKNLYVMDALEGET--GGLYRLTEGSWTDTMCN  546

Query  478  WSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            WSPDG  IAF+S+R NPG+   F +++V P+GTGLR++  +G  G       R NH  FS
Sbjct  547  WSPDGDWIAFASDRENPGSG-SFEMFMVHPNGTGLRKVIQSGTGG-------RTNHPYFS  598

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
             D ++++FT++   V+AEP++ P+ +QPYGD+++++ DG+ ++R+T N YE+GTPAW P
Sbjct  599  PDGKYIVFTSDYAAVSAEPIANPHHYQPYGDIFVIKSDGSEIRRMTHNSYEDGTPAWGP  657



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 131/183 (72%), Gaps = 12/183 (7%)
 Frame = -2

Query  658  KETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  485
            K TTG  NNAFPS SPDGK I FRSGRSG+KNLYI+D++ GE   GGI +LT+G W DTM
Sbjct  496  KLTTGGENNAFPSPSPDGKWIAFRSGRSGYKNLYIMDAVXGER--GGIHRLTEGPWTDTM  553

Query  484  PSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  305
             +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G+ G       R NH  
Sbjct  554  CNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSGSAG-------RTNHPW  605

Query  304  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  125
            FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL RLT N YE+GTPAW 
Sbjct  606  FSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGLHRLTHNSYEDGTPAWA  665

Query  124  PKA  116
            PK 
Sbjct  666  PKV  668



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 142/199 (71%), Gaps = 15/199 (8%)
 Frame = -2

Query  712  DDGDDDSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL  536
            DD  DD+      ++ LT  T G NNAFP  SPDGK IVFRSGR+GHKNLY++D+  GE 
Sbjct  488  DDAADDTSS--SSVRRLT--TNGKNNAFPWPSPDGKLIVFRSGRTGHKNLYLMDAEKGET  543

Query  535  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVA  356
               G+ +LT+GAW DTM SWSPDG+ IAF+S+R +PG+   F ++++ P+GTGLR++  +
Sbjct  544  --SGLWRLTEGAWTDTMCSWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGLRKLIQS  600

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTG  176
            G+ G       R NH  FS DS+ ++FT++  G++AEP+S P+ +QPYGD++ ++LDG+ 
Sbjct  601  GSGG-------RTNHPIFSPDSKSIVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSN  653

Query  175  LQRLTWNGYENGTPAWHPK  119
            L+RLT N YE+GTP W P+
Sbjct  654  LRRLTHNSYEDGTPVWAPR  672



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 143/194 (74%), Gaps = 15/194 (8%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DD D++   +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG
Sbjct  503  DDVDKL--GVKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGE--EGG  556

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            + +LTDG W DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G
Sbjct  557  LYRLTDGPWSDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG  615

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
                   R NH  FS D + ++FT++   V+AEP+S  + +QPYG+++ ++LDG+ L+RL
Sbjct  616  -------RANHPYFSPDGKSIVFTSDYAAVSAEPISNSHHYQPYGEIFTIKLDGSDLKRL  668

Query  163  TWNGYENGTPAWHP  122
            T N YE+GTPAW P
Sbjct  669  THNSYEDGTPAWGP  682



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 137/192 (71%), Gaps = 13/192 (7%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            DE    IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D+++GE    G+R+
Sbjct  479  DEEERNIKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVDGE--SKGLRR  534

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            LT+G W DTM SWSPDG  IAFSS+R NPG A  F ++++ P+GTGLR++  +G  G   
Sbjct  535  LTEGLWTDTMCSWSPDGDWIAFSSDRENPG-AGSFDLFLIHPNGTGLRKLFQSGLGG---  590

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
                R NH  +  D + ++FT +  G++AEPVS P+ +QPYG++Y ++LDG+ LQRLT N
Sbjct  591  ----RANHPNWRPDGKALVFTTDNAGISAEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHN  646

Query  154  GYENGTPAWHPK  119
             YE+GTP W P+
Sbjct  647  SYEDGTPTWSPR  658



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 140/196 (71%), Gaps = 13/196 (7%)
 Frame = -2

Query  703  DDDSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            D D+ +    ++ LT  T G NNAFP  SPDGK IVFRSGR+GHKNLYI+D+  GE   G
Sbjct  489  DVDASDKSSSVRRLT--TNGKNNAFPWPSPDGKQIVFRSGRTGHKNLYIMDAEKGE--SG  544

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            G+ +LT+G W DTM +WSPDG+ IAF+S+R +PG+   F ++++ P+GTG+R++  +G  
Sbjct  545  GLWRLTEGVWTDTMCNWSPDGEWIAFASDRESPGSG-SFELFLIHPNGTGIRKLIQSGTG  603

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++  G++ EP+S P+ +QPYGD++ ++LDG+ L+R
Sbjct  604  G-------RTNHPVFSPDSKSLVFTSDYAGISGEPISNPHSYQPYGDIFTVKLDGSNLRR  656

Query  166  LTWNGYENGTPAWHPK  119
            LT N YE+GTPAW P+
Sbjct  657  LTHNSYEDGTPAWSPR  672



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 141/203 (69%), Gaps = 13/203 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK +VFRSGR+GHKNLY +D+  GE   GGI +LT+G W DTM +WSPDG
Sbjct  493  NNAFPSVSPDGKWVVFRSGRAGHKNLYAMDAEEGE--KGGIHRLTEGPWSDTMCNWSPDG  550

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + IAF+S+R +PG+   F +Y++ P+GTGLR++  +G  G       R NH  FS D + 
Sbjct  551  EWIAFASDREDPGSG-SFELYLIHPNGTGLRKLVQSGLGG-------RTNHPYFSPDGKS  602

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            V+FT +  G++AEP+S P+ +QPYG++Y ++LDG+ L+RLT N +E+GTPAW P   + +
Sbjct  603  VVFTTDYAGISAEPISNPHHYQPYGEIYTIKLDGSDLKRLTHNSFEDGTPAWGP---IYI  659

Query  103  ARLSLGKSGEKLRGKFDEPLWIN  35
                +    E+ + +F++  W+N
Sbjct  660  EPNDVEWPNERPQCQFEDCHWLN  682



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 134/186 (72%), Gaps = 11/186 (6%)
 Frame = -2

Query  676  EIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
            +I V    T G NNAFPS SPDGK IVFRSGRSGHKNLYI+D+  GE  G  +++LT+G 
Sbjct  493  QIAVKKLTTNGKNNAFPSPSPDGKRIVFRSGRSGHKNLYIMDAEEGERIG--LQRLTEGP  550

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRER  320
            W DTM +WSPDG  IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G       R
Sbjct  551  WTDTMCNWSPDGDWIAFASDRENPGSG-SFELYVIHPNGTGLRKVIQSGSGG-------R  602

Query  319  LNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENG  140
             NH  FS D + ++FT++ G ++AEP+S P+ +QPYG+++ +++DG+ L+RLT N +E+G
Sbjct  603  TNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTVKVDGSDLRRLTQNSFEDG  662

Query  139  TPAWHP  122
            TP W P
Sbjct  663  TPVWVP  668



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 132/188 (70%), Gaps = 12/188 (6%)
 Frame = -2

Query  679  VEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTD  506
            V+     K TT   NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+
Sbjct  471  VDRATFKKLTTNGKNNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTE  528

Query  505  GAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            G W DTM +WSPDG  IAF+S+R +PG+   F +YV+RP+G GLR++  +G  G      
Sbjct  529  GPWTDTMCNWSPDGNWIAFASDREDPGSG-SFELYVIRPNGAGLRKVIQSGTGG------  581

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
             R NH  FS DS+ ++FT++   ++AEP+S P+ +QPYG+++ ++LDG+ L+RLT N YE
Sbjct  582  -RTNHPWFSPDSKSLVFTSDYRAISAEPISNPHHYQPYGEIFTVKLDGSDLKRLTQNSYE  640

Query  145  NGTPAWHP  122
            +GTP W P
Sbjct  641  DGTPVWVP  648



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 135/193 (70%), Gaps = 13/193 (7%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD D+     K LT     NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE  G  +
Sbjct  326  DDVDQ--ASFKKLTTNGK-NNAFPSPSPDGKRIVFRSGLSGHKNLYIMDAEDGERSG--L  380

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+G W DTM +WSPDG+ IAF+S+R NPG+   F +YV+ P+GTGLR++  +G+ G 
Sbjct  381  HRLTEGMWTDTMCNWSPDGEWIAFASDRDNPGSG-SFELYVIHPNGTGLRKVIESGSGG-  438

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS D + ++FT++ G ++AEP+S P+ +QPYG+++ + LDG+ L+RLT
Sbjct  439  ------RTNHPWFSPDGKSLVFTSDYGAISAEPISNPHHYQPYGEIFTINLDGSDLRRLT  492

Query  160  WNGYENGTPAWHP  122
             N YE+GTP W P
Sbjct  493  QNSYEDGTPVWIP  505



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 135/192 (70%), Gaps = 13/192 (7%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            DE    IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D++ GE    G+R+
Sbjct  479  DEEERNIKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRR  534

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            LT+G W DTM SWSP+G  IAFSS+R NPG  + F ++++ P+GTGLR++  +G  G   
Sbjct  535  LTEGQWTDTMCSWSPEGDWIAFSSDRENPGGGN-FDLFLIHPNGTGLRKLFQSGLGG---  590

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
                R NH  +  D + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N
Sbjct  591  ----RANHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHN  646

Query  154  GYENGTPAWHPK  119
             YE+GTP W P+
Sbjct  647  SYEDGTPTWSPR  658



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 134/192 (70%), Gaps = 13/192 (7%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            DE    IK LT  T G NNAFPS SPDGK IVFRSG++G+KNLYI+D++ GE    G+R+
Sbjct  479  DEEERNIKKLT--TNGENNAFPSPSPDGKWIVFRSGQTGYKNLYIMDAVEGE--SKGLRR  534

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            LT+G W DTM SWSP+G  IAFSS+R NPG    F ++++ P+GTGLR++  +G  G   
Sbjct  535  LTEGQWTDTMCSWSPEGDWIAFSSDRENPGGG-SFDLFLIHPNGTGLRKLFQSGLGG---  590

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
                R NH  +  D + ++FT +  G++ EPVS P+ +QPYG++Y ++LDG+ LQRLT N
Sbjct  591  ----RANHPNWRPDGKALVFTTDNAGISGEPVSNPHHYQPYGEIYTIKLDGSDLQRLTHN  646

Query  154  GYENGTPAWHPK  119
             YE+GTP W P+
Sbjct  647  SYEDGTPTWSPR  658



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 135/193 (70%), Gaps = 13/193 (7%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            DD D+     K LT     NNAFPS SPDGK IVFRSG SGHKNLYI+D+ +GE    G+
Sbjct  470  DDVDQ--ASFKKLTTNGK-NNAFPSASPDGKRIVFRSGLSGHKNLYIMDAEDGER--SGL  524

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
            ++LT+G W DTM +WSPDG+ IAF+S+R +PG+   F +YV+ P+GTGLR++  +G+ G 
Sbjct  525  QRLTEGMWTDTMCNWSPDGEWIAFASDRDDPGSG-SFELYVIHPNGTGLRKVIQSGSGG-  582

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                  R NH  FS D + ++FT++   ++AEP+S P+ +QPYG+++ + LDG+ L+RLT
Sbjct  583  ------RTNHPWFSPDGKSLVFTSDYRAISAEPISNPHHYQPYGEIFTINLDGSDLKRLT  636

Query  160  WNGYENGTPAWHP  122
             N YE+GTP W P
Sbjct  637  QNSYEDGTPVWIP  649



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 146/219 (67%), Gaps = 14/219 (6%)
 Frame = -2

Query  688  EIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  512
            E P +I V    T G NNAFPS SPDG  IVFRSG++G KNLYI+D++ GE   GG+ +L
Sbjct  502  EDPEKIVVKKLTTNGKNNAFPSLSPDGNRIVFRSGQTGFKNLYIMDAVKGE--EGGLHRL  559

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
            T+G W DTM +WSPDG+ IAF+S+R NPG+   F +Y++ P+GTGLR +  +G+ G    
Sbjct  560  TEGPWTDTMCNWSPDGEWIAFASDRENPGSG-SFELYLIHPNGTGLRTLIESGSGG----  614

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  152
               R NH  FS D + + FT++  G++AEP+S P+ +QPYG+++ +  DG+ ++RLT N 
Sbjct  615  ---RTNHPWFSPDGKKLAFTSDYAGISAEPISNPHHYQPYGEIFTVNFDGSDVRRLTHNS  671

Query  151  YENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLWIN  35
            YE+GTP W PK    +  + +    ++ R +F++  W+N
Sbjct  672  YEDGTPTWVPKF---IRPVDVEWPVDRPRCEFEDLHWLN  707



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 125/174 (72%), Gaps = 10/174 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFPS SPDGK IVFRSGR+GHKNLYI+D   GE   GG+ +LT+G W DTM +WSPDG
Sbjct  485  NNAFPSPSPDGKQIVFRSGRTGHKNLYIMDVEVGE--SGGLYRLTEGPWTDTMCNWSPDG  542

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              IAF+S+R +PG+   F +YV+RP+GTGLR++  +G  G       R NH  FS DS+ 
Sbjct  543  NWIAFASDREDPGSG-SFELYVIRPNGTGLRKVIQSGTGG-------RTNHPWFSPDSKS  594

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            ++FT++   ++AEP+     +QPYG+++ ++LDG+ L+RLT N YE+GTP W P
Sbjct  595  LVFTSDYRAISAEPIXNXXHYQPYGEIFTVKLDGSDLKRLTQNSYEDGTPVWVP  648



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 109/158 (69%), Gaps = 16/158 (10%)
 Frame = -2

Query  493  DTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  314
            D  P+ SP GK +              F IY+VRPDG+GLRR+HVAG  GS   +RER+N
Sbjct  449  DAFPAVSPCGKWV-------------VFRIYLVRPDGSGLRRVHVAGPAGSAAADRERIN  495

Query  313  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            HVCFS DS W+LFTAN GGV AEP+S PNQFQPYGDLY+ RLDG+GL RLT N YENGTP
Sbjct  496  HVCFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRLDGSGLVRLTCNAYENGTP  555

Query  133  AWHPKAE--VDLARLSLGK-SGEKLRGKFDEPLWINSD  29
            AW P +     L  LSLG  +G++  G+FDEPLW+  D
Sbjct  556  AWGPASSPAAGLESLSLGPGAGDESLGEFDEPLWLTCD  593


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 33/128 (26%)
 Frame = -2

Query  691  DEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  512
            DE+   +KVLT+   GN+AFP+ SP GK +VFR        +Y++       DG G+R++
Sbjct  432  DEVAATLKVLTRPEAGNDAFPAVSPCGKWVVFR--------IYLVRP-----DGSGLRRV  478

Query  511  ----------TDGAWIDTMPSWSPDGKLIAFSSNR--------HNPGNADCFS-IYVVRP  389
                       D   I+ +  +SPD + + F++N           P     +  +YV R 
Sbjct  479  HVAGPAGSAAADRERINHV-CFSPDSRWLLFTANFGGVMAEPISAPNQFQPYGDLYVCRL  537

Query  388  DGTGLRRI  365
            DG+GL R+
Sbjct  538  DGSGLVRL  545



>ref|XP_006652005.1| PREDICTED: uncharacterized protein LOC102702184, partial [Oryza 
brachyantha]
Length=391

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 126/195 (65%), Gaps = 14/195 (7%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GDDD     + +K LT     NNAFPS SPDGK +VFRSGRSGHKNLY++D+ +GE   G
Sbjct  168  GDDDGG---IAMKKLTVGGE-NNAFPSPSPDGKWVVFRSGRSGHKNLYVMDAEHGE--AG  221

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            G+R+LT+G W DTM +WSPDG+ IAF+S+RH+PG+         R               
Sbjct  222  GVRRLTEGPWSDTMCNWSPDGEWIAFASDRHDPGSG--------RFAXXXXXXXGPGRRG  273

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
            G       R NH  FS DS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++R
Sbjct  274  GVHSGGGGRTNHPWFSPDSKSIVFTSDYAAVSAEPVSNPHHYQPYGEIYTVSIDGSNIRR  333

Query  166  LTWNGYENGTPAWHP  122
            LT N +E+GTPAW P
Sbjct  334  LTHNSFEDGTPAWTP  348



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 124/195 (64%), Gaps = 13/195 (7%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D D +     V    T G NNAFP  SPDGK IVFRS  SG+KNLYI+D+  GE   GG+
Sbjct  455  DVDAVDQSKAVRNLTTNGQNNAFPWPSPDGKRIVFRSSMSGNKNLYIMDAEKGET--GGL  512

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LTDGAW DTM SWSPDG  IAF+SNR NPG  + F ++++ P+GTGLR++        
Sbjct  513  FRLTDGAWNDTMCSWSPDGDWIAFASNRENPGT-ESFGLFLIHPNGTGLRKL--------  563

Query  340  EEVNRERL-NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRL  164
             E    R+ NH  FS D + V FT+N   ++AEP+S P+     G+++ ++LDG+ L R+
Sbjct  564  TETGLGRMSNHPVFSPDGKTVAFTSNYAAISAEPISNPDIAISAGEIFTVKLDGSDLSRV  623

Query  163  TWNGYENGTPAWHPK  119
            T N Y +GTP W PK
Sbjct  624  THNSYMDGTPIWAPK  638



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   164 bits (415),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 119/183 (65%), Gaps = 12/183 (7%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRS RSG KN+YIID+  GE   GG+ +LT+G W D++P+WSPDG
Sbjct  495  NNAFPWPSPDGKRIVFRSARSGAKNIYIIDAEKGE--SGGLFRLTNGNWNDSIPTWSPDG  552

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              I FSSNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  553  NWIVFSSNREFPGTF-LDNLYVVHPDGTGLRKL-------AQNLTGGLSMHSTFSPDSKR  604

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP--KAEV  110
            ++FT    G++AEP+ +P+ F   G+++ + LDG+ L RLT N  E+G P W P  KA V
Sbjct  605  IVFTTTYAGISAEPIGVPHFFIAGGEIFTVNLDGSDLTRLTHNSVEDGPPMWFPKIKATV  664

Query  109  DLA  101
            D+A
Sbjct  665  DVA  667



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 120/194 (62%), Gaps = 12/194 (6%)
 Frame = -2

Query  688  EIPVEIKVLTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            + P  +  + K TT   NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +
Sbjct  472  DAPNPLTAVKKLTTKGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFR  529

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++       ++ 
Sbjct  530  LTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQN  581

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
            +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N
Sbjct  582  LTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHN  641

Query  154  GYENGTPAWHPKAE  113
              E+G P W PK +
Sbjct  642  SLEDGPPMWFPKIK  655



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 120/195 (62%), Gaps = 11/195 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D+      +K LT +   NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ 
Sbjct  472  DATNPSTAVKKLTTKGE-NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLF  528

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++       ++
Sbjct  529  RLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQ  580

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
             +      H  FS DS+ ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT 
Sbjct  581  NLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTH  640

Query  157  NGYENGTPAWHPKAE  113
            N  E+G P W PK +
Sbjct  641  NSLEDGPPMWFPKIK  655



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 121/196 (62%), Gaps = 13/196 (7%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D+      +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+
Sbjct  474  DAPSPATAVKKLT--TTGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--SGGL  529

Query  520  RQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGS  341
             +LT+G W DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       +
Sbjct  530  FRLTNGNWNDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------A  581

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
            + +      H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+GL RLT
Sbjct  582  QNLTGLVSMHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGLTRLT  641

Query  160  WNGYENGTPAWHPKAE  113
             N  E+G P W PK +
Sbjct  642  HNSVEDGPPMWFPKIK  657



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 10/177 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W DT+ +WSPD 
Sbjct  488  NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLFRLTNGNWNDTIATWSPDN  545

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS DS+ 
Sbjct  546  NWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQNLTGGVSMHPMFSPDSKR  597

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  113
            ++FT+   G++AEP+  P+   P  +++ + LDG+GL RLT N  E+G P W PK +
Sbjct  598  IVFTSIYAGLSAEPIGTPHFNVPSSEIFTVNLDGSGLTRLTHNSLEDGPPMWFPKIK  654



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 119/195 (61%), Gaps = 11/195 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIR  518
            D+      +K LT +   NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ 
Sbjct  472  DATNPSTAVKKLTTKGE-NNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGE--AGGLF  528

Query  517  QLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSE  338
            +LT+G W DT+ +WSPD   I F+SNR  PG     ++YVV PDGTGLR++       ++
Sbjct  529  RLTNGNWNDTIATWSPDNNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKL-------AQ  580

Query  337  EVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTW  158
             +      H  FS DS+ ++FT+   G++AEP+  P    P  +++ + LDG+GL RLT 
Sbjct  581  NLTGGVSMHPMFSPDSKRIVFTSIYAGLSAEPIGTPRFNVPSSEIFTVNLDGSGLTRLTH  640

Query  157  NGYENGTPAWHPKAE  113
            N  E+G P W PK +
Sbjct  641  NSLEDGPPMWFPKIK  655



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 13/188 (7%)
 Frame = -2

Query  673  IKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  497
            +K LT  TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W
Sbjct  482  VKKLT--TTGENNAFPWPSPDGKRIVFRSSRSGTKNLYIMDAEKGE--SGGLFRLTNGNW  537

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
             DT+ +WSPDG  I F+SNR  PG     +IYVV PDGTGLR++       ++ +     
Sbjct  538  NDTIATWSPDGNWIVFASNREFPGTL-LMNIYVVHPDGTGLRKL-------AQNLTGGVS  589

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
             H  FS DS+ ++FT    G++AE +  P+   P  +++ + LDG+G+ RLT N  E+G 
Sbjct  590  MHPMFSPDSKRIVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGMTRLTHNSVEDGP  649

Query  136  PAWHPKAE  113
            P W PK +
Sbjct  650  PMWFPKIK  657



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 111/156 (71%), Gaps = 11/156 (7%)
 Frame = -2

Query  589  GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCF  410
            G  GHKNLYI+D+ +GE   GGIR+LT+G W DTM +WSP  + IAF+S+RH PG+   F
Sbjct  284  GCRGHKNLYIMDAKDGE--AGGIRRLTEGPWSDTMCNWSPHDEWIAFASDRHAPGSGS-F  340

Query  409  SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP  230
            +I +V P+GTGLRR+  +G  G       R NH  FSSD + ++FT++   V+AEPVS P
Sbjct  341  AI-MVHPNGTGLRRVVHSGDGG-------RTNHPWFSSDFKSLVFTSDYAAVSAEPVSNP  392

Query  229  NQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            + +QPYG++Y + +DG+ ++RLT N +E+GTP+W P
Sbjct  393  HHYQPYGEIYTVDIDGSNIRRLTHNSFEDGTPSWTP  428



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 114/187 (61%), Gaps = 18/187 (10%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
             ++  LT   TGNNAFPS S DG  IVFRSGRSG KNLYI+ +   E +  G+ +LT+G 
Sbjct  489  TDVLTLTANGTGNNAFPSFSSDGSEIVFRSGRSGFKNLYIMPT---EGEAAGLIRLTEGP  545

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGN---ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVN  329
            W DTMP W+P    I F+S+R    +   A  F I+++R DG+GL+++         + +
Sbjct  546  WDDTMPGWTPASGWIVFASSREYVESNRPAGAFDIFMIRTDGSGLQKVF--------DSH  597

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGY  149
                NH  FS     V+FT      +AE +S P+QFQPYGDL+ +  DGT L+RLT + Y
Sbjct  598  GGLANHPHFSPSQTSVVFTR----YSAEEISTPHQFQPYGDLFAIDTDGTNLRRLTHDPY  653

Query  148  ENGTPAW  128
            ENGTPAW
Sbjct  654  ENGTPAW  660



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 111/181 (61%), Gaps = 11/181 (6%)
 Frame = -2

Query  652  TTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  476
            TTG NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D + +W
Sbjct  488  TTGQNNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGET--GGLFRLTNGNWSDVIATW  545

Query  475  SPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  296
            SPDG  I F+SNR  PG     ++YVV PDGTGLR++       ++ +      H  FS 
Sbjct  546  SPDGNWIVFASNREFPGTL-LMNLYVVHPDGTGLRKV-------AQNLTGAVSMHPMFSP  597

Query  295  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  116
            DS+ ++FT     ++AE +  P+   P  +++ + LDG+   RLT N  E+G P W PK 
Sbjct  598  DSKRIVFTTTYAAISAESIGNPHFNVPSSEIFTVNLDGSDFTRLTHNSLEDGPPMWFPKI  657

Query  115  E  113
            +
Sbjct  658  K  658



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -2

Query  532  GGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAG  353
            GGGI +LT+G W DTM +WSPDG  I F+S+R NPG    F +YV+ P+GTGLR++  +G
Sbjct  372  GGGIHRLTEGPWTDTMCNWSPDGDWIVFASDRENPGGGG-FELYVIHPNGTGLRKVVHSG  430

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGL  173
            + G       R NH  FS D + ++FT++   V+AEP+S  + +QPYGD++++ LDG+GL
Sbjct  431  SAG-------RTNHPWFSPDGKSIVFTSDYAAVSAEPISNAHHYQPYGDIFVVNLDGSGL  483

Query  172  QRLTWNGYENGTPAWHPKA  116
             RLT N YE+GTPAW PK 
Sbjct  484  HRLTHNSYEDGTPAWAPKV  502



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 111/186 (60%), Gaps = 12/186 (6%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  483  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  540

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  541  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  592

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
              FS DS+ ++FT    G++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  593  PMFSPDSKRIVFTTTYAGISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  652

Query  130  WHPKAE  113
            W PK +
Sbjct  653  WFPKIK  658



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 18/192 (9%)
 Frame = -2

Query  682  PVEIKVLTKETTG--NNAFPSCSPDGKHI--VFRSGRSGHKNLYIIDSLNGELDGGGIRQ  515
            P      T+ TT   NNAFP    DG  +  VFR  R+    LYI+D++ GE   GG+ +
Sbjct  313  PAFASATTQLTTNGDNNAFPDRMGDGLCLGRVFRVVRT----LYIMDAVEGE--KGGLYR  366

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE  335
            + +G W DTM  WSPDG+ I F S+R  PG    F +Y + P+GTGLR++  +G+ G   
Sbjct  367  VIEGLWDDTMCDWSPDGEWIVFCSDREEPGTGS-FDLYFIHPNGTGLRKLLQSGSGG---  422

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN  155
                R+NH+  S + + ++FT +   ++AEP+S    FQPYG++Y++ LDG+GL+RLT N
Sbjct  423  ----RVNHLYISPNGKSIVFTTDYTAISAEPISNQQMFQPYGEIYIINLDGSGLKRLTHN  478

Query  154  GYENGTPAWHPK  119
             +E+GTPAW P+
Sbjct  479  SFEDGTPAWGPR  490



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
              FS DS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  130  WHPKAE  113
            W PK +
Sbjct  660  WFPKIK  665



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 110/186 (59%), Gaps = 12/186 (6%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            + K TTG  NNAFP  SPDGK IVFRS RSG KNLYI+D+  GE   GG+ +LT+G W D
Sbjct  490  VKKLTTGGQNNAFPWPSPDGKRIVFRSDRSGTKNLYIMDAEKGE--AGGLFRLTNGNWND  547

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
            T+ +WSPD   I F+SNR   G      +YVV PDGTGLR++       ++ +      H
Sbjct  548  TIATWSPDNNWIVFASNREYIGTL-LMDLYVVHPDGTGLRKV-------AQNLTGGVSMH  599

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
              FS DS+ ++FT     ++AEP+  P       +++ + LDG+   RLT N  E+G P 
Sbjct  600  PMFSPDSKRIVFTTTYAAISAEPIGNPKFNVASSEIFTVNLDGSDFMRLTHNSVEDGPPL  659

Query  130  WHPKAE  113
            W PK +
Sbjct  660  WFPKIK  665



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 110/177 (62%), Gaps = 10/177 (6%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            NNAFP  SPDGK IVFRS RSG  NLYI+D+  GE   GG+ +LT+G   DT+ +WSPDG
Sbjct  486  NNAFPWPSPDGKRIVFRSARSGSFNLYIMDAKKGET--GGLFRLTNGHGNDTIATWSPDG  543

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
              I F+SNR  PG     ++YVV PDGTGL+++       +E++      H  FS DS+ 
Sbjct  544  NWIVFASNREFPGTL-FLNLYVVHPDGTGLKKV-------TEKLTGGISMHPMFSPDSKR  595

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  113
            ++FT     ++AEP+  P+   P  +++ + LDG+ L R+T N  E+G P W PK +
Sbjct  596  IVFTTIHAAISAEPIGNPHFNVPSSEIFTVNLDGSDLTRITHNSVEDGPPMWFPKIK  652



>gb|EMT16880.1| hypothetical protein F775_15390 [Aegilops tauschii]
Length=390

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 113/188 (60%), Gaps = 33/188 (18%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDG-GGIRQLTDGAWIDTMPSWSPD  467
            + ++PS SPDGK I F     G   LY+++S     DG GG R++  G    T   W   
Sbjct  168  DGSYPSFSPDGKRIAF----VGLPGLYVVNS-----DGSGGRRKIFSGNAFPTSWDWKRK  218

Query  466  GKL---------------IAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
            G +               IAF+S+RHNPG A  F+IY++ P+GTGLRR+ V  A+G    
Sbjct  219  GVIYTSIGPDFASESTEWIAFASDRHNPG-AGSFAIYMIHPNGTGLRRV-VHSADGG---  273

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNG  152
               R NH  FS DS+ ++FT++L  V+AEP+S P  +QPYG+++ + +DG+GLQRLT N 
Sbjct  274  ---RTNHPWFSPDSKRMVFTSDLAAVSAEPISNPRHYQPYGEIFTINIDGSGLQRLTHNS  330

Query  151  YENGTPAW  128
            +E+GTP+W
Sbjct  331  FEDGTPSW  338



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 3/101 (3%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            +I  ++KVLT+E T NNAFPSCSPDGK +VFRSGR+GHKNLYI+D +NGE D  GI QLT
Sbjct  426  DITCDVKVLTREDTRNNAFPSCSPDGKWLVFRSGRTGHKNLYIVDVVNGEFD-SGICQLT  484

Query  508  DGAWIDTMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVR  392
            DG+WIDTMPSWSP+  LIAF  N HNP  G  D    Y++R
Sbjct  485  DGSWIDTMPSWSPNDNLIAFFLNWHNPHVGRYDADLEYILR  525



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 98/135 (73%), Gaps = 15/135 (11%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTG-NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG  524
            DD D++   +K LT  T+G NNAFP+ SPDGK IVFRSGRSGHKNLYI+D++ GE   GG
Sbjct  503  DDVDKL--GVKRLT--TSGKNNAFPAPSPDGKWIVFRSGRSGHKNLYIMDAVKGE--EGG  556

Query  523  IRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEG  344
            + +LTDG W DTM +WSPDG+ IAF+S+R +PG+   FS+Y++ P+GTGLR++  +G+ G
Sbjct  557  LYRLTDGPWSDTMCNWSPDGEWIAFASDREDPGSG-SFSLYLIHPNGTGLRKLIQSGSLG  615

Query  343  SEEVNRERLNHVCFS  299
                   R NH  FS
Sbjct  616  -------RANHPYFS  623



>ref|NP_001173830.1| Os04g0278101 [Oryza sativa Japonica Group]
 dbj|BAH92558.1| Os04g0278101 [Oryza sativa Japonica Group]
Length=378

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 110/195 (56%), Gaps = 51/195 (26%)
 Frame = -2

Query  706  GDDDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGG  527
            GDDD   I ++   +  E   NNAFPS  PDGK                   L+GE   G
Sbjct  193  GDDDDKTISMKKLTVGDE---NNAFPSPPPDGKW------------------LDGE--AG  229

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAE  347
            GIR+LT+G W DTM +WSPD + IAF+S+RH PG+   F+I +V P+GTG          
Sbjct  230  GIRRLTEGPWSDTMCNWSPDDEWIAFASDRHAPGSG-SFAI-MVHPNGTG----------  277

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQR  167
                            SDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++R
Sbjct  278  ----------------SDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRR  321

Query  166  LTWNGYENGTPAWHP  122
            LT N +E+GTP+W P
Sbjct  322  LTHNSFEDGTPSWTP  336



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 31/198 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFP  +PDG   VFRS R G    +KNLYI+ D+  GE+ GG + +LT+G+WIDT   
Sbjct  483  NNAFPFTNPDGTKFVFRSTRDGGDKNYKNLYIMEDAEFGEVGGGKVTRLTEGSWIDTHCQ  542

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            WSPDG L+ F+SNR  P +A           F++Y++      + R+  +G + S  V  
Sbjct  543  WSPDGNLVVFASNRDKPADAPERDHGLDPGYFAVYLMNVSDRSVVRVIRSGYDLSGHV--  600

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ-----  170
               NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D   ++     
Sbjct  601  ---NHPVFSPDGRSIAVTSDLAAVSADPMSLPTFLHSVRPYGDIFSVDIDPDDMEKNKDL  657

Query  169  ----RLTWNGYENGTPAW  128
                R+T + YEN TPAW
Sbjct  658  DKFVRVTHSRYENSTPAW  675



>gb|AEW08691.1| hypothetical protein CL1213Contig1_01, partial [Pinus lambertiana]
Length=97

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 62/74 (84%), Gaps = 2/74 (3%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  497
            E+++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGIR LT+G W
Sbjct  26   EVRILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEQGE--EGGIRALTEGPW  83

Query  496  IDTMPSWSPDGKLI  455
            IDTMPSWSPDG+ I
Sbjct  84   IDTMPSWSPDGEWI  97



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 116/208 (56%), Gaps = 32/208 (15%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLT  509
            E ++LTK    NNAFPS + DG  +VFRS R+G    +KNLY++D+  GE DGG   ++T
Sbjct  557  ERRLLTK-GKFNNAFPSTNSDGTKLVFRSTRNGGHKKYKNLYMMDAEIGE-DGGEAERIT  614

Query  508  DGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVA  356
            +G WIDT   WSPD   I FSSNR  P +A           F++Y++      + R+  +
Sbjct  615  EGDWIDTHCQWSPDRDWIVFSSNRDKPADAPERDHGMDPGYFAVYLMNAIDRSVVRVIRS  674

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  185
            G + S  V     NH  FS D   ++ TA+L  V+A+P+S+P   +  +PYGD++ + +D
Sbjct  675  GYDFSGHV-----NHPVFSPDGRSIVVTADLAAVSADPMSLPLLLHSQRPYGDIFTVDID  729

Query  184  GTGLQ---------RLTWNGYENGTPAW  128
               ++         R+T + YEN TP W
Sbjct  730  PDDMEKNQDVEEFARVTHSRYENATPDW  757



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 106/199 (53%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG   VFRS R G    HKNLYI  D+  GE  GG + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGSRFVFRSTRDGGDKKHKNLYIAEDAEVGEYSGGTVTRLTNGEWTDTHCQ  547

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           +++++V+  D T + R+  +G +    V 
Sbjct  548  WSPRGDWIVFSSTRDKPKDAPELDNGLDSGYYAVFMVKVSDPTVVIRVVQSGDDLGGHV-  606

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  182
                NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIAMTADLAAVSADPISLPLFIHSVRPYGDIFVVDIDPDDARKNKD  662

Query  181  -TGLQRLTWNGYENGTPAW  128
                 R+T + YE  TPAW
Sbjct  663  VKKFHRVTHSRYEYSTPAW  681



>ref|XP_004963491.1| PREDICTED: uncharacterized protein LOC101774581 [Setaria italica]
Length=740

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 108/209 (52%), Gaps = 32/209 (15%)
 Frame = -2

Query  670  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQL  512
            +V+ + T G  NNAFPS +P+G   VFRS R G    HKNLYI+ DS  GE   G + +L
Sbjct  507  QVVNRLTKGDFNNAFPSSNPEGTKFVFRSTRDGGDKHHKNLYIMEDSDMGEHGEGTVTRL  566

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRPDGTGLRRIHVA  356
            TDG W DT  SWSP G  I FSS+R  P  A          F+I++V  +   +    V 
Sbjct  567  TDGPWTDTHCSWSPRGDWIVFSSSRDKPAGAPEKDILDPGFFAIFLVNANNPDV----VV  622

Query  355  GAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD  185
                S +     + H  FS D   ++ TA+L  V+AEP+S+P   +  +PYGD++ + L 
Sbjct  623  RVMKSSDTIAGHVTHPMFSPDMRSIVVTADLAAVSAEPISMPQFLHSVRPYGDVFSVNLR  682

Query  184  GT----------GLQRLTWNGYENGTPAW  128
             T             R+T + YE  TPAW
Sbjct  683  DTVDIAKNENIEEFHRITHSRYEYATPAW  711



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 113/207 (55%), Gaps = 29/207 (14%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQL  512
            ++K LT  +  NNAFP  +PDG  +VFRS R G    +KNLYII+ L+   DG G I +L
Sbjct  473  QVKRLTNGS--NNAFPCTNPDGTKLVFRSTRDGGENHYKNLYIIEDLDSMEDGEGEITRL  530

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPG-------NADCFSIYVVRPDGTGLRRIHVAG  353
            T+G W+DT   WSP+G+ I F+SNRH          +   F++Y+V+ D   +  + V G
Sbjct  531  TNGPWVDTHCEWSPNGEWIVFASNRHRTTDDSDHGLDTGYFAVYLVKADDPDV-WVKVIG  589

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG  182
            +   +      +NH  FS D   +   A+L  V+ +P+S+P   +  +PYGDL+++ +D 
Sbjct  590  SRSGDLAG--HVNHPFFSPDGRSLSVVADLAAVSCDPISMPLFIHSVRPYGDLFILDIDE  647

Query  181  TGL---------QRLTWNGYENGTPAW  128
              +         +R+T   YEN T  W
Sbjct  648  DDIYANEDVEDYRRITHTRYENSTAVW  674



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 112/199 (56%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+ +GE   G I +LT+G WIDT   
Sbjct  473  NNAFPSTNPDGTKLVFRSTRDGGDERYKNLYIMEDAESGEYGDGIITRLTNGPWIDTHCQ  532

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++Y+V+  D + + R+  +G++ +  V 
Sbjct  533  WSPRGDWIVFSSTRDKPEDAPESDNDLDPGYFAVYLVKANDPSVVVRVLGSGSDVAGHV-  591

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  173
                NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++ + +D   +     
Sbjct  592  ----NHPIFSPDGKSIVVTADLAAVSVDPISLPLFLHSVRPYGDIFTIDIDPDDIYMNED  647

Query  172  ----QRLTWNGYENGTPAW  128
                 R+T + YEN T +W
Sbjct  648  VEKCNRITHSRYENSTASW  666



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (54%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS +PDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G WIDT   
Sbjct  480  NNAFPSTNPDGTKLVFRSTRDGGDKKYKNLYIMEDARVGEYGDGKITRLTNGPWIDTHCQ  539

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G   +  V 
Sbjct  540  WSPRGNWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKANDSSVVVRVIKSGDNIAGHV-  598

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  182
                NH  FS D   +  T++L  V+ +PVS+P   +  +PYGD++ + +D         
Sbjct  599  ----NHPFFSPDGMSIAVTSDLAAVSVDPVSLPHFLHSVRPYGDVFTLDIDPDDINKNKD  654

Query  181  -TGLQRLTWNGYENGTPAW  128
                 R+T + YEN TP+W
Sbjct  655  LKKFNRITHSRYENATPSW  673



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 109/199 (55%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKQYKNLYIMEDAKVGEFGDGKITRLTNGPWTDTHCQ  542

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPDSDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-----  173
                NH  FS D   +  T++L  V+ +P+S+P   +  +PYGDL+++ +D + +     
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSVDPISLPLFLHSVRPYGDLFVVDIDPSDINKNKD  657

Query  172  ----QRLTWNGYENGTPAW  128
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/200 (38%), Positives = 103/200 (52%), Gaps = 33/200 (17%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  482
            NNAFPS +P G   VFRS R G     HKNLYI+ D+  GE   G + +LTDG W DT  
Sbjct  509  NNAFPSSNPQGDKFVFRSTRDGGKEKFHKNLYIMEDAEVGEFSEGTVTRLTDGPWTDTHC  568

Query  481  SWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  329
            SWSP G  + FSS R  P +A          F++Y+V+  D T + R+  + A  +  V 
Sbjct  569  SWSPRGDWVVFSSTREMPPSAPEMAFLDAGYFAVYLVKVSDPTAVVRVVQSSATLAGHV-  627

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  176
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  628  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDIAKNK  683

Query  175  ----LQRLTWNGYENGTPAW  128
                  R+T + YE  TP W
Sbjct  684  DIQEFHRITHSRYEYSTPTW  703



>gb|AEW08692.1| hypothetical protein CL1213Contig1_01, partial [Pinus radiata]
 gb|AFB33859.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFB33860.1| hypothetical protein CL1213Contig1_01, partial [Pinus mugo]
 gb|AFG48604.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = -2

Query  670  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEKGE--EGGIHALTEGPWID  85

Query  490  TMPSWSPDGKLI  455
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>ref|XP_004960704.1| PREDICTED: uncharacterized protein LOC101777811 [Setaria italica]
Length=754

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 113/239 (47%), Gaps = 48/239 (20%)
 Frame = -2

Query  679  VEIKVLTK-ETTG-------------NNAFPSCSPDGKHIVFRSGR----------SGHK  572
            VEIK + K E TG             N+AFPS + DG   VFR  R            H 
Sbjct  473  VEIKAIVKNEETGEWNKPNRLTKGEFNHAFPSSNHDGSKFVFRCTRDRTHGQSVRKQNHT  532

Query  571  NLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNR-----HNPGNADC-  413
            NLYI+ D+  GE   G + QLTDG W+DT  SWSP G  I FSS+R       PG  D  
Sbjct  533  NLYIMEDAEEGEWGEGTVTQLTDGPWVDTHCSWSPSGDWIVFSSSRDKDPDAQPGTLDAG  592

Query  412  -FSIYVVRP---DGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAE  245
             FSIY+V     D T            S +     +NH  FS D   ++FT++L  V+ E
Sbjct  593  YFSIYIVNAAERDPTNKTMPPPVRVVHSADTFIGHVNHPVFSHDMRSLIFTSDLAAVSVE  652

Query  244  PVSIP---NQFQPYGDLYMMRL----------DGTGLQRLTWNGYENGTPAWHPKAEVD  107
            P+S+P   +  +PYGD++ + L          + T   RLT + YE  TPAW   A VD
Sbjct  653  PISMPIFIHSVRPYGDIFSVDLRDDKDIAKNENITEFHRLTHSRYEYSTPAWTKFATVD  711



>gb|AFG48602.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48603.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
 gb|AFG48605.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 2/72 (3%)
 Frame = -2

Query  670  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE   GGI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEEGE--EGGIHALTEGPWID  85

Query  490  TMPSWSPDGKLI  455
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 105/199 (53%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG   VFRS R G    HKNLYI ++   GE   G + +LT+G W DT   
Sbjct  488  NNAFPSSSPDGNRFVFRSTRDGGDKKHKNLYIAENAEVGEYGDGTVTRLTNGEWTDTHCQ  547

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++++V+  D T + R+  +G +    V 
Sbjct  548  WSPSGDWIVFSSTRDKPKDAPELDNGLDPGYFAVFMVKASDPTVVIRVIRSGDDLGGHV-  606

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  182
                NH  FS D   ++ T++L  V+A+P+S+P   +  +PYGD++++ +D         
Sbjct  607  ----NHPVFSPDGRSIVVTSDLAAVSADPISLPLFIHSVRPYGDIFVVDIDPEDASKNKD  662

Query  181  -TGLQRLTWNGYENGTPAW  128
                 R+T + YE  TP W
Sbjct  663  VKKFHRVTHSRYEYSTPTW  681



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 34/201 (17%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  488
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  493  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  552

Query  487  MPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEE  335
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  553  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  612

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  182
            V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  613  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  667

Query  181  ---TGLQRLTWNGYENGTPAW  128
                G  R+T + YEN TPAW
Sbjct  668  EDVEGFVRVTHSRYENSTPAW  688



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 107/201 (53%), Gaps = 34/201 (17%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGG---IRQLTDGAWIDT  488
            NNAFPS +PDG   VFRS R G     KNLYI+ D+  GE + G    + ++T G W DT
Sbjct  486  NNAFPSTNPDGTKFVFRSTRDGGAKYSKNLYIMEDADAGEGEDGSQSTVTRMTAGEWTDT  545

Query  487  MPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEE  335
               WSP+GK I FSSNR  P +A           F++Y++      + R+  +G + +  
Sbjct  546  HCQWSPNGKWIVFSSNRDRPADAPERDHGLDPGYFAVYLMDVASRSVVRVIRSGYDVAGH  605

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG------  182
            V     NH  FS D   +  T++L  VTA+P+S+P   +  +PYGD++ + +D       
Sbjct  606  V-----NHPVFSPDGRSIAVTSDLAAVTADPMSLPLFLHSVRPYGDIFTVDIDPDDMARN  660

Query  181  ---TGLQRLTWNGYENGTPAW  128
                G  R+T + YEN TPAW
Sbjct  661  EDVEGFVRVTHSRYENSTPAW  681



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 109/202 (54%), Gaps = 22/202 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIID-SLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+AFPS + DG  +V+RS + G KNLYI++ +L GE +G  + +LT+G W DT   WSP 
Sbjct  484  NSAFPSTNADGTRLVYRSTKDGPKNLYIMENALLGEFEGAKVTRLTEGNWTDTHCQWSPK  543

Query  466  GKLIAFSSNRHNPG--------NADCFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRERLN  314
               I F+SNR NP         +   F +Y+V+  D T + ++  +G     ++    +N
Sbjct  544  QDWIVFASNRSNPTAKTPQDLPDPGFFGVYLVKANDKTVVVKVMDSGYTYLGDLFPGHVN  603

Query  313  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQ  170
            H  FS D E ++  A+L  V+ +PVS+P   +  +PYGD++++ ++              
Sbjct  604  HPFFSPDGESLVVAADLAAVSCDPVSMPLFVHSVRPYGDIFILDINRDDIYKNENLKKFT  663

Query  169  RLTWNGYENGTPAWHPKAEVDL  104
            R+T + YEN T  W   +  DL
Sbjct  664  RVTHSKYENSTATWTMTSTKDL  685



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 104/203 (51%), Gaps = 36/203 (18%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  485
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE   G + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTGKVTRLTSGAWTDTH  554

Query  484  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  341
             SWSP      I FSS R  P  A           F++++VR  D T + R+       S
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRV-----VRS  609

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  182
             +     +NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  610  ADSVAGHVNHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  181  -----TGLQRLTWNGYENGTPAW  128
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (54%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G I +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKITRLTNGPWTDTHCQ  542

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++++V+  D + + R+  +G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKSGDDLAGHV-  601

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  182
                NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D         
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  181  -TGLQRLTWNGYENGTPAW  128
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|WP_041858684.1| hypothetical protein [Candidatus Solibacter usitatus]
Length=611

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 99/185 (54%), Gaps = 27/185 (15%)
 Frame = -2

Query  664  LTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWID  491
            LT E  GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D
Sbjct  445  LTAEP-GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------D  494

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
              P WSP G LI FS           + IY ++PDG+ L+R+       +         H
Sbjct  495  NFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------H  540

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
            + +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPA
Sbjct  541  MAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPA  599

Query  130  WHPKA  116
            W P A
Sbjct  600  WQPMA  604


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -2

Query  658  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  93   KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  147

Query  490  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  353
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  148  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  201


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  452
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  61   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  115

Query  451  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
            F S R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F+
Sbjct  116  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  162

Query  271  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  163  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  209



>gb|ABJ88479.1| WD40 domain protein beta Propeller [Candidatus Solibacter usitatus 
Ellin6076]
Length=638

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 99/185 (54%), Gaps = 27/185 (15%)
 Frame = -2

Query  664  LTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI--RQLTDGAWID  491
            LT E  GNNAFPS SPDGK  V+R+       L I   +N E   G I  RQ       D
Sbjct  472  LTAEP-GNNAFPSFSPDGKRFVYRTFTEDGYGLRI---MNLETKTGKILTRQY------D  521

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
              P WSP G LI FS           + IY ++PDG+ L+R+       +         H
Sbjct  522  NFPLWSPRGDLITFSRQIEG-----AYEIYTIKPDGSSLKRLTFTKGNDA---------H  567

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
            + +S D E+++FT++  G   E V+  +  QPYG++++MR DGTG+++LT N +E GTPA
Sbjct  568  MAWSPDGEYIVFTSSRMGFKDE-VAYTDAPQPYGEIFVMRYDGTGVEQLTDNQWEEGTPA  626

Query  130  WHPKA  116
            W P A
Sbjct  627  WQPMA  631


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (52%), Gaps = 17/114 (15%)
 Frame = -2

Query  658  KETTGNNAF---PSCSPDGKHIVFRSGRSG-HKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            K+ T + A+    + S D K + F S R G   NL+ +D + G       R LT G   D
Sbjct  120  KQLTADPAYDDQATFSSDSKQLAFVSTRGGGTANLWTMDLVTGR-----ARALTSGPGGD  174

Query  490  TMPSWSPDGKLIAFSSNRHNP--------GNADCFSIYVVRPDGTGLRRIHVAG  353
              PSWSPDGK IAFSS R NP               IYV+RPDG+GL++I  +G
Sbjct  175  FRPSWSPDGKWIAFSSGRDNPVPFASGRWERLQLSDIYVIRPDGSGLKKITKSG  228


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 19/168 (11%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  452
            P+ +PDG  IVF S R+G  +L+ ++      DG G++QLT     D   ++S D K +A
Sbjct  88   PAWAPDGGSIVFTSERNGSADLFRVNP-----DGSGLKQLTADPAYDDQATFSSDSKQLA  142

Query  451  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
            F S R   G A+ +++ +V    TG  R   +G  G             +S D +W+ F+
Sbjct  143  FVSTRGG-GTANLWTMDLV----TGRARALTSGPGGD--------FRPSWSPDGKWIAFS  189

Query  271  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            +              + Q   D+Y++R DG+GL+++T +G   G+P W
Sbjct  190  SGRDNPVPFASGRWERLQ-LSDIYVIRPDGSGLKKITKSGNFCGSPKW  236



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 103/197 (52%), Gaps = 29/197 (15%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  476
            NNAFPS SPDGK +VFRS R+G    +KNLYI D+  GE   G + +LT+G W DT   W
Sbjct  502  NNAFPSSSPDGKKLVFRSTRNGGDKKYKNLYITDAEAGEYGNGFLTRLTEGDWTDTHCQW  561

Query  475  SPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE  323
            SP+   I FSS R  P +A           F++++V  +        V    GS      
Sbjct  562  SPNSDWIVFSSTRDKPKDAPPLDNGLDPGFFAVFLVNVNKPS----VVVRVVGSGNRLAG  617

Query  322  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQ------  170
             LNH  FS D   ++ T +L  V++EP+S+P   +  +PYGD++ + +D   ++      
Sbjct  618  HLNHPFFSPDGNSIVVTGDLAAVSSEPISLPLFLHSVRPYGDIFTVDIDPKNIEKNEDVE  677

Query  169  ---RLTWNGYENGTPAW  128
               R+T + YE  T +W
Sbjct  678  KFKRITHSRYEYSTASW  694



>gb|AFG48601.1| hypothetical protein CL1213Contig1_01, partial [Pinus taeda]
Length=97

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 2/72 (3%)
 Frame = -2

Query  670  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWID  491
            ++LTK+ T NNAFPS SPDGK +VFRSGRSGHKNLYI+D+  GE    GI  LT+G WID
Sbjct  28   RILTKDGTKNNAFPSSSPDGKQLVFRSGRSGHKNLYIMDAEKGE--ESGIHALTEGPWID  85

Query  490  TMPSWSPDGKLI  455
            TMPSWSPDG+ I
Sbjct  86   TMPSWSPDGEWI  97



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 103/203 (51%), Gaps = 36/203 (18%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  485
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  484  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  341
             SWSP      I FSS R  P  A           F++++VR  D T + R+  +    +
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRVVRSADSVA  614

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  182
              V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  615  GHV-----NHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  181  -----TGLQRLTWNGYENGTPAW  128
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 106/199 (53%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG  +VFRS R G    +KNLYI+ D+  GE   G + +LT+G W DT   
Sbjct  483  NNAFPSTSPDGTKLVFRSTRDGGDKKYKNLYIMEDAQVGEYGDGKVTRLTNGPWTDTHCQ  542

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVN  329
            WSP G  I FSS R  P +A           F++++V+  D + + R+   G + +  V 
Sbjct  543  WSPRGDWIVFSSTRDKPKDAPETDNGLDPGYFAVFLVKVNDPSVVIRVIKGGDDLAGHV-  601

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG--------  182
                NH  FS D   +  T++L  V+A+P+S+P   +  +PYGD++ + +D         
Sbjct  602  ----NHPFFSPDGMSIAVTSDLAAVSADPISLPLFLHSVRPYGDVFTVDIDPDDINKNKD  657

Query  181  -TGLQRLTWNGYENGTPAW  128
                 R+T + YEN TP W
Sbjct  658  VKKFNRITHSRYENSTPTW  676



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 103/203 (51%), Gaps = 36/203 (18%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTM  485
            NNAFPS SPDG  +VFRS R        HKNLY++ D+  GE     + +LT GAW DT 
Sbjct  495  NNAFPSSSPDGGRLVFRSTRDGGGGGRRHKNLYVMEDAAVGEFGTSKVTRLTSGAWTDTH  554

Query  484  PSWSPD--GKLIAFSSNRHNPGNADC---------FSIYVVRP-DGTGLRRIHVAGAEGS  341
             SWSP      I FSS R  P  A           F++++VR  D T + R+       S
Sbjct  555  CSWSPREGSDWIVFSSTRDKPAAAPADDNGLDPGYFAVFLVRASDPTVVVRV-----VRS  609

Query  340  EEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG----  182
             +     +NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D     
Sbjct  610  ADSVAGHVNHPVFSPDGRSIAVTADLAAVSADPISLPLFLHSVRPYGDIFTVDIDPDDIS  669

Query  181  -----TGLQRLTWNGYENGTPAW  128
                     R+T + YEN TPAW
Sbjct  670  KNRDVRAFHRVTHSRYENSTPAW  692



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score =   110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 105/218 (48%), Gaps = 39/218 (18%)
 Frame = -2

Query  670  KVLTKETTG--NNAFPSCSPDGKHIVFRSGRSG---------HKNLYII-DSLNGELDGG  527
            + L K T G  NNAFPS +P G  IVFRS +            KNLYI+ D++ GE    
Sbjct  501  RQLRKLTAGGFNNAFPSSNPAGTKIVFRSTKDAPPPPPGGFRQKNLYIMEDAMEGE--SA  558

Query  526  GIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG-TG  377
            G+ +LTDG W DT   WSP G  I FSS+RH P  A           F +Y+V P     
Sbjct  559  GVTRLTDGDWTDTHCQWSPSGDWIVFSSSRHKPDGAPKTDNFLDPGYFGVYLVNPASPKA  618

Query  376  LRRIHVAGAEGSEEVNRERLNHV---CFSSDSEWVLFTANLGGVTAEPVSIP---NQFQP  215
            + R+  +        N   L HV    FS D   ++ TA+L  V+ EP+S+P   +  +P
Sbjct  619  VVRVMTSALPPPVPTNVAGLGHVNHPMFSPDGRSIVVTADLAAVSVEPISMPMFLHSVRP  678

Query  214  YGDLYMMRLDGTGL---------QRLTWNGYENGTPAW  128
            YGD++   +D   +          R+T + YE  TP W
Sbjct  679  YGDIFSFDIDPVDMDKNKDIQKFHRVTHSRYEYATPVW  716



>ref|XP_010676033.1| PREDICTED: uncharacterized protein LOC104891943 [Beta vulgaris 
subsp. vulgaris]
Length=751

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 115/217 (53%), Gaps = 36/217 (17%)
 Frame = -2

Query  670  KVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH------KNLYIIDSLN-GELDGGGIRQL  512
            K LTK+   NNAFPS + +G  +VFRS R  H      KNLYI+ S + GE   G IR+L
Sbjct  478  KKLTKQF--NNAFPSTNGEGTQLVFRSTRDHHENGGIFKNLYIMKSADEGEFGRGEIRRL  535

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNA-DC--------FSIYVVRPDGTG-LRRIH  362
            T G  IDT   WSP    I FSSNR  P +A  C        FS+Y+V+ D    L R+ 
Sbjct  536  TTGNCIDTHCKWSPRNDWIVFSSNRDMPEDARKCDEDLDSGYFSVYLVKADNPDVLVRVM  595

Query  361  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  191
             +G++ +  V     NH  FS D + ++ T+++  V+A+P+S+P   +  +PYGD++ + 
Sbjct  596  YSGSDLAGHV-----NHPFFSPDGKSIVVTSDVAAVSADPMSLPLFLHSARPYGDIFTID  650

Query  190  LDGTGL---------QRLTWNGYENGTPAWHPKAEVD  107
            +D   +          R+T + YEN T  W   +  D
Sbjct  651  IDSDDINKNEDLKMFNRITHSRYENATGTWTKSSTRD  687



>gb|EMT14934.1| hypothetical protein F775_30553 [Aegilops tauschii]
Length=723

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 102/200 (51%), Gaps = 33/200 (17%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  482
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  478  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  537

Query  481  SWSPDGKLIAFSSNRHNPG--------NADCFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  329
            SWSP G  + FSS R  P         +A  F++Y+V+  D T + R+  + A  +  V 
Sbjct  538  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSDPTVVVRVVQSSATLAGHV-  596

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  176
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  597  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  652

Query  175  ----LQRLTWNGYENGTPAW  128
                  R+T + YE  TP W
Sbjct  653  DIQEFHRITHSRYEYSTPTW  672



>ref|XP_010676032.1| PREDICTED: uncharacterized protein LOC104891942 [Beta vulgaris 
subsp. vulgaris]
Length=662

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 98/190 (52%), Gaps = 27/190 (14%)
 Frame = -2

Query  616  DGKHIVFRSGRSGH--KNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  446
            DG  +V+RS R G+  KNLYI+ D+  GE  GG I +LT+G W DT   WSP+G  I F+
Sbjct  426  DGTKLVYRSSRDGNNCKNLYIMQDASKGEFMGGEITRLTEGEWTDTHCQWSPNGDWIVFA  485

Query  445  SNRHNPG--------NADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRE----RLNHVCF  302
            SNR NP         +   F IY+V+ D        +     S    RE     +NH  F
Sbjct  486  SNRANPTAPKKDDLPDPGYFGIYMVKADNKNAWLKVIDSGFDSTRPGRELFPGHVNHPFF  545

Query  301  SSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQRLTW  158
            S D + ++  A+L  V+ EP+S+P   +  +PYGD++ + LD          T  +RLT 
Sbjct  546  SPDGKSIVIAADLAAVSCEPISLPLFAHSVRPYGDIFTVDLDSENFENNANLTKFKRLTH  605

Query  157  NGYENGTPAW  128
            + YEN T  W
Sbjct  606  SRYENSTAVW  615



>gb|EMS49561.1| hypothetical protein TRIUR3_11240 [Triticum urartu]
Length=568

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 102/200 (51%), Gaps = 33/200 (17%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG-----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMP  482
            NNAFPS +  G   VFRS R G     HKNLYI+ D+  GE   G + +LT+G W DT  
Sbjct  323  NNAFPSSNAQGDKFVFRSTRDGGKEKFHKNLYIMEDAEEGEFGQGTVTRLTNGPWTDTHC  382

Query  481  SWSPDGKLIAFSSNRHNPGNAD--------CFSIYVVR-PDGTGLRRIHVAGAEGSEEVN  329
            SWSP G  + FSS R  P +A          F++Y+V+  + T + R+  + A  +  V 
Sbjct  383  SWSPKGDWVVFSSTREMPASAPEMAFLDAGYFAVYLVKVSNPTVVVRVVQSSATLAGHV-  441

Query  328  RERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG------  176
                NH  FS D   ++F ++L  V+ EP+S+P   +  +PYGD+  + L  T       
Sbjct  442  ----NHPIFSPDMRSIVFASDLAAVSNEPISMPVFLHSVRPYGDILSVDLRDTDDITKNK  497

Query  175  ----LQRLTWNGYENGTPAW  128
                  R+T + YE  TP W
Sbjct  498  DIQEFHRITHSRYEYSTPTW  517



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 102/199 (51%), Gaps = 32/199 (16%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS +PDG   VFRS R G    HKNLYI+ D+  GE   G +R+LT+G W DT  S
Sbjct  510  NNAFPSSNPDGTKFVFRSTRDGGAELHKNLYIMEDAEVGEFSEGTVRRLTNGPWTDTHCS  569

Query  478  WSPDGKLIAFSSNRHNPGNAD--------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNR  326
            WSP    I FSS+R     A          F++++V   D T + R+     + S+ V  
Sbjct  570  WSPKNDWIVFSSSRDKAAGAPKRDILDPGSFAVFMVMASDPTVVVRV----MKSSDSVA-  624

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  176
              + H  FS D   ++  A+L  V+ EP+S+P   +  +PYGD++ + L  T        
Sbjct  625  GHVTHPMFSPDMRSIVVAADLAAVSTEPISMPQFLHSVRPYGDIFSVDLRDTDDMSKNKD  684

Query  175  ---LQRLTWNGYENGTPAW  128
                 R+T + YE  TP W
Sbjct  685  IKEFHRITHSRYEYATPEW  703



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 110/205 (54%), Gaps = 30/205 (15%)
 Frame = -2

Query  664  LTKETTG-NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGG-IRQLTDG  503
            L + T G NNAFP  +PDG  +VFRS R G    +KNLYII+ L    +G G I +LT+G
Sbjct  473  LKRLTNGFNNAFPCTNPDGTKLVFRSTRDGGEKKYKNLYIIEDLQSMENGEGEITRLTNG  532

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPG-------NADCFSIYVVRPDGTGLRRIHVAGAEG  344
             W+DT   WSP G+ I F+SNR+          +   F++Y+V+ D   +  + V G+  
Sbjct  533  PWVDTHCDWSPSGEWIVFASNRNRTTEGMDHGLDTGYFAVYLVKADDPDV-WVKVIGSRS  591

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF----QPYGDLYMMRLDGTG  176
             +      +NH  FS D   +   ++L  V+ +P+S+P QF    +PYG+L+++ +D   
Sbjct  592  GDLAG--HVNHPFFSPDGRSLSVVSDLAAVSCDPISLP-QFIHSARPYGELFILDIDHDD  648

Query  175  L---------QRLTWNGYENGTPAW  128
            +         +R+T   YEN T  W
Sbjct  649  IYANEDVEDYRRITHTRYENSTAVW  673



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 103/213 (48%), Gaps = 44/213 (21%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-------GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  485
            N AFPS +P+G  +VFRS       G+   KNL+IID+  GE    G+ QLT+G W DT 
Sbjct  417  NCAFPSTNPEGTKLVFRSSRDRVQGGKREDKNLFIIDAEKGEY--AGVDQLTNGPWTDTH  474

Query  484  PSWSPDGKL--IAFSSNRHNPGNADC---------FSIYVVRPDGTG-----LRRIHVAG  353
             SWSP      I FSS+R  PG A           FS+Y+V           +R IH A 
Sbjct  475  CSWSPREGCDWIVFSSSRGKPGGAPASDHGLDSGYFSVYLVNAKDMAEGVVPVRVIHSAP  534

Query  352  AEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL--  188
                       +NH  FS D   ++FTA+L  V+ +P+S+P   +  +PYGD++ + L  
Sbjct  535  TIAGH------VNHPVFSPDMMSIVFTADLAAVSVDPISMPHFMHSVRPYGDIFSVELLD  588

Query  187  --------DGTGLQRLTWNGYENGTPAWHPKAE  113
                    D     R+T + YE  TP W P  +
Sbjct  589  REDMAKNKDIHKYHRITHSRYEYSTPTWSPHTD  621



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 106/202 (52%), Gaps = 22/202 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLN-GELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+AFPS +PDG  +V+RS + G KNLYI+++   GE +   + +LT G W DT   WSP 
Sbjct  658  NSAFPSSNPDGTRLVYRSTKHGPKNLYIMENAELGEFEEAKVTRLTKGNWTDTHCQWSPT  717

Query  466  GKLIAFSSNRHNPG--------NADCFSIYVVRPDGTGLR-RIHVAGAEGSEEVNRERLN  314
               I FSSNR  P         +A  F +Y+V  +   +  ++  +G      +    +N
Sbjct  718  QDWIVFSSNRSYPTAKTFEDLPDAGYFGVYLVNANNEDVVIKVIDSGYTYLGGLFPGHVN  777

Query  313  HVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDG---------TGLQ  170
            H  FS D + ++ TA+L  V+ +PVS+P   +  +PYGD++++ +DG             
Sbjct  778  HPFFSPDGKSLVVTADLAAVSCDPVSMPLFLHSVRPYGDIFVVDIDGDDIYKNENLKKFT  837

Query  169  RLTWNGYENGTPAWHPKAEVDL  104
            R+T + YEN T  W   +  DL
Sbjct  838  RVTHSRYENSTGTWTEASTKDL  859



>ref|XP_010105408.1| hypothetical protein L484_008562 [Morus notabilis]
 gb|EXC04631.1| hypothetical protein L484_008562 [Morus notabilis]
Length=424

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 110/207 (53%), Gaps = 30/207 (14%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTM  485
              NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT 
Sbjct  181  VSNNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTH  240

Query  484  PSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
              WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+  
Sbjct  241  CQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSD  296

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------  188
                +NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         
Sbjct  297  LAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNK  356

Query  187  DGTGLQRLTWNGYENGTPAWHPKAEVD  107
            D     R+T + YEN T +W P +  D
Sbjct  357  DVEKFNRITHSRYENSTASWTPFSTQD  383



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 96/179 (54%), Gaps = 25/179 (14%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSG----HKNLYI-IDSLNGELDGGGIRQLTDGAWIDTMPS  479
            NNAFPS SPDG   VFRS R G    +KNL+I +++ NG+   G   +LT G W DT   
Sbjct  524  NNAFPSSSPDGSKFVFRSTRDGGVKKYKNLHIMLEAENGQSGIGWETRLTKGPWTDTHCQ  583

Query  478  WSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDG--TGLRRIHVAGAEGSEEV  332
            WSP G  + FSS R  P +AD          FS+Y+V+P      +R +   G  G    
Sbjct  584  WSPTGDWVVFSSTRGKPRDADELDNGLDPGYFSVYLVKPSDPMVVIRVMDSMGDLGGH--  641

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGLQRL  164
                +NH  FS D   +  TA+L  V+ +P+S+P   +  +PYGD++M+ LD   L+ +
Sbjct  642  ----INHPVFSPDGRSIAVTADLAAVSVDPISLPMFMHAVRPYGDIFMIDLDTDNLKNI  696



>ref|XP_004980674.1| PREDICTED: uncharacterized protein LOC101756594 [Setaria italica]
Length=1083

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 109/212 (51%), Gaps = 32/212 (15%)
 Frame = -2

Query  667   VLTKETTGN--NAFPSCSPDGKHIVFRSGRSG----HKNLYII-DSLNGELDGGGIRQLT  509
             V  + T G+  NA+PS +P+G  +VF+S R      +KNLYI+ D+  GE   G + +LT
Sbjct  853   VFIQLTKGDFFNAYPSTNPEGTKVVFQSTRDHGDYEYKNLYIMEDAQIGEFGEGSVTRLT  912

Query  508   DGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVR-PDGTGLRRIHV  359
             +G WIDT   WSP G  I FSS R  P  A           F+IY+V   D T + R+  
Sbjct  913   NGPWIDTQCQWSPRGNWIVFSSTRDKPAAAPENYNELDPGHFAIYLVNAADPTVVVRVVT  972

Query  358   AGAEGSEEVNRE-RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP-----NQFQPYGDLYM  197
             +G  G    +    +NH  FS D   + FT+++  V+AEP+S+P        +PYGD++ 
Sbjct  973   SGDPGPGASSIAGHVNHPVFSPDGRSIAFTSDIAAVSAEPISMPMASVMASVRPYGDIFS  1032

Query  196   MRLDGTGL---------QRLTWNGYENGTPAW  128
             + +D   +          R+T + YE  T AW
Sbjct  1033  VDIDPDDICRNKDIDRVHRVTHSRYEYSTNAW  1064



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 105/219 (48%), Gaps = 43/219 (20%)
 Frame = -2

Query  670  KVLTKETTGNNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGEL-DGGGIRQ  515
            ++LTK    NNAFPS SPDG   VFRS R        HKNLYI+ D   GE  +GG + +
Sbjct  488  RLLTKGKF-NNAFPSSSPDGTRFVFRSTRDHAKSERKHKNLYIMEDQEVGEYGEGGKVTR  546

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIH  362
            LTDG W DT   WSP G  I FSS R  P  A           F++++V+     +    
Sbjct  547  LTDGEWTDTHCQWSPSGDWIVFSSTRDKPPTAAPLDHGLDPGYFAVFMVKASDPAV----  602

Query  361  VAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMR  191
            V    GS +     +NH  FS +   +  T++L  V+A+P+S+P   +  +PYGD++ + 
Sbjct  603  VIRVVGSGDDLSGHVNHPVFSPNGRSIAVTSDLAAVSADPISLPLFLHSVRPYGDIFAVD  662

Query  190  LDGT------------------GLQRLTWNGYENGTPAW  128
            +D                       R+T + YE  TP W
Sbjct  663  IDDILRLGDDAEKLKKIKDLRRKFHRITHSRYEYSTPEW  701



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score =   105 bits (261),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 110/197 (56%), Gaps = 30/197 (15%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR--SGHKNLYII-DSLNGELDGGGIRQLTDGAWIDTMPSWS  473
            N+AFPS + +G  +V+RS R    +KNLYI+ D+  GE   G I +LT+G+W DT   WS
Sbjct  487  NSAFPSTNREGTKLVYRSTRGDKRYKNLYIMEDAQVGEYGHGKITRLTNGSWTDTHCQWS  546

Query  472  PDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAEGSEEVNRE  323
            P G  I FSS R  P +A           F+IY+V+  D + + R+  +G++ +  V   
Sbjct  547  PTGDWIVFSSTRDKPEDAPKSDNGLDPGYFAIYLVKVNDPSVVVRVTGSGSDLTGHV---  603

Query  322  RLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTGL-------  173
              NH  FS D + ++ T++L GV+ +P+S+P   +  +PYGD++ + +D   +       
Sbjct  604  --NHPFFSPDRKSIVVTSDLAGVSVDPISLPLFLHSVRPYGDIFTIDIDPDDINKNWDVK  661

Query  172  --QRLTWNGYENGTPAW  128
               R+T + YEN T +W
Sbjct  662  EFNRITHSRYENATGSW  678



>gb|AFB33555.1| hypothetical protein 2_7121_02, partial [Pinus mugo]
Length=152

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM SWSPDG+ I
Sbjct  135  EGPWTDTMCSWSPDGEWI  152



>ref|XP_003575792.1| PREDICTED: uncharacterized protein LOC100821131 [Brachypodium 
distachyon]
Length=730

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 110/212 (52%), Gaps = 37/212 (17%)
 Frame = -2

Query  670  KVLTKETTG-NNAFPSCSPDGKHIVFRSG--RSG----HKNLYII-DSLNGELDGGGIRQ  515
            K LT +T   NNAFPS + +G  +VFRS   RSG     KNLYI+ D+  G+   G + Q
Sbjct  492  KQLTDDTKKYNNAFPSSNKEGDKLVFRSSCDRSGGDNKFKNLYIMEDATEGDSSAGKVTQ  551

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNRHN--PG------NADCFSIYVV--RPDGTGLRRI  365
            LT G W DT   WSP    I FSS+R    PG      +A CFSI++V  +     +R +
Sbjct  552  LTKGDWTDTHCCWSPTDDWIVFSSSRDRAPPGTDPAILDAGCFSIFMVNYKDPSVVVRVM  611

Query  364  HVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMM  194
            H      S+      + H  FS D + ++ T+++  V+A+P S+P   +  +PYGD++ +
Sbjct  612  H------SDMSLAGHVCHPVFSPDRKSIVVTSDVAAVSADPASLPIFIHSVRPYGDIFTI  665

Query  193  RL----------DGTGLQRLTWNGYENGTPAW  128
            +L          D     R+T + YEN TP W
Sbjct  666  KLRDPDCLEKNGDIVEFDRITHSRYENSTPTW  697



>gb|AFB33549.1| hypothetical protein 2_7121_02, partial [Abies alba]
Length=150

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -2

Query  700  DDSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGI  521
            D  D   +  K LTKE  GNNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+
Sbjct  73   DREDISEISYKTLTKE--GNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGL  128

Query  520  RQLTDGAWIDTMPSWSPDGKLI  455
             QLT+G W DTM +WSPDG+ I
Sbjct  129  WQLTEGPWTDTMCNWSPDGEWI  150



>gb|EMS54560.1| hypothetical protein TRIUR3_19354 [Triticum urartu]
Length=136

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 7/93 (8%)
 Frame = -2

Query  400  VVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQF  221
            +V P+GTGLRR+ V  A+G       R NH  FS DS+ ++FT++L  V+AEP+S P+ +
Sbjct  1    MVHPNGTGLRRV-VHSADGG------RTNHPWFSPDSKSMVFTSDLAAVSAEPISNPHHY  53

Query  220  QPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            QPYG+++ + +DG+GLQRLT N +E+GTP+W P
Sbjct  54   QPYGEIFTINIDGSGLQRLTHNSFEDGTPSWTP  86



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 101/214 (47%), Gaps = 47/214 (22%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR------SGHKNLYII-DSLNGELDGG----GIRQLTDGAW  497
            NNAFPS SPDG   VFRS R        HKNLYI+ D   GE         + +LTDG W
Sbjct  494  NNAFPSSSPDGTRFVFRSTRDHAKSEKKHKNLYIMEDQEFGEYGYDTVVPKVTRLTDGEW  553

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRP-DGTGLRRIHVAGAE  347
             DT   WSP G  I FSS R  P  A           F++++V+  D T + R+  +G +
Sbjct  554  TDTHCQWSPSGDWIVFSSTRDKPATAAPTDHGLDPGYFAVFMVKASDPTVVIRVVGSGDD  613

Query  346  GSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLD---  185
             S  V     NH  FS D   +  TA+L  V+A+P+S+P   +  +PYGD++ + +D   
Sbjct  614  LSGHV-----NHPVFSPDGRTIAVTADLAAVSADPISLPLFLHSVRPYGDIFAVDIDDIL  668

Query  184  ---------------GTGLQRLTWNGYENGTPAW  128
                                R+T + YE  TP W
Sbjct  669  RLGDDVEKLKKIKDLKKKFHRITHSRYEYSTPEW  702



>gb|AFG49274.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCTWSPDGEWI  152



>gb|AEW08359.1| hypothetical protein 2_7121_02, partial [Pinus radiata]
 gb|AFG49263.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49264.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49265.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49266.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49267.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49268.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49269.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49270.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49271.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49272.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49273.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49275.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49276.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49277.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49278.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49279.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
 gb|AFG49280.1| hypothetical protein 2_7121_02, partial [Pinus taeda]
Length=152

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K+LTKE   NNAFPS SPDGK++VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKED--NNAFPSPSPDGKYVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCTWSPDGEWI  152



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 107/200 (54%), Gaps = 30/200 (15%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLN-GELDGGGIRQLTDGAWIDTM  485
              NNAFPS +P G  +VFRS R+G    +KNLYI+++   GE   G I +LT+GAW DT 
Sbjct  474  VSNNAFPSTNPAGTKLVFRSTRNGGDKKYKNLYIMENAELGEYGDGIITRLTNGAWTDTH  533

Query  484  PSWSPDGKLIAFSSNRHNPGNAD---------CFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
              WSP G  I FSS R  P +A           F++++V+ +   +    V    GS+  
Sbjct  534  CQWSPRGDWIVFSSTRDKPDDAPESDNGLDPGYFAVFLVKANDPSV----VVRVLGSDSD  589

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---------  188
                +NH  FS D + ++ TA+L  V+ +P+S+P   +  +PYGD++++ +         
Sbjct  590  LAGHVNHPFFSPDGKSIVVTADLAAVSVDPISLPIFVHSVRPYGDIFIIDIDPDDINKNK  649

Query  187  DGTGLQRLTWNGYENGTPAW  128
            D     R+T + YEN T +W
Sbjct  650  DVEKFNRITHSRYENSTASW  669



>gb|EJL34752.1| periplasmic component of the Tol biopolymer transport system 
[Caulobacter sp. AP07]
Length=602

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 97/185 (52%), Gaps = 23/185 (12%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  497
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  432  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  483

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  484  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  530

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
             H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E GT
Sbjct  531  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFEKGT  589

Query  136  PAWHP  122
            PAW P
Sbjct  590  PAWAP  594


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 14/97 (14%)
 Frame = -2

Query  628  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  449
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  113  ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  167

Query  448  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRI  365
            SS+R   +P   +          IY+V+ DGT LRR+
Sbjct  168  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRV  204


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = -2

Query  628  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  449
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  69   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  123

Query  448  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
             S+R   G AD   I+++      LR + H    +              +S D  W+ F+
Sbjct  124  VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  168

Query  271  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  169  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  218



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 114/212 (54%), Gaps = 40/212 (19%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  503
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  487  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  544

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVR-PDGTGLRR  368
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V   + + + R
Sbjct  545  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  604

Query  367  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  197
            +  +G + +  V     NH  FS D + ++ T++L  V+ +P+S+P   +  +PYGD+++
Sbjct  605  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPISLPLFVHSVRPYGDIFI  659

Query  196  MRLDGTGL---------QRLTWNGYENGTPAW  128
              +D   +         +R T + +E  T +W
Sbjct  660  FDIDTKDIHKNKDLKTFKRATHSRFEYSTVSW  691



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 112/211 (53%), Gaps = 39/211 (18%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRSGRSG----HKNLYIIDSLNGELDGGGIRQLTDG  503
            L   TTG  NNAF S + +G  +V+RS R+G    +KNLYI+D+ +GE   G + +LT+G
Sbjct  486  LKTLTTGDFNNAFASTNIEGTQLVYRSTRNGGSEKYKNLYIMDAQSGE--DGCLTRLTEG  543

Query  502  AWIDTMPSWSPDGKLIAFSSNRHNPGNAD--------------CFSIYVVR-PDGTGLRR  368
             W DT   WSP+G  I FSS+R NP  AD               F++Y+V   + + + R
Sbjct  544  KWTDTHCQWSPNGDWIVFSSSRENPYGADQYKKENFDNGLDPGYFAVYLVNTSNPSAVVR  603

Query  367  IHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYM  197
            +  +G + +  V     NH  FS D + ++ T++L  V+ +P S+P   +  +PYGD+++
Sbjct  604  VAGSGYDLAGHV-----NHPFFSPDGKSIVVTSDLAAVSVDPTSLPLFVHSVRPYGDVFI  658

Query  196  MRLDGTGL--------QRLTWNGYENGTPAW  128
               D   +        +R T + +E  T +W
Sbjct  659  FDFDCNDMNQEDLKTFKRATHSRFEYSTVSW  689



>gb|EMT06488.1| hypothetical protein F775_06751 [Aegilops tauschii]
Length=739

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 104/207 (50%), Gaps = 44/207 (21%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRS--------GHKNLYII-DSLNGELDGGGIRQLTDGAWID  491
            NNAFPS + DG  +VFRS R+         +KNLYI+ D+  GE   G + QLTDG W D
Sbjct  515  NNAFPSSNKDGTKLVFRSTRNRMGKPEDVKYKNLYIMEDADEGEWGSGTVTQLTDGPWTD  574

Query  490  TMPSWSPDGKLIAFSSNR-HNPG-------NADCFSIYVVRPD--GTGLRRIHVAGAEGS  341
            +  +WSP    I FSS+R   PG       +A  FSI++V        +R +H A +   
Sbjct  575  SHCTWSPTDDWIVFSSSRDRAPGAPDRDILDAGFFSIFLVLATDPSVLVRVMHSADSLA-  633

Query  340  EEVNRERLNHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRL---  188
                     HVC   FS   + ++ T+++ GV+A+PVS+P   +  +PYGD++ + L   
Sbjct  634  --------GHVCHPVFSPFKDSIVVTSDIAGVSADPVSLPIFIHSVRPYGDIFTINLRDK  685

Query  187  -------DGTGLQRLTWNGYENGTPAW  128
                   D     R+T   YE  TP W
Sbjct  686  NDIMKNKDIMEFDRITHTRYEYSTPTW  712



>gb|AEW08360.1| hypothetical protein 2_7121_02, partial [Pinus lambertiana]
 gb|AFB33551.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33552.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>ref|WP_035092853.1| hypothetical protein [Caulobacter henricii]
Length=625

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DGK IVFR      K L +I+     LD   IR LT G   D +P WSPDG
Sbjct  471  HSGFPSYSADGKEIVFRVWGEAEKGLRVIN-----LDTRQIRVLTTG--YDNLPFWSPDG  523

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            K I F+       +A  F IY +RPDG+ L+R+           NR    H  +S+D + 
Sbjct  524  KRIVFTRKV----DAVNFDIYTIRPDGSDLQRL---------TTNRGNDGHAVWSADGK-  569

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            +LF+  + G   E     N FQPYG + +M  DGTG + +T + +E+  P + P
Sbjct  570  ILFSTGMYGFREEAALYDNTFQPYGQIMVMSADGTGKRLVTDSLWEDSMPLYLP  623


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 21/105 (20%)
 Frame = -2

Query  625  CSPDGKHIVFRSGRSGHK-NLYIIDSLNGELD----GGGIR---QLTDGAWIDTMPSWSP  470
             SPDG  + F S R G++ N+++ D   G L     G G++    L DG +    P+WSP
Sbjct  122  LSPDGARLAFVSTRDGYRTNIWLKDLKTGRLTNLTGGEGVQGDPSLPDGFF---RPAWSP  178

Query  469  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  365
            DGK +AFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  179  DGKWLAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  223



>gb|AFB33553.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
 gb|AFB33554.1| hypothetical protein 2_7121_02, partial [Pinus cembra]
Length=152

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K+LTK+   NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKILTKKD--NNAFPSPSPDGKFVVFRSGRNGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>gb|AFB33550.1| hypothetical protein 2_7121_02, partial [Larix decidua]
Length=152

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 4/78 (5%)
 Frame = -2

Query  688  EIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLT  509
            E  +  K LTK    NNAFPS SPDGK +VFRSGR+GHKNLYI+D+  GE   GG+ QLT
Sbjct  79   ESEISYKTLTK--VDNNAFPSPSPDGKFVVFRSGRTGHKNLYIMDAEEGEE--GGLWQLT  134

Query  508  DGAWIDTMPSWSPDGKLI  455
            +G W DTM +WSPDG+ I
Sbjct  135  EGPWTDTMCNWSPDGEWI  152



>emb|CDM86908.1| unnamed protein product [Triticum aestivum]
Length=731

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 100/199 (50%), Gaps = 38/199 (19%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGR--------SGHKNLYII-DSLNGELDGGGIRQLTDGAWID  491
            N+AFPS +P G   VFRS R        + + NLYI+ D+  GE   G + QLTDG W D
Sbjct  494  NDAFPSSNPAGTKFVFRSTRNRSGRPEDAKYNNLYIMEDAEEGEWGEGTVTQLTDGPWTD  553

Query  490  TMPSWSPDGKLIAFSSNRHNP--GNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            +  SWSP G  I FSS+R      +A CFSI++V      +  + V    G         
Sbjct  554  SHCSWSPRGDWIVFSSSRDRDILDSAGCFSIFLVLATDRKV-LVRVMSLPG---------  603

Query  316  NHVC---FSSDSEWVLFTANLGGVTAEPVSIP---NQFQPYGDLYMMRLDGTG-------  176
             HVC   FS D + ++ T+++  V+A+PVS+P      +PYGD++ ++L  T        
Sbjct  604  -HVCHPIFSPDMDNLVVTSDVAVVSADPVSLPIFIASGRPYGDMFSIKLRDTTDINKNKD  662

Query  175  ---LQRLTWNGYENGTPAW  128
                 R+T   YE   P+W
Sbjct  663  IMEFHRITHTRYEYSKPSW  681



>ref|WP_035205184.1| hypothetical protein [Acidovorax sp. CF316]
Length=622

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  445  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  502

Query  493  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  503  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  553

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
             H  +++D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  554  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  613

Query  136  PAWHP  122
            P + P
Sbjct  614  PQYAP  618


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 74/152 (49%), Gaps = 20/152 (13%)
 Frame = -2

Query  628  SCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            + SPD   + F S R G   N++++D    +L       GI+   D       PSWSPDG
Sbjct  102  ALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQGRADSPNGFFRPSWSPDG  161

Query  463  KLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRIHVAG--AEGSEEVNRER  320
            + +AFSS+R      H+ G    +    SIYV+R DGTG R+I       +GS + + + 
Sbjct  162  QWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKISSRKDYCQGSPKWSADG  221

Query  319  LNHVCFSSDSE---WVLFTANLGGVTAEPVSI  233
               V + + +E   WVL    L  + ++ VS+
Sbjct  222  KRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  253



>gb|EJE50504.1| periplasmic component of the Tol biopolymer transport system 
[Acidovorax sp. CF316]
Length=637

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            ++ LT ++  N  FPS S DGK +VFR       +  +       L+   IR +T G   
Sbjct  460  LEQLTDDSVFNAGFPSYSADGKEVVFRIANQDPSSASLGGLAVLNLETRQIRHITRG--Y  517

Query  493  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ LRR+    A           
Sbjct  518  DNMPIWSPDGSRILFNRGVRNPDSIWSNFDLYTVRPDGSDLRRLTDHPASD---------  568

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
             H  +++D + +L+ +   G   E       FQPYG +++M  DG+G +++T + +E+ T
Sbjct  569  GHPVWTADGKQILYNSGQAGYRDEACHYDQTFQPYGQVFVMNADGSGKRQITDSIWEDST  628

Query  136  PAWHP  122
            P + P
Sbjct  629  PQYAP  633


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (49%), Gaps = 21/169 (12%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGH-KNLYIID----SLNGELDGGGIRQ  515
             +++ LT  +   +A  + SPD   + F S R G   N++++D    +L       GI+ 
Sbjct  101  TQVERLTDGSIVEDA-AALSPDASKVAFVSTRDGMLANIWMLDLKIRTLKNLTGVKGIQG  159

Query  514  LTDGAWIDTMPSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  365
              D       PSWSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTG R+I
Sbjct  160  RADSPNGFFRPSWSPDGQWLAFSSDRDTEWKGHHNGAGWEHTQELSIYVIRADGTGFRKI  219

Query  364  HVAG--AEGSEEVNRERLNHVCFSSDSE---WVLFTANLGGVTAEPVSI  233
                   +GS + + +    V + + +E   WVL    L  + ++ VS+
Sbjct  220  SSRKDYCQGSPKWSADGKRIVFYETQAEYTYWVLRPDLLLKIDSQIVSV  268



>ref|WP_020604165.1| hypothetical protein [Spirosoma spitsbergense]
Length=612

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N+ FPS SPDG+ IV+R        L I++ LN +L    ++ LT     D +P WSPDG
Sbjct  454  NSGFPSWSPDGQRIVYRVWGEKDSGLRILN-LNDKL----VQVLTTE--YDNLPFWSPDG  506

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
             LI+F+  +H+  N   F I+ +RPDGT LR++    A  +         H  +++DS+ 
Sbjct  507  SLISFT-RKHDDNN---FDIFTIRPDGTNLRQLTTTPANDA---------HAYWTADSKH  553

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKA  116
            +++++ + G   E     N FQPYG ++ M  DG+  ++LT + +E+  P   PKA
Sbjct  554  LMWSSGIYGFKDEAALYDNTFQPYGAIFSMNADGSDKRQLTDSAWEDSMPVVVPKA  609


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 86/193 (45%), Gaps = 24/193 (12%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  497
            E K+L   T+G +   S S +G+ IVF S R+G   L   D      DG  + +LTD   
Sbjct  57   ERKLLA--TSGLDYHASYSGNGQWIVFTSERNG---LGQADIYRVHPDGTALERLTDSPA  111

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            +D   + SPDG  + F S R         +I+++      + ++    A   +       
Sbjct  112  LDDQAALSPDGSKVTFVSTRE----MHTANIWLLDIKSKKVTKLTALPAIQGDSTKPNGF  167

Query  316  NHVCFSSDSEWVLFTAN-----LG---GVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLT  161
                +S D +W+ F ++     LG   G   E V      Q  G +Y++  DGTGL++L+
Sbjct  168  FRPSWSPDGKWIAFASDRNTQWLGHGNGAGWEHV------QELG-IYVVHPDGTGLRKLS  220

Query  160  WNGYENGTPAWHP  122
              G  +G+P W P
Sbjct  221  QAGICSGSPKWSP  233



>ref|WP_006298539.1| hypothetical protein [Hylemonella gracilis]
 gb|EGI76207.1| hypothetical protein HGR_12282 [Hylemonella gracilis ATCC 19624]
Length=638

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            ++ LT ++  N  FPS S DGK +VFR      K+  +       L+   IR++T G   
Sbjct  461  LEQLTDDSIFNAGFPSYSADGKEVVFRIANEDPKSASLGGLAVLNLETRQIRRITAG--Y  518

Query  493  DTMPSWSPDGKLIAFSSNRHNPGNA-DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            D MP WSPDG  I F+    NP +    F +Y VRPDG+ L+R+    A           
Sbjct  519  DNMPIWSPDGSRILFNRGVRNPNSIWSNFDLYTVRPDGSDLQRLTSHPASD---------  569

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
             H  ++ D + +L+ + + G   E       FQPYG L++M  DG   +++T + +E+ T
Sbjct  570  GHPVWTPDGKQILYNSGMAGYRDEACHYDQTFQPYGQLFVMDADGRNKRQITDSIWEDST  629

Query  136  PAWHP  122
            P + P
Sbjct  630  PQYVP  634


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 74/157 (47%), Gaps = 32/157 (20%)
 Frame = -2

Query  622  SPDGKHIVFRSGRSGH-KNLYIIDSLNGELDGGGIRQLT--DGAWIDTM---------PS  479
            SPDG  + F S R G   N++++D     L    +R LT   G   D +         PS
Sbjct  118  SPDGSKVAFVSTRDGFLANIWVLD-----LQTRKLRNLTGIKGVQADDLQNSPSGFFRPS  172

Query  478  WSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI-----HVAGAEG  344
            WSPDG+ +AFSS+R      H+ G    +    SIYV+R DGTGLRR+     H  G+  
Sbjct  173  WSPDGQWLAFSSDRNTEWKGHHDGAGWEHTQELSIYVIRVDGTGLRRVASRKDHCLGSPR  232

Query  343  SEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSI  233
                 +  + +   +  + WVL    L  + ++ VS+
Sbjct  233  WSGDGKRIVFYETLAEYTYWVLRPDLLLKIDSQIVSV  269



>ref|WP_029915040.1| hypothetical protein [Caulobacter sp. UNC358MFTsu5.1]
Length=618

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 90/174 (52%), Gaps = 21/174 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DGK IVFR     +  L +I+     LD   +R LT G  +D +P WSPDG
Sbjct  464  HSGFPSYSADGKEIVFRVWGENNMGLRVIN-----LDTREVRTLTTG--LDNLPFWSPDG  516

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            K I F+       +A  F ++ +RPDG+ L+R+           NR    H  +++D   
Sbjct  517  KRIVFTRKV----DAVNFDVFTIRPDGSDLQRL---------TTNRGNDGHAVWTADGR-  562

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            +L++  + G   E     N FQPYG + +M  DGTG + LT + +E+  P + P
Sbjct  563  ILWSTGMYGFREEAALYDNTFQPYGQIMVMNADGTGKRLLTDSLWEDSMPLYLP  616


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 21/105 (20%)
 Frame = -2

Query  625  CSPDGKHIVFRSGRSGHK-NLYIID-------SLNGELDGGGIRQLTDGAWIDTMPSWSP  470
             SPDG  + F S R G++ N++I D       +L G  D  G   L DG +    P+WSP
Sbjct  115  LSPDGTRLAFVSTREGYRTNIWIKDLKSGRLTNLTGAADVQGDPSLPDGFF---RPAWSP  171

Query  469  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  365
            DGK IAFSS+R      H+ G    +    SIYV+  DG G RR+
Sbjct  172  DGKQIAFSSDRNTDWRGHHDGKGWEHTQELSIYVIGVDGKGFRRV  216



>gb|KFY81759.1| hypothetical protein V500_11119 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=665

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-  543

Query  493  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  145  NGTP  134
            +  P
Sbjct  654  DSMP  657



>gb|KFZ03462.1| hypothetical protein V502_10931 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=666

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LTD  W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----LTDKTTTNLTDD-W-  543

Query  493  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            D  P WSPDG+LI F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGELIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQVTTSGANDA-----  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+    LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMLTDSMWE  653

Query  145  NGTP  134
            +  P
Sbjct  654  DSMP  657



>ref|NP_001066679.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|ABA97669.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29698.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|EAY82937.1| hypothetical protein OsI_38155 [Oryza sativa Indica Group]
 gb|EAZ20324.1| hypothetical protein OsJ_35933 [Oryza sativa Japonica Group]
Length=777

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 72/219 (33%), Positives = 99/219 (45%), Gaps = 58/219 (26%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRS-------GHKNLYIIDSLNGELDGGGIRQLTDGAWIDTM  485
            N AFPS + +G  +VFRS R+        HKNLYIID+  GE    G+  LTDG W DT 
Sbjct  517  NCAFPSTNAEGTKLVFRSSRNRVAGGERQHKNLYIIDAEKGE--AAGVVPLTDGPWTDTH  574

Query  484  PSWSPDGKL--IAFSSNRH------------------NPGNADCFSIYVVRPDGTG----  377
             SWSP      I FSS                     +PG    F++Y+V          
Sbjct  575  CSWSPREGCDWIVFSSTGRPEKDIVKGKDEPEKDHGLDPG---YFAVYLVNAKDIKKGEV  631

Query  376  ---LRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIP---NQFQP  215
               +R IH A            +NH  FS D + ++F A+L  V+A+P+S+P   +  +P
Sbjct  632  PVPVRVIHSAPTIAGH------INHPVFSPDMKSIVFAADLAAVSADPISMPHFTHSVRP  685

Query  214  YGDLYMMRLDGTG----------LQRLTWNGYENGTPAW  128
            YGD++ + L  T             R+T + YE  TP W
Sbjct  686  YGDIFSVNLRDTTDMAKNRDIQEFHRITHSRYEYSTPTW  724



>gb|KFY12538.1| hypothetical protein V491_06750 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=665

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 94/184 (51%), Gaps = 24/184 (13%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            LT  T G  N+ FPS SPDG  +V+R  G  G   L I++     L       LT   W 
Sbjct  491  LTFGTAGEVNSGFPSFSPDGTQLVYREFGPDGPLGLRIMN-----LADKTTTNLT-ADW-  543

Query  493  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            D  PSWSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPSWSPDGKRIVFTRRNHINWDDIGATDSFDIYTIAPDGTGLAQLTTSGANDA-----  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
                H  +S+D   +++T+ + G   E V+  N FQPYG + +M  DG+  + LT + +E
Sbjct  599  ----HAAWSADGR-IMYTSGMYGFREESVNYDNTFQPYGQIVIMDADGSNKRMLTDSMWE  653

Query  145  NGTP  134
            +  P
Sbjct  654  DSMP  657



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 4/72 (6%)
 Frame = -2

Query  697  DSDEIPVEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGG--  524
            D DE+   +KVLT+  +GN+AFP+ SP GK IVFRSGRSGHKNLYI+D+ +GE DG G  
Sbjct  432  DRDEVAATLKVLTRPESGNDAFPAVSPCGKWIVFRSGRSGHKNLYIVDAAHGE-DGAGEG  490

Query  523  -IRQLTDGAWID  491
             IR+LTDG WID
Sbjct  491  TIRRLTDGEWID  502



>ref|WP_043399319.1| tolB protein precursor protein, partial [Cystobacter violaceus]
Length=349

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 102/210 (49%), Gaps = 39/210 (19%)
 Frame = -2

Query  679  VEIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGA  500
             E+  LT+   GN   PS SPDG  + F S R+G   +Y++ +     DG  +R+LT   
Sbjct  149  AEVTRLTQAPEGNFE-PSVSPDGTQVAFVSSRTGDPEIYVMKA-----DGTDVRRLTSFH  202

Query  499  WIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEE-----  335
              D  P WSPDGK I+F S+R          ++VV+PDGTGLR +  +   G E      
Sbjct  203  KEDMAPKWSPDGKWISFLSDREG-----RVRVFVVKPDGTGLRAVSGSQQTGEEREPVWS  257

Query  334  VNRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPN--------QFQPYG----------  209
             + ++L  V  + D +  ++ A++GG   EPV++ +        ++ P G          
Sbjct  258  PDGKKLAFVGRAKDQKSRIWVADMGG--GEPVALTDGKSTDDQPEWSPDGKYLAFASERT  315

Query  208  ---DLYMMRLDGTGLQRLTWNGYENGTPAW  128
               +L++MR +G+G  +LT     +  P W
Sbjct  316  GDVELFLMRANGSGQTQLTSTKGADWLPRW  345



>gb|KFY42678.1| hypothetical protein V495_04387 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59861.1| hypothetical protein V497_04044 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=665

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 24/186 (13%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-  543

Query  493  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
                H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  145  NGTPAW  128
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFY02373.1| hypothetical protein O988_02191 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=665

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 94/186 (51%), Gaps = 24/186 (13%)
 Frame = -2

Query  664  LTKETTG--NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWI  494
            LT  T G  N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W 
Sbjct  491  LTFGTAGEVNSGFPSFSPFGDQLVYRDFGPDGGLGLRILN-----ITDKTTINLTDG-W-  543

Query  493  DTMPSWSPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
            D  P WSPDGK I F+   H    + G  D F IY + PDGTGL ++  +GA  +     
Sbjct  544  DNNPGWSPDGKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA-----  598

Query  325  ERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
                H  +S+D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E
Sbjct  599  ----HAAWSADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWE  653

Query  145  NGTPAW  128
            +  P +
Sbjct  654  DSMPVY  659



>gb|KFX90155.1| hypothetical protein V490_06619 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=665

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (51%), Gaps = 22/177 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+ FPS SP G  +V+R  G  G   L I++     +       LTDG W D  P WSPD
Sbjct  500  NSGFPSFSPVGDQLVYRDFGPDGGLGLRILN-----ITDKTTTNLTDG-W-DNNPGWSPD  552

Query  466  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  ++
Sbjct  553  GKRIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWT  603

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            +D   +++T+ + G   E V+  + FQPYG + +M  DGT    LT + +E+  P +
Sbjct  604  ADGR-IVYTSGMYGFRDECVNYDSTFQPYGQIVVMNADGTNKTMLTDSMWEDSMPVY  659



>ref|XP_001545913.1| hypothetical protein BC1G_15641 [Botrytis cinerea B05.10]
 gb|EMR86797.1| putative tat pathway signal sequence domain-containing protein 
[Botrytis cinerea BcDW1]
 emb|CCD52696.2| similar to prolyl oligopeptidase [Botrytis cinerea T4]
Length=674

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 86/176 (49%), Gaps = 18/176 (10%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N  FPS SPDG  IV+R    G   LY I      L  G +  LTD  W D  P WSPDG
Sbjct  507  NAGFPSYSPDGTKIVYR--ECGPAPLYCIGLRILNLADGTVTNLTD-TW-DNTPGWSPDG  562

Query  463  KLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  296
            + I F+   H    +  + D + +Y + P+GTGL ++  +GA  +         H  +S+
Sbjct  563  ERIVFTRRNHLNFDDLSSTDSYDVYTIFPNGTGLTQVTTSGANDA---------HAVWSA  613

Query  295  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            D   +L+++ + G   E     N FQPYG +  M  DG+    LT + +E+  P +
Sbjct  614  DGR-ILYSSGMYGFREESPLYDNAFQPYGQIISMNFDGSNKTMLTDSMWEDSMPLY  668



>ref|WP_035035180.1| hypothetical protein, partial [Caulobacter sp. AP07]
Length=544

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 91/177 (51%), Gaps = 23/177 (13%)
 Frame = -2

Query  673  IKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAW  497
            +K+LTK  TGN  FP  S DG+HIV+R  ++G  N L ++D     LD G    L  G  
Sbjct  390  LKLLTK-GTGNFGFPDWSGDGRHIVYR--QAGAANALDVVD-----LDSGESHVLLAGPA  441

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
                P+WSP   +IAF+++         + IY +R DG+GL+R+  +    +        
Sbjct  442  HYNFPAWSPTADVIAFTADIDG-----DYEIYSIRADGSGLKRLTRSPGNDA--------  488

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYE  146
             H  +S D +W+ F +  GG   E +  P   QPYG++Y+MR DG+    LT   +E
Sbjct  489  -HNAWSPDGKWIAFASARGGFKDEALLHPANPQPYGEIYVMRADGSEAHALTDEPFE  544


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 14/97 (14%)
 Frame = -2

Query  628  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  449
            + SPDG+ + F S R G  +++I+D     L    +R LT     D  PSWSPDG+ +AF
Sbjct  71   ALSPDGRSLAFVSSRGGQADIWILD-----LASKALRNLTHDPAGDFRPSWSPDGRWLAF  125

Query  448  SSNR--HNPGNAD-------CFSIYVVRPDGTGLRRI  365
            SS+R   +P   +          IY+V+ DGT LRR+
Sbjct  126  SSDRVSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRV  162


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (48%), Gaps = 27/173 (16%)
 Frame = -2

Query  628  SCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAF  449
            S S DG+ ++F S R+G  ++Y        LDG G+ +L      D   + SPDG+ +AF
Sbjct  27   SFSSDGQWVLFTSRRAGTSDIY-----RAHLDGSGLERLVASPAYDDQAALSPDGRSLAF  81

Query  448  SSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
             S+R   G AD   I+++      LR + H    +              +S D  W+ F+
Sbjct  82   VSSRG--GQAD---IWILDLASKALRNLTHDPAGD----------FRPSWSPDGRWLAFS  126

Query  271  ANLGGVTAEPVSIPN---QFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            ++     +E   IP      +   ++Y++++DGT L+R+T +G   G+P W P
Sbjct  127  SDR---VSEHPRIPEGDFTLRHSTEIYIVKVDGTELRRVTRDGQFAGSPTWSP  176



>gb|KFY15902.1| hypothetical protein V492_01680 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=652

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 89/175 (51%), Gaps = 22/175 (13%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+ FPS SPDG  +V+R  G  G   L I++     +       LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPDGTQLVYRDFGPDGGLGLRILN-----IADNTTTTLTED-W-DNNPGWSPD  539

Query  466  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLMQLTTSGANDA---------HAAWS  590

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>gb|KFZ05841.1| hypothetical protein V501_07970 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=665

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 22/177 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+ FPS SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  500  NSGFPSFSPDGTQLVYRDFGPEGGLGLRILN-----LADRTTTNLTED-W-DNNPGWSPD  552

Query  466  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  553  GERIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  603

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            +D   +++T+ + G   E V+  N FQPYG +  M  DG+    +T + +E+  P +
Sbjct  604  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVAMNADGSNKTLVTDSMWEDSMPVY  659



>ref|WP_034400879.1| translocation protein TolB [Candidatus Pelagibacter ubique]
Length=441

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 101/219 (46%), Gaps = 44/219 (20%)
 Frame = -2

Query  679  VEIKVLTKETTGN----NAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQL  512
            ++I+  T+E  GN       P  SPDGK IV    + G+ ++Y +D     LD   + ++
Sbjct  232  LDIETGTQEVVGNFPGMTFAPRFSPDGKKIVMSFAKDGNSDIYTMD-----LDTRVVERI  286

Query  511  TDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEV  332
            TD + IDT PS+SPDGK IAF+S+R     +    IYV+R DG+G++RI          V
Sbjct  287  TDHSSIDTSPSFSPDGKFIAFNSDR-----SGLQQIYVMRSDGSGVKRITFGNGIYGTPV  341

Query  331  NRERLNHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYM--MRLDGTGLQRLTW  158
               R + + F+   +                         G  Y+  MR DGTG + LT 
Sbjct  342  WSPRGDLIAFTKMRK-------------------------GRFYIGVMRTDGTGERLLTE  376

Query  157  NGYENGTPAWHPKAEVDLARLSLGKSGEKLRGKFDEPLW  41
            N Y+   P+W P   V L      K+G K  G F   LW
Sbjct  377  NYYQEA-PSWSPNGRV-LVFYRETKAGSKGEG-FSAKLW  412


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 12/115 (10%)
 Frame = -2

Query  709  DGDDDSDEIPVEIKVLTKET--TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGEL  536
            DG+ D   + ++ +V+ + T  +  +  PS SPDGK I F S RSG + +Y++ S     
Sbjct  268  DGNSDIYTMDLDTRVVERITDHSSIDTSPSFSPDGKFIAFNSDRSGLQQIYVMRS-----  322

Query  535  DGGGIRQLTDGAWIDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLR  371
            DG G++++T G  I   P WSP G LIAF+  R        F I V+R DGTG R
Sbjct  323  DGSGVKRITFGNGIYGTPVWSPRGDLIAFTKMRKG-----RFYIGVMRTDGTGER  372



>ref|WP_020383615.1| hypothetical protein [Candidatus Poribacteria sp. WGA-4E]
Length=342

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 94/201 (47%), Gaps = 44/201 (22%)
 Frame = -2

Query  646  GNNAFPSCSPDGKHIVFRSGRSGH--------KNLYIIDSLNGELDGGGIRQLTDGAWID  491
            G + FPS SPDGKHIVF S R GH          +Y++D+     DGG  ++LT+    D
Sbjct  167  GEDRFPSWSPDGKHIVFSSRRDGHFRGNFGITHEIYVMDT-----DGGNQQRLTENRTND  221

Query  490  TMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNH  311
              PSWSPDGK IAFSS+R   G+ + F IYV+  DG   +++           NR     
Sbjct  222  WHPSWSPDGKRIAFSSDRK--GDFENFEIYVMDADGGNQQKL---------TENRVYDWR  270

Query  310  VCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPA  131
              +S D++ + F +   G                ++Y+M  DG   Q LT N   +  PA
Sbjct  271  PSWSPDAKRITFASERDGNY--------------EIYVMDADGGNPQNLTNNPNYDALPA  316

Query  130  WHPKAEVDLARLSLGKSGEKL  68
            W   A       S+  +G+K 
Sbjct  317  WFGSA------FSVSPAGKKF  331


 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 89/182 (49%), Gaps = 34/182 (19%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRS----GHKNL--YIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  470
            PS SPDGK IVF S R     GH NL  Y++D+     DGG  + LT+    D  PSWSP
Sbjct  122  PSWSPDGKRIVFTSRRKKDADGHFNLEIYVMDA-----DGGNQQNLTNNPGEDRFPSWSP  176

Query  469  DGKLIAFSSNR--HNPGN-ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            DGK I FSS R  H  GN      IYV+  DG   +R+           NR    H  +S
Sbjct  177  DGKHIVFSSRRDGHFRGNFGITHEIYVMDTDGGNQQRL---------TENRTNDWHPSWS  227

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPK  119
             D + + F+++  G           F+ + ++Y+M  DG   Q+LT N   +  P+W P 
Sbjct  228  PDGKRIAFSSDRKG----------DFENF-EIYVMDADGGNQQKLTENRVYDWRPSWSPD  276

Query  118  AE  113
            A+
Sbjct  277  AK  278


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 81/192 (42%), Gaps = 35/192 (18%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRSGH----------KNLYIIDSLNGELDGGGIRQLTDGAWIDTMP  482
            PS SP GK I F S R GH            +Y++D+     DGG  + LT+    D  P
Sbjct  68   PSWSPHGKRIAFVSDRDGHFRADMPDIPSYGIYVMDA-----DGGNQQNLTNDLSDDRSP  122

Query  481  SWSPDGKLIAFSSNRHNPGNADC-FSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVC  305
            SWSPDGK I F+S R    +      IYV+  DG   + +     E           H+ 
Sbjct  123  SWSPDGKRIVFTSRRKKDADGHFNLEIYVMDADGGNQQNLTNNPGEDRFPSWSPDGKHIV  182

Query  304  FSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWH  125
            FSS  +   F  N  G+T E             +Y+M  DG   QRLT    EN T  WH
Sbjct  183  FSSRRD-GHFRGNF-GITHE-------------IYVMDTDGGNQQRLT----ENRTNDWH  223

Query  124  PKAEVDLARLSL  89
            P    D  R++ 
Sbjct  224  PSWSPDGKRIAF  235


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 79/176 (45%), Gaps = 27/176 (15%)
 Frame = -2

Query  625  CSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIAFS  446
            C      I F S R G   +Y++D     ++GG  + LT+    D  PSWSP GK IAF 
Sbjct  26   CVDAQAQIAFVSRRDGDPEIYVMD-----INGGNPQNLTNHPDRDWDPSWSPHGKRIAFV  80

Query  445  SNRHNPGNAD-----CFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWV  281
            S+R     AD      + IYV+  DG   + +       + +++ +R     +S D + +
Sbjct  81   SDRDGHFRADMPDIPSYGIYVMDADGGNQQNL-------TNDLSDDR--SPSWSPDGKRI  131

Query  280  LFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  113
            +FT+          ++        ++Y+M  DG   Q LT N  E+  P+W P  +
Sbjct  132  VFTSRRKKDADGHFNL--------EIYVMDADGGNQQNLTNNPGEDRFPSWSPDGK  179



>gb|KFY39698.1| hypothetical protein V494_03875 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=652

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 89/175 (51%), Gaps = 22/175 (13%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+ FPS SP+G  +V+R  G  G   L I++  +          LT+  W D  P WSPD
Sbjct  487  NSGFPSFSPNGTQLVYRDFGPDGGLGLRILNIADNT-----TTTLTED-W-DNNPGWSPD  539

Query  466  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            GK I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  540  GKSIVFTRRNHINWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  590

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P
Sbjct  591  ADGR-IMYTSGMYGFRDECVNYDNTFQPYGQIVVMNADGSNKTMVTDSMWEDSMP  644



>gb|AFK45973.1| unknown [Medicago truncatula]
Length=97

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = -2

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEVDL  104
            ++FT++  G++AEP+S P+ +QPYG+++ +RLDG+GL RLT N YE+GTPAW PK  +  
Sbjct  1    MVFTSDYAGISAEPISNPHHYQPYGEIFTVRLDGSGLTRLTHNSYEDGTPAWSPKY-IKP  59

Query  103  ARLSLGKSGEKLRGKFDEPLWINS  32
              + + K G      F++  W+N+
Sbjct  60   VNVEMPKGGPYC--SFEDCHWLNN  81



>gb|KFY74302.1| hypothetical protein V499_05663 [Pseudogymnoascus pannorum VKM 
F-103]
Length=667

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 89/177 (50%), Gaps = 22/177 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRS-GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            N+ FP  SPDG  +V+R  G  G   L I++     L       LT+  W D  P WSPD
Sbjct  502  NSGFPGFSPDGTQLVYRDFGPGGGLGLRILN-----LADKTTTNLTED-W-DNNPGWSPD  554

Query  466  GKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFS  299
            G+ I F+   H    + G  D F IY + PDGTGL ++  +GA  +         H  +S
Sbjct  555  GERIVFTRRNHIKWEDLGATDSFDIYTIAPDGTGLTQLTTSGANDA---------HAAWS  605

Query  298  SDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            +D   +++T+ + G   E V+  N FQPYG + +M  DG+    +T + +E+  P +
Sbjct  606  ADGR-IMYTSGMYGFREECVNYDNTFQPYGQIVVMNADGSNKTLVTDSMWEDSMPVY  661



>gb|ENH85242.1| WD40 domain protein beta propeller [Colletotrichum orbiculare 
MAFF 240422]
Length=655

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 89/176 (51%), Gaps = 22/176 (13%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  470
            T ++ FPS SPDG  IVFR     +  L ++D     L    +R LTD    D +PSWSP
Sbjct  497  TVHSGFPSYSPDGGSIVFREWGVRY-GLRVVD-----LATRAVRNLTDA--TDNLPSWSP  548

Query  469  DGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDS  290
            DG  I F+       +A  F +  +RPDG+GLR +  +GA  +         H  +++D 
Sbjct  549  DGTRIVFTRKV----DAANFDVCTIRPDGSGLRVLTSSGANDA---------HAVWTADG  595

Query  289  EWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
              +L+++ + G   E  +    FQPYG + +M  DG   + LT + +E+  P + P
Sbjct  596  R-ILYSSGMYGFRDEAAAYDQTFQPYGQIVVMDADGANKRMLTDSLWEDSMPLYVP  650


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 25/107 (23%)
 Frame = -2

Query  625  CSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLTDGAWI---------DTMPSW  476
             SPDG  + + S  +G++ N++++D   GE      R LTD   +            PSW
Sbjct  139  LSPDGTKLAYVSTENGYRANIWVLDLATGER-----RNLTDTPEVAGDPLLPDGHFRPSW  193

Query  475  SPDGKLIAFSSNRHNP----GN------ADCFSIYVVRPDGTGLRRI  365
            SPDG  IAF+S+R+ P    GN          S+Y +RPDGTG R+I
Sbjct  194  SPDGGWIAFASDRNTPWRGHGNGTGWEHTQELSVYAIRPDGTGFRQI  240



>ref|WP_041305462.1| hypothetical protein, partial [Herpetosiphon aurantiacus]
Length=173

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 17/122 (14%)
 Frame = -2

Query  646  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  42   GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  96

Query  466  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSD  293
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +S D
Sbjct  97   GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  146

Query  292  SE  287
            S+
Sbjct  147  SQ  148


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 82/173 (47%), Gaps = 27/173 (16%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  452
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  3    PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  57

Query  451  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
            F SNR   GN +   +Y++  DG+ LR++    A         R     +S D   + FT
Sbjct  58   FQSNRS--GNDE---LYLINRDGSNLRQLTNDPA---------RDWQPSWSPDGSLIAFT  103

Query  271  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  113
            ++ G  T  P    +Q      LY+++ DG GL+ LT        PAW P ++
Sbjct  104  SDRGAQT--PDGWNDQ------LYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  148



>ref|WP_027978304.1| hypothetical protein [gamma proteobacterium L18]
Length=628

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 84/176 (48%), Gaps = 19/176 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N  FPS SPDGK IV+R      + L I+D     +D     +LT  A  D +P WSPDG
Sbjct  468  NAGFPSYSPDGKKIVYRVWSPKVQGLRILD-----VDTRQTTELTSEA--DNLPGWSPDG  520

Query  463  KLIAFSSNRHNPGNADCF--SIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDS  290
              I F+    NP + + F   +Y ++PDGTG+ R+   GA            H  +  D 
Sbjct  521  SKIVFTRKEINPADPNKFHYDVYTIKPDGTGVTRLTTPGAN---------QGHAVWLYDG  571

Query  289  EWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
              + +++ + G   E     N FQP G  ++M  DG+G   +T   +E+  P + P
Sbjct  572  R-IAYSSGVYGFRDELALYDNTFQPDGQNWVMNADGSGQHAITDTLWEDSMPLYVP  626


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 88/190 (46%), Gaps = 14/190 (7%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRS--GHKNLYIIDSLNGELDGGGIRQLTDG  503
            E K+L  +T G +   S S DG+ IVF S R   G  NLY + +     DG  +++LTD 
Sbjct  49   EHKLL--QTPGFDYHASFSKDGQWIVFTSERDGLGEANLYRVKA-----DGTELKRLTDH  101

Query  502  AWIDTMPSWSP-DGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNR  326
              ID    +SP D  +IAF S+R          I+ +      L+  +V G    +    
Sbjct  102  VAIDDAAVFSPTDPNVIAFVSSRRGKDAFGTTHIWTLNIATGALK--NVTGDIKFDPGLP  159

Query  325  ERLNHVCFSSDSEWVLFTANLGGV-TAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWN-G  152
                   +S D +W+  ++++G       + +  +      +Y++  DG+G +++  N G
Sbjct  160  HSFFRPTWSPDGKWIALSSDIGSQWRGHNLPVGWERTQESSIYIIHPDGSGWKKIASNPG  219

Query  151  YENGTPAWHP  122
            ++ G+P W P
Sbjct  220  FDEGSPTWSP  229



>ref|XP_007914327.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
 gb|EOO00969.1| putative tat pathway signal sequence domain-containing protein 
[Togninia minima UCRPA7]
Length=679

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 87/176 (49%), Gaps = 23/176 (13%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSP  470
            N  FPS SPDG  +V+R     +G   LYI+D     L  G   +LTDG W D  P WSP
Sbjct  512  NAGFPSFSPDGTKLVYRLWDWNNGPLGLYIMD-----LATGNTTRLTDG-W-DNTPGWSP  564

Query  469  DGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  302
            DGKLI F+   +    N    D F I  ++PDGT L+ +  + A  +         H  +
Sbjct  565  DGKLIVFTRQTNWTWGNSWELDRFDICTIKPDGTDLKVLTESQANDA---------HAVW  615

Query  301  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            S D   +++++ + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  616  SLDGR-IMYSSGMYGFRDESSLYDNTFQPYGQIIVMNADGSNKTMLTDSMWEDSMP  670



>gb|ETI58852.1| hypothetical protein C100_22665 [Sphingobium sp. C100]
Length=611

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 85/172 (49%), Gaps = 21/172 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  456  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  508

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +S D   
Sbjct  509  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  554

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P +
Sbjct  555  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMPLY  606


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -2

Query  667  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  509
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  93   IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  145

Query  508  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRR  368
             +  + D    P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R+
Sbjct  146  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  205

Query  367  I  365
            +
Sbjct  206  V  206



>ref|WP_031310342.1| hypothetical protein [Sphingobium sp. C100]
Length=621

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 85/172 (49%), Gaps = 21/172 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DGK IVFR      K L +++     LD    R LT G  +D +P WSPDG
Sbjct  466  HSGFPSYSADGKEIVFRVWSESEKGLRVLN-----LDTRKTRVLTTG--LDNLPGWSPDG  518

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            K I F+  R + GN   F IY ++PDG+GL R     +            H  +S D   
Sbjct  519  KRIVFTRKRED-GN---FDIYTIKPDGSGLFRCTDHPSSD---------GHAVWSPDGR-  564

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            ++++ +  G   E       FQ YG +Y+M  DG+  + LT + +E+  P +
Sbjct  565  IMWSGSQHGFRDEAALYDQTFQQYGQIYVMNADGSDKRLLTDSKWEDSMPLY  616


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 27/121 (22%)
 Frame = -2

Query  667  VLTKETTGNNAFPSCSPDGKHIVFRSGRSGHK-NLYIIDSLNGELDGGGIRQLT------  509
            ++T ++  + A    SPDG+ + F S R G++ N+++ D   G       RQLT      
Sbjct  103  IITTDSLDDAAM--LSPDGRTLAFVSTRDGYRANIWLQDLFTGR-----TRQLTGVGDVH  155

Query  508  -DGAWIDTM--PSWSPDGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRR  368
             +  + D    P+WSPDGK +AFSS+R      H+ G    +    SIY++RPDGTG R+
Sbjct  156  GEDLYPDCYFRPAWSPDGKWLAFSSDRNTRWTGHDKGHGWEHTQELSIYIIRPDGTGFRK  215

Query  367  I  365
            +
Sbjct  216  V  216



>gb|ESZ89568.1| hypothetical protein SBOR_10048 [Sclerotinia borealis F-4157]
Length=677

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 83/176 (47%), Gaps = 18/176 (10%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N+ FPS SPDG  IV+R    G   LY I      L  G I  LTD  W D  P WS DG
Sbjct  508  NSGFPSFSPDGTQIVYRD--CGPAPLYCIGLRILNLTDGTITNLTD-TW-DNTPGWSADG  563

Query  463  KLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSS  296
            + I F+   H    + G+ D + IY + P+GTGL ++  +G   +         H  ++ 
Sbjct  564  ERIVFTRRNHLDFTDLGSTDSYDIYTIHPNGTGLTQLTTSGTNDA---------HAVWTD  614

Query  295  DSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAW  128
            D   +L+++ + G   E     N FQPYG +  M  DG     LT   +E+  P +
Sbjct  615  DGR-ILYSSGMYGFREESSLYDNAFQPYGQIMSMNGDGGNKTLLTDTMWEDSMPLY  669



>emb|CAE05101.3| OSJNBa0009K15.21 [Oryza sativa Japonica Group]
 gb|EAZ30049.1| hypothetical protein OsJ_14105 [Oryza sativa Japonica Group]
Length=139

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 61/98 (62%), Gaps = 10/98 (10%)
 Frame = -2

Query  316  NHVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGT  137
            NH  FSSDS+ ++FT++   V+AEPVS P+ +QPYG++Y + +DG+ ++RLT N +E+GT
Sbjct  33   NHPWFSSDSKSLVFTSDYAAVSAEPVSNPHHYQPYGEIYTVDIDGSNIRRLTHNSFEDGT  92

Query  136  PAWHPKAEVDLARLSLGKSGEKL----RGKFDEPLWIN  35
            P+W P        L     GE L    R  F +  W+N
Sbjct  93   PSWTPY------FLDPRDVGETLQASGRCAFQDCHWLN  124



>ref|WP_025438063.1| hypothetical protein [Komagataeibacter xylinus]
Length=614

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (51%), Gaps = 21/174 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DG  IV+R     +  L I+D     L     R LT     D +P WSPDG
Sbjct  461  HSGFPSYSADGTQIVYRVWGENNMGLRILD-----LQTRQTRVLTTA--YDNLPGWSPDG  513

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + I F+  R +  N D F+I   RPDG+GL+R+  +GA            H  ++ D   
Sbjct  514  RRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------GHAVWTGDGR-  559

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P + P
Sbjct  560  IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMPLYVP  613



>gb|AHI25037.1| hypothetical protein H845_1092 [Komagataeibacter xylinus E25]
Length=628

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 88/174 (51%), Gaps = 21/174 (12%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            ++ FPS S DG  IV+R     +  L I+D     L     R LT     D +P WSPDG
Sbjct  475  HSGFPSYSADGTQIVYRVWGENNMGLRILD-----LQTRQTRVLTTA--YDNLPGWSPDG  527

Query  463  KLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEW  284
            + I F+  R +  N D F+I   RPDG+GL+R+  +GA            H  ++ D   
Sbjct  528  RRIVFT-RRVDDENYDIFTI---RPDGSGLKRLTTSGAND---------GHAVWTGDGR-  573

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            +++++ L G   E     N FQPYG +++M  DG+  + LT + +E+  P + P
Sbjct  574  IMWSSGLYGFRDEAALYDNTFQPYGQIFIMNADGSHKKILTDSLWEDSMPLYVP  627



>dbj|GAA89133.1| tat pathway signal sequence domain-containing protein [Aspergillus 
kawachii IFO 4308]
Length=687

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 20/185 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N+ FPS SPDG  IV+R      +    +  LN     G   QLTDG   D  P WSPDG
Sbjct  517  NSGFPSWSPDGTAIVYRKWSLATEAPLGLHILN--FTTGKTHQLTDG--WDNTPGWSPDG  572

Query  463  KLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  302
            + I F+ N +   +      AD F IY +RPDG+ L R+       ++ ++ +   H  +
Sbjct  573  ERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTRV-------TDSLSNDA--HAVW  623

Query  301  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            S D   ++++  + G   E     + FQPYG + +M  DGT    +T   +E+  P + P
Sbjct  624  SQDGR-IMWSTGMYGFKDESALFDDTFQPYGQIMVMNYDGTNKTLVTDTIWEDSMPLYMP  682

Query  121  KAEVD  107
               ++
Sbjct  683  NEYLE  687



>gb|ABX03625.1| WD40 domain protein beta Propeller [Herpetosiphon aurantiacus 
DSM 785]
Length=316

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 17/122 (14%)
 Frame = -2

Query  646  GNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPD  467
            G++  PS SPDG+ + F+S RSG+  LY+I+      DG  +RQLT+    D  PSWSPD
Sbjct  125  GDDQSPSWSPDGQQLAFQSNRSGNDELYLINR-----DGSNLRQLTNDPARDWQPSWSPD  179

Query  466  GKLIAFSSNR--HNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSD  293
            G LIAF+S+R    P   +   +YV++PDG GL+ +       +E   R R  H  +S D
Sbjct  180  GSLIAFTSDRGAQTPDGWND-QLYVIQPDGQGLKYL-------TEGFGRAR--HPAWSPD  229

Query  292  SE  287
            S+
Sbjct  230  SQ  231


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 81/173 (47%), Gaps = 27/173 (16%)
 Frame = -2

Query  631  PSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGKLIA  452
            P+ SPDG  + F    S   N+YI        DG  + Q+T+    D  PSWSPDG+ +A
Sbjct  86   PTWSPDGNELAFVVQDSDGFNMYI-----SSADGSNLFQVTNQPGDDQSPSWSPDGQQLA  140

Query  451  FSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCFSSDSEWVLFT  272
            F SNR   GN +   +Y++  DG+ LR++    A   +           +S D   + FT
Sbjct  141  FQSNRS--GNDE---LYLINRDGSNLRQLTNDPARDWQP---------SWSPDGSLIAFT  186

Query  271  ANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAE  113
            ++ G  T +  +          LY+++ DG GL+ LT        PAW P ++
Sbjct  187  SDRGAQTPDGWN--------DQLYVIQPDGQGLKYLTEGFGRARHPAWSPDSQ  231



>ref|WP_033378529.1| MULTISPECIES: hypothetical protein, partial [Marinimicrobia]
Length=304

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 95/206 (46%), Gaps = 33/206 (16%)
 Frame = -2

Query  676  EIKVLTKETTGNNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAW  497
            +I  LT +  G    P  SPDGK I F    +G+ ++Y+ D+      G  +R+LT    
Sbjct  107  QISRLT-QIVGPATSPVFSPDGKKIAFSLTTNGNTDIYVSDT-----HGNNLRRLTQNPG  160

Query  496  IDTMPSWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERL  317
            IDT P+WSP+GK +AF+S+R     +    IY++  DG  +RR+       +      R 
Sbjct  161  IDTSPAWSPNGKSLAFTSDR-----SGSPQIYLMDADGANIRRLTYNNDYNASPAWSPRG  215

Query  316  NHVCFSS-------------DSEWVLFTANLGGVTAEPVSIPNQFQPYG--------DLY  200
            + + + S             D E V    +     A+PV  PN              ++Y
Sbjct  216  DVIAYESQESNGFQIYLITPDGEEVQCITDRTASYADPVWAPNGLHLACASNRTGKWEIY  275

Query  199  MMRLDGTGLQRLTWNGYENGTPAWHP  122
             M LDG+ L+RLT++G  N  PAW P
Sbjct  276  SMYLDGSRLKRLTFSG-NNTQPAWSP  300


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 79/178 (44%), Gaps = 38/178 (21%)
 Frame = -2

Query  631  PSCSPDGKHIVFRS---GRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDGK  461
            P  SPDGK ++F S    +     L I +  + +     I +LT      T P +SPDGK
Sbjct  74   PDWSPDGKQLIFSSLIPAQHLASQLVIFNFASNQ-----ISRLTQIVGPATSPVFSPDGK  128

Query  460  LIAFSSNRHNPGNADCFSIYVVRPDGTGLRRI-HVAGAEGSEEVNRERLNHVCFSSDSEW  284
             IAFS   +  GN D   IYV    G  LRR+    G + S            +S + + 
Sbjct  129  KIAFSLTTN--GNTD---IYVSDTHGNNLRRLTQNPGIDTSP----------AWSPNGKS  173

Query  283  VLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHPKAEV  110
            + FT++  G                 +Y+M  DG  ++RLT+N   N +PAW P+ +V
Sbjct  174  LAFTSDRSGSP--------------QIYLMDADGANIRRLTYNNDYNASPAWSPRGDV  217



>ref|XP_007835900.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
 gb|ETS79275.1| hypothetical protein PFICI_09128 [Pestalotiopsis fici W106-1]
Length=678

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 94/186 (51%), Gaps = 25/186 (13%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  476
            T N  FPS SPDG  +VFR   G +G   L+++D     ++ G   Q+T+G W D  P W
Sbjct  507  TFNAGFPSFSPDGTKLVFRLWDGENGPLGLHVMD-----METGNTTQITNG-W-DNTPGW  559

Query  475  SPDGKLIAFSSNR---HNPGNA---DCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLN  314
            SPDG+LI F+       + GN    D + I  ++PDGT L+ +  + A  +         
Sbjct  560  SPDGELIVFARQTNWTQDYGNRWYDDRYDIATIKPDGTDLKILTESHANDA---------  610

Query  313  HVCFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
            H  ++ D   +++ + + G   E     N FQPYG + +M  DG+    LT + +E+  P
Sbjct  611  HAVWAPDGR-IMYNSGMHGFRDESPLYDNTFQPYGQIIIMNADGSNKTALTDSMWEDSMP  669

Query  133  AWHPKA  116
             + P++
Sbjct  670  QYIPRS  675



>gb|KEQ78669.1| tricorn protease N-terminal domain-containing protein [Aureobasidium 
pullulans EXF-150]
Length=675

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 23/178 (13%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFR--SGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSW  476
            T N  FPS SPDG  +V+R  +   G   L+++D     ++ G   QLT G W D  P W
Sbjct  507  TNNAGFPSFSPDGTKLVYRLWNATYGPLGLHVLD-----METGDTTQLTAG-W-DNTPGW  559

Query  475  SPDGKLIAFSSNRH----NPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHV  308
            SPDG+LI F+   +    +    D F I  +RPDGT L+ +  + A  +         H 
Sbjct  560  SPDGELIVFTRQTNWTYGSSWQEDRFDICTIRPDGTDLKILTESEANDA---------HA  610

Query  307  CFSSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTP  134
             +S D   ++++  + G   E V   N FQPYG + +M  DG   + LT + +E+  P
Sbjct  611  VWSFDGR-IMYSTGMYGFRDESVMYDNTFQPYGQIVVMDKDGQNKKMLTDSMWEDSMP  667



>ref|WP_030901696.1| hypothetical protein [Streptomyces sp. NRRL F-5126]
Length=628

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 88/182 (48%), Gaps = 30/182 (16%)
 Frame = -2

Query  649  TGNNAFPSCSPDGKHIVFRSGRSGHKN-LYIIDSLNGELDGGGIRQLTDGAWI---DTMP  482
            T N  FPS S DG  IV+R    G  N L ++D          +R+ T        D +P
Sbjct  469  TVNAGFPSFSEDGNRIVYRVW--GEDNGLRVLD----------LRKRTTTVLTTESDNLP  516

Query  481  SWSPDGKLIAFSSNRHNPGNADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  302
             WSPDGKLI F+       +A  F +  +RPDGTGL  +  +GA            H  +
Sbjct  517  DWSPDGKLILFTRRT----SATNFDVCTIRPDGTGLAVLTSSGAND---------GHAVW  563

Query  301  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            +SD   VL+ + + G   E     N FQPYG ++ M+ DG+  + LT + +E+  P + P
Sbjct  564  ASDGR-VLYNSGMYGFREEAALYDNTFQPYGQIFSMKADGSDKRMLTDSQWEDSMPIYIP  622

Query  121  KA  116
            ++
Sbjct  623  QS  624


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 22/105 (21%)
 Frame = -2

Query  622  SPDGKHIVFRSGRSGH--KNLYIID-------SLNGELDGGGIRQLTDGAWIDTMPSWSP  470
            SPDG  + F S  S      ++++D       +L G     G     DG +    PSWSP
Sbjct  120  SPDGTTVAFVSTNSDDHLTQIWLLDLRTQKLTNLTGTAALAGDPASPDGHF---RPSWSP  176

Query  469  DGKLIAFSSNR------HNPG----NADCFSIYVVRPDGTGLRRI  365
            DG+ +AFSS+R      H+ G    +    SIYV+RPDGTG RR+
Sbjct  177  DGQWLAFSSDRDTAWRGHDNGKGWEHTQELSIYVIRPDGTGFRRV  221



>ref|XP_001395414.2| hypothetical protein ANI_1_1672104 [Aspergillus niger CBS 513.88]
Length=688

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 20/185 (11%)
 Frame = -2

Query  643  NNAFPSCSPDGKHIVFRSGRSGHKNLYIIDSLNGELDGGGIRQLTDGAWIDTMPSWSPDG  464
            N+ FPS SPDG  IV+R      +    +  LN     G   QLTDG   D  P WSPDG
Sbjct  518  NSGFPSWSPDGSAIVYRKWSLATEAPLGLHILN--FTTGKTHQLTDG--WDNTPGWSPDG  573

Query  463  KLIAFSSNRHNPGN------ADCFSIYVVRPDGTGLRRIHVAGAEGSEEVNRERLNHVCF  302
            + I F+ N +   +      AD F IY +RPDG+ L R+       ++ ++ +   H  +
Sbjct  574  ERIVFTRNNNWTESYGARWYADRFDIYTIRPDGSELTRV-------TDSLSNDA--HAVW  624

Query  301  SSDSEWVLFTANLGGVTAEPVSIPNQFQPYGDLYMMRLDGTGLQRLTWNGYENGTPAWHP  122
            S D   +++++   G   E     + FQPYG + +M  DGT    +T   +E+  P + P
Sbjct  625  SQDGR-IMWSSGQYGFKDESALFDDTFQPYGQIMVMNYDGTNKTLVTDTIWEDSMPLYMP  683

Query  121  KAEVD  107
               ++
Sbjct  684  NEYLE  688



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395