BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF003B06

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA74714.1|  transcription factor TEIL                              147   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_009587969.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     145   1e-36   Nicotiana tomentosiformis
ref|XP_009801714.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     144   3e-36   Nicotiana sylvestris
ref|XP_011080514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          144   4e-36   Sesamum indicum [beniseed]
gb|AFH56407.1|  EIN3-like protein EIL1                                  138   8e-34   Diospyros kaki [Japanese persimmon]
ref|NP_001234721.1|  EIL2 protein                                       137   1e-33   Solanum lycopersicum
emb|CDP19134.1|  unnamed protein product                                137   3e-33   Coffea canephora [robusta coffee]
gb|AAP70005.1|AF498235_1  EIL                                           134   4e-33   Solanum lycopersicum
ref|XP_006364491.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     134   3e-32   Solanum tuberosum [potatoes]
gb|AHA93899.1|  ethylene insensitive 3                                  132   9e-32   Coffea arabica [arabica coffee]
ref|XP_006361129.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...    127   8e-30   Solanum tuberosum [potatoes]
ref|XP_009798827.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    124   9e-29   Nicotiana sylvestris
ref|XP_011090234.1|  PREDICTED: LOW QUALITY PROTEIN: protein ETHY...    123   2e-28   
ref|XP_009607986.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    122   4e-28   Nicotiana tomentosiformis
ref|NP_001234541.1|  EIL1 protein                                       119   6e-27   Solanum lycopersicum
gb|AAP04000.1|  EIL4                                                    115   1e-25   Nicotiana tabacum [American tobacco]
ref|XP_009798829.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...    115   1e-25   Nicotiana sylvestris
ref|XP_006361131.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     115   1e-25   Solanum tuberosum [potatoes]
ref|NP_001233931.1|  EIN3-like protein                                  115   1e-25   Solanum lycopersicum
ref|XP_009607827.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     114   4e-25   Nicotiana tomentosiformis
gb|ACP56697.1|  EIN3-like protein                                       111   3e-24   Lithospermum erythrorhizon
gb|KHG00335.1|  ethylene insensitive 3 -like protein                    109   4e-24   Gossypium arboreum [tree cotton]
gb|KJB56070.1|  hypothetical protein B456_009G105400                    108   4e-23   Gossypium raimondii
gb|AID55343.1|  EIN3-like protein EIL1                                  107   9e-23   Actinidia chinensis
gb|KJB26156.1|  hypothetical protein B456_004G227800                    107   1e-22   Gossypium raimondii
gb|AGK07288.1|  EIN3-3                                                  106   2e-22   Rosa hybrid cultivar
ref|XP_007016682.1|  Ethylene insensitive 3 family protein              105   4e-22   
gb|ABY28269.1|  EIN3-like protein EIL1                                  104   7e-22   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004144109.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     103   1e-21   
gb|KHG04095.1|  ethylene insensitive 3 -like protein                    102   1e-21   Gossypium arboreum [tree cotton]
ref|XP_004288382.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3          102   3e-21   Fragaria vesca subsp. vesca
gb|ACJ70675.1|  EIN3-like protein EIL2                                  101   1e-20   Actinidia deliciosa [Chinese gooseberry]
gb|AID55344.1|  EIN3-like protein EIL2                                  100   1e-20   Actinidia chinensis
ref|XP_011006497.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like     100   2e-20   Populus euphratica
ref|XP_002275284.2|  PREDICTED: protein ETHYLENE INSENSITIVE 3        99.8    3e-20   Vitis vinifera
ref|XP_008451093.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        99.8    4e-20   Cucumis melo [Oriental melon]
ref|XP_010031647.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   99.8    4e-20   Eucalyptus grandis [rose gum]
gb|KGN66413.1|  EIN3-like protein                                     99.4    5e-20   Cucumis sativus [cucumbers]
gb|AHB18380.1|  ethylene insensitive 3                                99.0    7e-20   Momordica charantia [balsam pear]
ref|XP_004171661.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   98.6    9e-20   
gb|AFK80347.1|  ethylene-insensitive 3                                97.4    2e-19   Cucumis sativus [cucumbers]
ref|XP_002312841.2|  EIN3-like family protein                         97.4    2e-19   
ref|XP_006384758.1|  EIN3-like family protein                         97.1    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_004501972.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  95.9    6e-19   Cicer arietinum [garbanzo]
gb|KJB20248.1|  hypothetical protein B456_003G140600                  95.5    1e-18   Gossypium raimondii
ref|XP_002276380.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  94.7    2e-18   Vitis vinifera
ref|XP_002530192.1|  ETHYLENE-INSENSITIVE3 protein, putative          94.7    2e-18   Ricinus communis
ref|XP_011043514.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        94.0    3e-18   Populus euphratica
gb|KDP42896.1|  hypothetical protein JCGZ_23838                       93.6    4e-18   Jatropha curcas
dbj|BAB64344.1|  EIN3-like protein                                    94.0    4e-18   Cucumis melo [Oriental melon]
gb|AFK45610.1|  unknown                                               89.7    7e-18   Lotus japonicus
gb|KHN33829.1|  Protein ETHYLENE INSENSITIVE 3                        92.4    1e-17   Glycine soja [wild soybean]
ref|XP_003543159.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        92.4    1e-17   Glycine max [soybeans]
gb|KHG09663.1|  ethylene insensitive 3 -like protein                  91.3    2e-17   Gossypium arboreum [tree cotton]
ref|XP_006470438.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  90.5    5e-17   Citrus sinensis [apfelsine]
gb|KDO66375.1|  hypothetical protein CISIN_1g0070172mg                89.7    8e-17   Citrus sinensis [apfelsine]
gb|KDO66378.1|  hypothetical protein CISIN_1g0070172mg                89.7    9e-17   Citrus sinensis [apfelsine]
ref|XP_003555660.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        89.4    1e-16   Glycine max [soybeans]
ref|XP_006446382.1|  hypothetical protein CICLE_v10014617mg           88.2    3e-16   Citrus clementina [clementine]
ref|XP_006446380.1|  hypothetical protein CICLE_v10014617mg           88.2    3e-16   
ref|XP_010106127.1|  Protein ETHYLENE INSENSITIVE 3                   85.9    1e-15   Morus notabilis
gb|KJB83827.1|  hypothetical protein B456_013G266300                  85.9    2e-15   Gossypium raimondii
gb|AHC70433.1|  ethylene insensitive 3 protein                        85.5    2e-15   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_003543154.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        85.1    3e-15   Glycine max [soybeans]
gb|AFI61908.1|  ethylene insensitive 3-like 2 protein                 83.2    1e-14   Paeonia suffruticosa [moutan peony]
ref|XP_010247605.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   82.4    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002310961.1|  hypothetical protein POPTR_0008s01200g           82.0    3e-14   
gb|KDO53815.1|  hypothetical protein CISIN_1g007174mg                 81.6    4e-14   Citrus sinensis [apfelsine]
ref|XP_006432540.1|  hypothetical protein CICLE_v10000617mg           81.6    4e-14   Citrus clementina [clementine]
emb|CAB95830.1|  hypothetical protein                                 79.3    7e-14   Cicer arietinum [garbanzo]
ref|XP_006432536.1|  hypothetical protein CICLE_v10000608mg           79.7    2e-13   
gb|AAL76271.1|AF467783_1  transcription factor EIL2                   79.3    2e-13   Vigna radiata [mung bean]
ref|NP_001275851.1|  ethylene-insensitive 3-like 1 protein            79.0    3e-13   Citrus sinensis [apfelsine]
ref|XP_004491182.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  78.6    4e-13   Cicer arietinum [garbanzo]
ref|XP_007146084.1|  hypothetical protein PHAVU_006G011300g           78.2    5e-13   Phaseolus vulgaris [French bean]
ref|XP_008368189.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  77.4    9e-13   
ref|XP_010106128.1|  Protein ETHYLENE INSENSITIVE 3                   77.4    1e-12   
gb|ADE41153.1|  ethylene insensitive 3 class transcription factor     77.0    1e-12   Malus domestica [apple tree]
gb|AGI41323.1|  EIN3-like protein                                     77.0    1e-12   Malus domestica [apple tree]
ref|XP_007146083.1|  hypothetical protein PHAVU_006G011200g           76.6    2e-12   Phaseolus vulgaris [French bean]
ref|XP_002315400.1|  EIN3-like family protein                         76.3    2e-12   
ref|XP_010067064.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  75.1    5e-12   Eucalyptus grandis [rose gum]
ref|XP_009341360.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  75.1    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_003545483.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        74.3    1e-11   Glycine max [soybeans]
gb|ADE41155.1|  ethylene insensitive 3 class transcription factor     73.6    1e-11   Malus domestica [apple tree]
ref|XP_008357657.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  72.0    5e-11   
gb|AGI41325.1|  EIN3-like protein                                     72.0    5e-11   Malus domestica [apple tree]
gb|EYU46131.1|  hypothetical protein MIMGU_mgv1a003270mg              71.2    8e-11   Erythranthe guttata [common monkey flower]
gb|KHN38437.1|  Protein ETHYLENE INSENSITIVE 3                        70.9    1e-10   Glycine soja [wild soybean]
ref|XP_008231880.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  70.9    1e-10   Prunus mume [ume]
gb|KGN46075.1|  hypothetical protein Csa_6G051520                     69.7    2e-10   Cucumis sativus [cucumbers]
ref|XP_003519487.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3        69.7    3e-10   Glycine max [soybeans]
gb|AHC70432.1|  ethylene insensitive 3-like protein                   69.3    4e-10   Cucurbita pepo subsp. pepo [field pumpkin]
gb|KHN26027.1|  Protein ETHYLENE INSENSITIVE 3                        68.9    5e-10   Glycine soja [wild soybean]
ref|XP_004140927.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-li...  68.9    6e-10   Cucumis sativus [cucumbers]
ref|XP_008456656.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  68.2    9e-10   Cucumis melo [Oriental melon]
ref|NP_001284429.1|  ETHYLENE INSENSITIVE 3-like 1 protein            68.2    9e-10   Cucumis melo [Oriental melon]
ref|XP_009759370.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.8    1e-09   Nicotiana sylvestris
gb|AAP04001.1|  EIL5                                                  67.8    1e-09   Nicotiana tabacum [American tobacco]
ref|XP_009355060.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  67.0    2e-09   Pyrus x bretschneideri [bai li]
gb|AIS20827.1|  EIL                                                   67.0    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_010243659.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   67.0    3e-09   Nelumbo nucifera [Indian lotus]
ref|XP_009595535.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  66.2    4e-09   Nicotiana tomentosiformis
ref|XP_008346133.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  65.5    8e-09   
gb|ACM89299.1|  EIN3-like protein EIL1                                63.5    3e-08   Eriobotrya japonica [loquat]
gb|ADZ97022.2|  EIL6                                                  63.2    4e-08   Nicotiana tabacum [American tobacco]
ref|XP_007141570.1|  hypothetical protein PHAVU_008G207000g           62.8    5e-08   Phaseolus vulgaris [French bean]
gb|AAK67355.1|AF387795_1  transcription factor                        62.8    6e-08   Cucumis melo [Oriental melon]
gb|EYU35998.1|  hypothetical protein MIMGU_mgv1a003505mg              62.0    9e-08   Erythranthe guttata [common monkey flower]
gb|AGV54673.1|  ethylene insensitive protein 3                        62.0    1e-07   Phaseolus vulgaris [French bean]
gb|AGV54306.1|  transcription factor EIL1                             62.0    1e-07   Phaseolus vulgaris [French bean]
gb|ADE41154.1|  ethylene insensitive 3 class transcription factor     61.6    1e-07   Malus domestica [apple tree]
emb|CDP16004.1|  unnamed protein product                              60.1    4e-07   Coffea canephora [robusta coffee]
gb|AGI41324.1|  EIN3-like protein                                     60.1    4e-07   Malus domestica [apple tree]
gb|ACD87815.1|  putative ethylene insensitive transcription factor    60.1    4e-07   Vicia faba [broad bean]
ref|NP_001234546.1|  EIL3 protein                                     59.7    6e-07   Solanum lycopersicum
ref|XP_008231879.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  59.7    7e-07   Prunus mume [ume]
ref|XP_008364747.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  59.3    7e-07   
ref|XP_009355361.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  59.3    8e-07   Pyrus x bretschneideri [bai li]
emb|CDY06379.1|  BnaC05g31510D                                        58.9    1e-06   
ref|XP_007220648.1|  hypothetical protein PRUPE_ppa003493mg           58.9    1e-06   
gb|ABK35086.1|  EIL2                                                  58.9    1e-06   Prunus persica
gb|AAL76272.1|AF467784_1  transcription factor EIL1                   58.2    2e-06   Vigna radiata [mung bean]
dbj|BAI44821.1|  ethylene insensitive 3-like                          57.8    3e-06   Daucus carota [carrots]
ref|XP_010544313.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   57.8    3e-06   Tarenaya hassleriana [spider flower]
emb|CBI29154.3|  unnamed protein product                              55.1    3e-06   Vitis vinifera
emb|CDY19606.1|  BnaA05g20140D                                        57.0    5e-06   Brassica napus [oilseed rape]
ref|XP_009145590.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  57.0    5e-06   
ref|XP_009145591.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  57.0    6e-06   Brassica rapa
ref|XP_011091876.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   56.6    7e-06   
gb|ACJ85584.1|  unknown                                               56.2    8e-06   Medicago truncatula
ref|XP_003617086.1|  Ethylene insensitive 3-like protein              56.2    8e-06   Medicago truncatula
ref|XP_004306440.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.8    1e-05   Fragaria vesca subsp. vesca
ref|XP_010544311.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   55.5    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_009339245.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  55.1    2e-05   
ref|XP_010509301.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  52.4    2e-04   
ref|XP_010509323.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3 is...  52.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009417872.1|  PREDICTED: ETHYLENE INSENSITIVE 3-like 1 pro...  52.4    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006347695.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   51.2    4e-04   Solanum tuberosum [potatoes]
ref|XP_009135708.1|  PREDICTED: protein ETHYLENE INSENSITIVE 3-like   51.2    4e-04   Brassica rapa



>dbj|BAA74714.1| transcription factor TEIL [Nicotiana tabacum]
Length=615

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 5/139 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L NQGI
Sbjct  479  GIGVPEDGQRMINELMSFYDNNIQGNKSSMAANVVMSKEQPRQQPSIQ--QNNYLHNQGI  536

Query  564  I-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            I  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  +DY+E
Sbjct  537  ILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTE  596

Query  387  GLLGVPP--LPKKDILSWY  337
             L G+    +PK+D+  WY
Sbjct  597  ALSGITQDNMPKQDVPVWY  615



>ref|XP_009587969.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 gb|AAP03997.1| EIL1 [Nicotiana tabacum]
Length=618

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 5/139 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L NQGI
Sbjct  482  GIGVPEDGQRMINELMSFYDNNIQGNKSSMAGNVVMSKEQPRQQPSIQ--QNNYLHNQGI  539

Query  564  I-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            I  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  +DY+E
Sbjct  540  ILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTE  599

Query  387  GLLGVPP--LPKKDILSWY  337
             L G+    +PK+D+  WY
Sbjct  600  ALSGITQDNMPKQDVPVWY  618



>ref|XP_009801714.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana sylvestris]
 gb|AAP03998.1| EIL2 [Nicotiana tabacum]
Length=616

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQRMIN+LMSFYD+NIQGNK S   N   +KEQP QQ +IQ  Q  +L NQGI
Sbjct  480  GLGVPEDGQRMINELMSFYDSNIQGNKNSMAGNVVMSKEQPRQQPSIQ--QNNYLHNQGI  537

Query  564  I-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +  GNIF ++NIS+   +F  GD+F+Q K L SPFN  S +   FMFG PFNL  +DY+E
Sbjct  538  VLDGNIFGDTNISANHSVFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQSTDYTE  597

Query  387  GLLGVPP--LPKKDILSWY  337
             L G+    +PK+D+  WY
Sbjct  598  ALSGITQDNMPKQDVPVWY  616



>ref|XP_011080514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
 ref|XP_011080515.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Sesamum indicum]
Length=616

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 94/139 (68%), Gaps = 3/139 (2%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPE+GQRMIN+LMSFYD N+QGNK SN  N+  AKEQ LQQ + Q  Q G+LQNQG 
Sbjct  478  GLGVPEEGQRMINELMSFYDNNVQGNKNSNTGNAANAKEQSLQQHSAQSRQDGYLQNQGL  537

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ GNIF++  I +   +F   D+F+  K + SPFN +  E    MF  PFN+PP DY+E
Sbjct  538  VLEGNIFEDKTIPNNLSIFRPPDRFDHSKVITSPFNPNPTENFQLMFSSPFNIPPVDYTE  597

Query  387  GLLGVPP--LPKKDILSWY  337
               GVP   LPK+DI  WY
Sbjct  598  NFPGVPRNNLPKQDITIWY  616



>gb|AFH56407.1| EIN3-like protein EIL1, partial [Diospyros kaki]
Length=594

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISN----PRNSGPAKEQPLQQTNIQCHQ-GGFL  580
            GLGVPEDGQ+MI++LMSFYD N+QGNK+S+    P       +Q L Q N+ C Q   ++
Sbjct  450  GLGVPEDGQKMISELMSFYDANVQGNKLSHSINIPITKDQTPQQALSQPNLHCQQENNYI  509

Query  579  QNQGIIPG-NIFQESNISSTRPMFTS-GDQFEQPKALNSPFNVSSIETLPFMFGPPFNLP  406
              QG++ G NIF+E+N+SS R MF+  GDQF+Q KALNSPF  +  +    MFG PFNLP
Sbjct  510  HGQGVVMGVNIFEEANMSSNRSMFSRQGDQFDQCKALNSPFEANPNDNFHLMFGSPFNLP  569

Query  405  PSDYSEGLLGVPP--LPKKDILSWY  337
            P DY+EG+ GV    L K D+  WY
Sbjct  570  PVDYTEGIPGVARDMLSKPDVSIWY  594



>ref|NP_001234721.1| EIL2 protein [Solanum lycopersicum]
 gb|AAK58858.1|AF328785_1 EIL2 [Solanum lycopersicum]
Length=614

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 97/139 (70%), Gaps = 5/139 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +LQ+QG 
Sbjct  478  GLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYLQSQGN  535

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ G+IF ++NIS+   MF  GD+F+Q K L SPFN SS +   FMFG PFN+  +D SE
Sbjct  536  VLEGSIFGDTNISANNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQSTDLSE  595

Query  387  GLLGVP--PLPKKDILSWY  337
             L G+    + K+D   WY
Sbjct  596  CLSGISHDDVTKQDASVWY  614



>emb|CDP19134.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 100/157 (64%), Gaps = 22/157 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMINDLMSFY++NIQGNK ++  N+   KEQ +QQ  +QC    +L  QGI
Sbjct  478  GIGVPEDGQRMINDLMSFYESNIQGNKNADSGNAAVIKEQSVQQPGMQCQSDNYLHGQGI  537

Query  564  -IPGNIFQESNISS------------------TRPMFTSGDQFEQPKALNSPFNVSSIET  442
             + GNIF+++N+SS                  +RPMF  GD+F+Q K  +SPFN S+ E 
Sbjct  538  MMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRPMFQHGDRFDQCKITSSPFNNSN-EN  596

Query  441  LPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  337
              FMFG PFNLP  D++EGL G+      K+D+  WY
Sbjct  597  FQFMFGSPFNLPSVDFTEGLPGISRDNASKQDLPIWY  633



>gb|AAP70005.1|AF498235_1 EIL [Solanum lycopersicum]
Length=359

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +LQ+QG 
Sbjct  220  GLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYLQSQGN  277

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ G+IF ++NIS++  MF  GD+F+Q K L SPFN SS +   FMFG PFN+  +D SE
Sbjct  278  VLEGSIFGDTNISASNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQSTDLSE  337

Query  387  GLLGV  373
             L G+
Sbjct  338  CLSGI  342



>ref|XP_006364491.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=614

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 95/139 (68%), Gaps = 5/139 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVP DGQR+IN+LMSFY++N+QGNK S   N   +KEQPLQQ +IQ  Q  +LQ+QG 
Sbjct  478  GLGVPADGQRVINELMSFYESNVQGNKSSMAGNVVMSKEQPLQQPSIQ--QNNYLQSQGN  535

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ G+IF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  +D SE
Sbjct  536  VLEGSIFGDTNISANNSMFVQGDRFDQSKVLTSPFNAGSNDDFNFMFGSPFNLQSTDLSE  595

Query  387  GLLGVP--PLPKKDILSWY  337
             L G+    + K+D   WY
Sbjct  596  CLSGISHDDMTKQDTSVWY  614



>gb|AHA93899.1| ethylene insensitive 3 [Coffea arabica]
Length=589

 Score =   132 bits (332),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 22/157 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMINDLMSFY++NIQGNK ++  N+   KEQ +QQ  +QC    +L  QGI
Sbjct  423  GIGVPEDGQRMINDLMSFYESNIQGNKNADSGNAAVIKEQSVQQPGMQCQSDNYLHGQGI  482

Query  564  -IPGNIFQESNISS------------------TRPMFTSGDQFEQPKALNSPFNVSSIET  442
             + GNIF+++N+SS                  +RPMF  GD+F+Q K  +SPFN S+ E 
Sbjct  483  MMEGNIFEDTNVSSNRSIFQQGDRFEDTNIPASRPMFQHGDRFDQCKITSSPFNNSN-EK  541

Query  441  LPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  337
              FMFG PFNLP  D++  L G+      K+D+  WY
Sbjct  542  FQFMFGSPFNLPSVDFTXSLPGISRDNASKQDLPIWY  578



>ref|XP_006361129.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006361130.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMIN+LM+ YD+++QG+K  N  N    KEQP QQ  +  HQ  +L +QGI
Sbjct  481  GIGVPEDGQRMINELMTIYDSDVQGSKRQNRGNVTLTKEQPHQQPRV--HQDNYLLSQGI  538

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF+ +NIS+T+ M    D F+Q KALNS FN  S ++  FMFG  FN+  ++Y+  
Sbjct  539  MEGNIFKNTNISTTQSMLPQVDPFDQSKALNSAFNAGSNDSFHFMFGSSFNIQSTNYNGN  598

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+D   WY
Sbjct  599  LPSIGYDTTPKQDAPIWY  616



>ref|XP_009798827.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798828.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=615

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMI++LMSFYD+ I GNK  N  N    KEQP QQ  +  +Q  +L +QG+
Sbjct  480  GVGVPEDGQRMIDELMSFYDSKIHGNKSQNTGNVALTKEQPHQQPRL--NQDNYLHSQGM  537

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            +  NIF+++NIS++ P+   G+  +Q K LNS F+  S +   FMFG PFNL  ++Y+  
Sbjct  538  MERNIFKDTNISASHPILPQGNLADQCKVLNSSFDTGSSDNFNFMFGSPFNLQSTNYTGS  597

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+DI  WY
Sbjct  598  LPGIGCDNTPKQDIPIWY  615



>ref|XP_011090234.1| PREDICTED: LOW QUALITY PROTEIN: protein ETHYLENE INSENSITIVE 
3 [Sesamum indicum]
Length=598

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 89/138 (64%), Gaps = 7/138 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQRMIN+LMS YD N+QGN  SN  N    KE+ LQ  N Q    G+L+ QG+
Sbjct  466  GLGVPEDGQRMINELMSLYDNNVQGN--SNMGNGTATKEKSLQHRNGQYQPDGYLRGQGM  523

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
               NIF+++NI +   +F+  D+F+Q K +NSPF+ +  E    MF  PFN+P  DY+E 
Sbjct  524  ---NIFEDNNIPNNPSIFSPPDRFDQCKVMNSPFSSNPAENFQLMFSSPFNVPSIDYTEA  580

Query  384  LLGVPP--LPKKDILSWY  337
              GVP   LPK+D+  WY
Sbjct  581  FPGVPRDNLPKQDVTIWY  598



>ref|XP_009607986.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
 ref|XP_009607987.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=615

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMI++LMSFYD+NIQGNKI N  N    K QP QQ  +  +Q  +L +QG+
Sbjct  480  GVGVPEDGQRMIDELMSFYDSNIQGNKIQNTGNVALTKGQPHQQPRL--NQDNYLHSQGM  537

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF++++IS+  P+   G+  +Q K LNS FN  S +   FM G  F+L  ++YS  
Sbjct  538  MEGNIFKDTSISAIHPILPQGNLTDQCKVLNSSFNAGSSDNFNFMLGSLFDLQSTNYSGS  597

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+DI  WY
Sbjct  598  LPGIGCDNTPKQDIPIWY  615



>ref|NP_001234541.1| EIL1 protein [Solanum lycopersicum]
 gb|AAK58857.1|AF328784_1 EIL1 [Solanum lycopersicum]
Length=610

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMIN+LMS YD+++QG+K  N  N    KEQP QQ  +  HQ  +L +QGI
Sbjct  479  GIGVPEDGQRMINELMSIYDSDVQGSKRQNRGNIALTKEQPHQQPRV--HQDNYLLSQGI  536

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF+ +NIS+T+ M    D F+Q KA    FN  S +   FMFG PFN+  ++Y+  
Sbjct  537  MDGNIFKNTNISTTQSMLPQVDPFDQSKA----FNAGSNDNFHFMFGSPFNIQSTNYNGN  592

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+D   WY
Sbjct  593  LPSIGYDTTPKQDAPIWY  610



>gb|AAP04000.1| EIL4 [Nicotiana tabacum]
Length=603

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMI +LMSFYD+NIQGNK  N  N    KEQP QQ  +  +Q  +L +QGI
Sbjct  478  GVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVALTKEQPHQQPRV--NQDNYLHSQGI  535

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF+++NIS++  M         P+A  SPFN    +   FMFG PFNL  ++Y+  
Sbjct  536  MEGNIFKDANISTSHSML--------PQA--SPFNAGPNDNFHFMFGSPFNLQSANYTGN  585

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+++ +WY
Sbjct  586  LPGIGYDTTPKQNLPTWY  603



>ref|XP_009798829.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
 ref|XP_009798831.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=603

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMI +LMSFYD+NIQGNK  N  N    KEQP QQ  +  +Q  +L +QGI
Sbjct  478  GVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVALTKEQPHQQPRV--NQDNYLHSQGI  535

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF+++NIS++  M         P+A  SPFN    +   FMFG PFNL  ++Y+  
Sbjct  536  MEGNIFKDANISTSHSML--------PQA--SPFNAGPNDNFHFMFGSPFNLQSANYTGN  585

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+++ +WY
Sbjct  586  LPGIGYDTTPKQNLPTWY  603



>ref|XP_006361131.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=605

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 86/138 (62%), Gaps = 9/138 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMI+DLMSFYD NIQGNK  N  N    KEQ L Q   +  Q  +L ++G+
Sbjct  475  GVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTKEQQLHQ-QPRVDQVNYLHSRGM  533

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF++ N+S+++ M    +  +Q K LNS  N      L FMFGPPFNL  ++Y   
Sbjct  534  MEGNIFKDINVSASQSMHPQSNPVDQCKILNSSDN------LHFMFGPPFNLQSTNYPGS  587

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+DI  WY
Sbjct  588  LSGIGCDATPKQDIPIWY  605



>ref|NP_001233931.1| EIN3-like protein [Solanum lycopersicum]
 dbj|BAC99307.1| EIN3-like protein [Solanum lycopersicum]
Length=605

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 88/139 (63%), Gaps = 11/139 (8%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-QPLQQTNIQCHQGGFLQNQG  568
            G+GVPEDGQRMI+DLMSFYD NIQGNK  N  N    KE QP QQ  +   Q  +L ++G
Sbjct  475  GVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTKEQQPHQQPRVD--QVNYLHSRG  532

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ GNIF++ N+S+++ M   G+  +Q K LNS  N      L FMFGPPFNL  ++Y  
Sbjct  533  MMEGNIFKDINVSASQSMQPQGNLVDQCKILNSSDN------LQFMFGPPFNLQSTNYPG  586

Query  387  GL--LGVPPLPKKDILSWY  337
             L  +G    PK+DI  WY
Sbjct  587  SLPGIGCDTTPKQDIPIWY  605



>ref|XP_009607827.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
 ref|XP_009607828.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nicotiana tomentosiformis]
Length=600

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 84/138 (61%), Gaps = 17/138 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQRMIN+LMSFYD+NIQGNK  N  N    KEQP QQ      +  +L +QGI
Sbjct  478  GVGVPEDGQRMINELMSFYDSNIQGNKSQNTGNIALTKEQPHQQP-----RDNYLHSQGI  532

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
            + GNIF+++NIS++  M   G          SPFN    +    MFG PFNL  ++Y+  
Sbjct  533  MEGNIFKDANISTSHSMLPHG----------SPFNAGPNDNFHCMFGSPFNLQSANYTGN  582

Query  384  L--LGVPPLPKKDILSWY  337
            L  +G    PK+D+ +WY
Sbjct  583  LPCIGYDTTPKQDLPTWY  600



>gb|ACP56697.1| EIN3-like protein [Lithospermum erythrorhizon]
Length=635

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 86/159 (54%), Gaps = 23/159 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQRMIN LMSFYDTNIQGNK     N     EQ + Q NI C Q  +L  QG 
Sbjct  477  GLGVPEDGQRMINGLMSFYDTNIQGNKNLPASNITFNGEQSVHQPNIHCQQVNYLPTQGA  536

Query  567  -------------------IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-NVSSI  448
                               +I GN+FQ+SNI++    +  GD F+Q K L+SPF N  + 
Sbjct  537  THQQTGTQGLSNNYQGQGLMIEGNMFQDSNINANPSPYPQGDHFDQRKVLSSPFDNNHNN  596

Query  447  ETLPFMFGPPFNLPPSDYSEGLLGVPP--LPKKDILSWY  337
            E    MFG PFN+   DY+EG  G     + K+D   W+
Sbjct  597  ENFQLMFGSPFNMASGDYTEGFPGATRDNMSKQDESIWF  635



>gb|KHG00335.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=397

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 87/141 (62%), Gaps = 5/141 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+ I +LMS YD NIQGNK  NP N+   K Q + Q  IQ  Q  F + QG+
Sbjct  256  GLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSNNLVTKGQNVLQPKIQHQQDEFFRGQGV  315

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPPFNLPPSDY  394
             + GN F++S++   + MF+ G+ QFE+ K LNSP + +        MFG PF+L   DY
Sbjct  316  MMEGNFFEDSSMLHNQQMFSQGEAQFERFKGLNSPLDSNHNNNGFQLMFGSPFDLASFDY  375

Query  393  SEGL--LGVPPLPKKDILSWY  337
             E L  +G+  +PK+D+  W+
Sbjct  376  KEDLHAVGMDSMPKQDVSIWF  396



>gb|KJB56070.1| hypothetical protein B456_009G105400 [Gossypium raimondii]
Length=612

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 89/142 (63%), Gaps = 6/142 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQ-NQG  568
            GLGVPEDGQ+MI+DLMS YD NIQGNK  NP N+   + Q L Q+  Q  Q  F   +QG
Sbjct  471  GLGVPEDGQKMISDLMSIYDNNIQGNKNMNPGNNPGTEGQNLLQSKSQPQQDEFFNGHQG  530

Query  567  I-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLPPSD  397
            + + GN F+ES++     MF  G+ QF++ K LNSPF  + +  +   MFG PF+L   D
Sbjct  531  VMMEGNFFEESSMPRNHQMFMQGEGQFDRFKGLNSPFEANHNNNSFQLMFGSPFDLASFD  590

Query  396  YSEGL--LGVPPLPKKDILSWY  337
            Y E L  +GV  +PK+D+  W+
Sbjct  591  YKEDLQAVGVDTMPKQDVSIWF  612



>gb|AID55343.1| EIN3-like protein EIL1 [Actinidia chinensis]
Length=620

 Score =   107 bits (267),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 84/140 (60%), Gaps = 10/140 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN-SGP---AKEQPLQQTNIQCHQ-GGFL  580
            GLGVPEDGQ+MI++LMSFYD NIQGN+ SNP N SG    A  Q L Q NIQC Q   ++
Sbjct  477  GLGVPEDGQKMISELMSFYDANIQGNRQSNPMNISGSLDRALSQSLPQPNIQCQQDNNYI  536

Query  579  QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  403
              QG + G++ +E+N+     MF+  + +F+Q K L+S F     +  P MFG P  LP 
Sbjct  537  HGQGFVEGHVHEEANLPINLSMFSQQENRFDQRKVLSSQFEADPNDNFPLMFGSPLYLPC  596

Query  402  SDYSEGLLGVPPLPKKDILS  343
             DY E L    P   +D LS
Sbjct  597  MDYPEHL----PAVARDTLS  612



>gb|KJB26156.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
 gb|KJB26157.1| hypothetical protein B456_004G227800 [Gossypium raimondii]
Length=614

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 6/142 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+ I +LMS YD NIQGNK  NP N+   K Q + Q  IQ  Q  F + QG+
Sbjct  472  GLGVPEDGQKTIGELMSVYDNNIQGNKNMNPSNNLVTKGQNVLQPKIQHQQDEFFRGQGV  531

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFNLPPSD  397
             + GN F++S++     MF+ G+ QFE+ K LNSP   N ++  +   MFG  F+L   D
Sbjct  532  MMEGNFFEDSSMLHNHQMFSQGEAQFERFKGLNSPLDSNHNNNNSFQLMFGSSFDLASFD  591

Query  396  YSEGL--LGVPPLPKKDILSWY  337
            Y E L  +G+  +PK+D+  W+
Sbjct  592  YKEDLHAVGMDSMPKQDVSIWF  613



>gb|AGK07288.1| EIN3-3 [Rosa hybrid cultivar]
Length=618

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 85/138 (62%), Gaps = 5/138 (4%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI-I  562
            GVPEDGQ+MI++LMSFYD+N+QG+K +NP NS     Q   Q  +   Q  + + QG+ +
Sbjct  481  GVPEDGQKMISELMSFYDSNVQGDKNANP-NSSATNGQNFSQPKVAHQQDEYFRGQGVRL  539

Query  561  PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
             GN F+ESNISS   +F   + QFEQ K ++SPF  +     P MFG PF+L   DY E 
Sbjct  540  DGNFFEESNISSNHHLFPREEGQFEQFKVVSSPFETNHNSNFPMMFGSPFDLASFDYKED  599

Query  384  LLGVP-PLPKKDILS-WY  337
            L G+  P+ K+   S W+
Sbjct  600  LQGLALPMEKQSETSIWF  617



>ref|XP_007016682.1| Ethylene insensitive 3 family protein [Theobroma cacao]
 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao]
Length=615

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 90/142 (63%), Gaps = 6/142 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
             LGVPEDGQ+MI++LMS YD NIQG K  NP N+   + Q L Q  IQ  Q  + + QG+
Sbjct  473  ALGVPEDGQKMISELMSIYDNNIQGTKNMNPGNNPVTEGQNLLQPKIQQQQDEYFRGQGV  532

Query  564  I-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSP-FNVS-SIETLPFMFGPPFNLPPSD  397
            I  GN F+ES++ +   MF+ G+ QF++ KALN+P F  + +  +   MFG PF+L   D
Sbjct  533  IMEGNFFEESSMPNNNQMFSQGEGQFDRFKALNTPQFETNHNNNSFQLMFGSPFDLASFD  592

Query  396  YSEGL--LGVPPLPKKDILSWY  337
            Y E L  +G+  LPK+D+  W+
Sbjct  593  YKEDLQAVGMDTLPKQDVSMWF  614



>gb|ABY28269.1| EIN3-like protein EIL1 [Actinidia deliciosa]
Length=570

 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 83/139 (60%), Gaps = 10/139 (7%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKISNPRN-SGP---AKEQPLQQTNIQCHQ-GGFLQ  577
            LGVPEDGQ+MI++LMSFYD NIQGN+ SNP N SG    A  Q L Q NIQC Q   ++ 
Sbjct  428  LGVPEDGQKMISELMSFYDANIQGNRQSNPMNISGSLDRALSQSLPQPNIQCQQDNNYIH  487

Query  576  NQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS  400
             QG + G++ +E+N+     MF+  + +F+Q K L+S F     +  P MFG P  LP  
Sbjct  488  GQGFVEGHVHEEANLPINFSMFSQQENRFDQRKVLSSQFEADPNDNFPLMFGSPLYLPCM  547

Query  399  DYSEGLLGVPPLPKKDILS  343
            DY E L    P   +D LS
Sbjct  548  DYPEHL----PAVARDTLS  562



>ref|XP_004144109.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=622

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 87/144 (60%), Gaps = 9/144 (6%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  478  LGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYFRNQGL  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFNLPPSD  397
             I GN F  SN+SS+  MFT  + QF++ K +N+PF  +      F  MF  PF+L   D
Sbjct  538  MIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHNNNFHLMFSSPFDLSTFD  597

Query  396  YSEGLLGVPPL----PKKDILSWY  337
            Y E + GV  +     ++DI  WY
Sbjct  598  YKEEVSGVAAIDTLSKQQDIPLWY  621



>gb|KHG04095.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=469

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 85/143 (59%), Gaps = 11/143 (8%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI++LMS YD NIQGNK  NP N+   + Q +    IQ  Q  + + Q  
Sbjct  330  GLGVPEDGQKMISELMSVYDNNIQGNKNMNPSNNPITEGQNILHPKIQQPQDEYFRGQ--  387

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSS----IETLPFMFGPPFNLPPS  400
              GN F++S++ +   MF  G+ QF++ K LNSPF          + P MFG PF+L   
Sbjct  388  --GNFFEDSSMPNNHQMFQQGEGQFDRFKGLNSPFETEHNNNNNNSFPLMFGSPFDLSTF  445

Query  399  DYSEGL--LGVPPLPKKDILSWY  337
            DY E L  +G+  +P++D+  W+
Sbjct  446  DYKEDLQTVGMDTIPRQDVSIWF  468



>ref|XP_004288382.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Fragaria vesca subsp. 
vesca]
Length=618

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI-I  562
            GVPEDGQ+MI+DLMSFYD N+QG+K +NP NS     +   Q N+   Q  + + QG+ +
Sbjct  481  GVPEDGQKMISDLMSFYDCNVQGDKNANP-NSLVTNVKNFSQPNVAHQQDEYFRGQGVRL  539

Query  561  PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEG  385
             GN F+ESNISS   +FT  + QF+Q K  +SPF  +     P MFG  F+L   DY E 
Sbjct  540  DGNFFEESNISSNHHVFTREEGQFDQFKVTSSPFETNHNSNFPMMFGSSFDLASFDYKED  599

Query  384  LLGV  373
            L G+
Sbjct  600  LQGL  603



>gb|ACJ70675.1| EIN3-like protein EIL2 [Actinidia deliciosa]
Length=618

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT----NIQCHQGGFLQ  577
            GLGVPEDGQ+MIN+LMSFYD+NIQGNK SNP +   +  Q L Q     NI      ++ 
Sbjct  477  GLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSISVSSNQTLSQALPQPNI---DNNYIH  533

Query  576  NQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  403
             QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  PF LP 
Sbjct  534  GQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASPFYLPS  593

Query  402  SDYSEGLLGVPPLPKKDILS  343
             DY E L   P LP+ D LS
Sbjct  594  VDYPEHL---PGLPRGDTLS  610



>gb|AID55344.1| EIN3-like protein EIL2 [Actinidia chinensis]
Length=618

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT----NIQCHQGGFLQ  577
            GLGVPEDGQ+MIN+LMSFYD+NIQGNK SNP +   +  Q L Q     NI      ++ 
Sbjct  477  GLGVPEDGQKMINELMSFYDSNIQGNKQSNPMSISVSSNQTLSQALPQPNI---DNNYIH  533

Query  576  NQG-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  403
             QG ++  NI +E+N+     MF+  + +F+  K LNS F  +  + +P MF  PF LP 
Sbjct  534  GQGFVMERNICEEANLPVNLSMFSQQENRFDHRKVLNSQFEANPNDNVPLMFASPFYLPS  593

Query  402  SDYSEGLLGVPPLPKKDILS  343
             DY E L   P LP+ D LS
Sbjct  594  VDYPEHL---PGLPRGDTLS  610



>ref|XP_011006497.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
 ref|XP_011006504.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Populus euphratica]
Length=617

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 6/140 (4%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-II  562
            GVPEDGQ+MI++LMS YDTNIQGNK +N  N+   ++  + Q  IQ  Q    + Q  +I
Sbjct  478  GVPEDGQKMISELMSIYDTNIQGNKNTNRGNNLVTEDHNVFQPKIQHQQDNHFRGQSNMI  537

Query  561  PGNIFQESNISSTRPMFTSG-DQFEQPKALNSPFNVSSIET-LPFMFGPPFNLPPSDYSE  388
             GNIF+ESNI+    MF+    QF++ K LNSPF  +   +    MFG PF+L   DY +
Sbjct  538  NGNIFEESNINQNHQMFSQEVGQFDRFKPLNSPFETNQNNSGFSLMFGSPFDLSSFDYKD  597

Query  387  GL--LGVPPLPK-KDILSWY  337
             L  LG+  LPK +D+ +W+
Sbjct  598  DLQVLGMDTLPKHQDVSTWF  617



>ref|XP_002275284.2| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
 ref|XP_010651613.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Vitis vinifera]
Length=610

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 75/141 (53%), Gaps = 12/141 (9%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI DLMSFYDTNIQG+K+SNPR+     +Q LQ    Q HQ         
Sbjct  477  GLGVPEDGQKMIGDLMSFYDTNIQGSKVSNPRSIAVTNDQNLQHPKRQHHQNNSFH----  532

Query  564  IPGNIFQESNISSTRPMF-TSGDQFEQPKALNSPFNVSSIE-TLPFMFGPPFNLPPSDYS  391
                  QESN++    MF     QF++ K LNS F  S  E    F++GP F+L   DY 
Sbjct  533  ---GFLQESNMTHNHHMFPREESQFDRSKLLNSRFETSPNENAFQFIYGPAFDLSSIDYV  589

Query  390  EGLLGVPPL---PKKDILSWY  337
            E +          K+D   WY
Sbjct  590  EDIPATTATDISSKQDASIWY  610



>ref|XP_008451093.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Cucumis melo]
Length=625

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 87/147 (59%), Gaps = 12/147 (8%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  478  LGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYFRNQGL  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN-----VSSIETLPFMFGPPFNLP  406
             + GN F  SN+SS+  MFT  + QF++ K +NSPF       ++      MF  PF+L 
Sbjct  538  MMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNNNNFHLMFSSPFDLS  597

Query  405  PSDYSEGLLGVPPL----PKKDILSWY  337
              DY E + GV  +     ++DI  WY
Sbjct  598  TFDYKEEVPGVAAIDTLSKQQDIPLWY  624



>ref|XP_010031647.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031648.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 ref|XP_010031649.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Eucalyptus grandis]
 gb|KCW51004.1| hypothetical protein EUGRSUZ_J00631 [Eucalyptus grandis]
Length=611

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 83/141 (59%), Gaps = 13/141 (9%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ++I+DLMS YDT+IQGNK  NP N    ++Q   Q          LQ Q  
Sbjct  477  GLGVPEDGQKVISDLMSIYDTSIQGNKNMNPANDAIIEDQSRPQPK--------LQQQNE  528

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFNLPPSDY  394
              G+ FQ+ N S+   MF+  D QF++ K +NS F  N  + + L  MFG PF+L   D+
Sbjct  529  FVGSFFQQPNASANHHMFSREDIQFDRFKTMNSSFEANNHNHDNLQLMFGSPFDLSSFDF  588

Query  393  SEGLLG--VPPLPKKDILSWY  337
             E L G  + PLPK+D+  W+
Sbjct  589  KEELPGGVMDPLPKQDVTIWF  609



>gb|KGN66413.1| EIN3-like protein [Cucumis sativus]
Length=630

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 17/152 (11%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  478  LGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYFRNQGL  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN----------VSSIETLPFMFGP  421
             I GN F  SN+SS+  MFT  + QF++ K +N+PF            ++      MF  
Sbjct  538  MIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNNNNNNNNNFHLMFSS  597

Query  420  PFNLPPSDYSEGLLGVPPL----PKKDILSWY  337
            PF+L   DY E + GV  +     ++DI  WY
Sbjct  598  PFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  629



>gb|AHB18380.1| ethylene insensitive 3 [Momordica charantia]
Length=629

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 89/152 (59%), Gaps = 16/152 (11%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQG  568
             LGVPEDGQ++I++LMS YDTN+QGNK + N  N+  A+ Q L Q  IQ  Q  + +NQG
Sbjct  477  SLGVPEDGQKLISELMSIYDTNVQGNKNNVNTVNAAIAENQNLPQLKIQPQQDEYFRNQG  536

Query  567  I-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------VSSIETLPFMFGP  421
            I + GN F+ SN+SS+ PMF   + QF++ K +N+PF           ++      MFG 
Sbjct  537  IMMEGNFFEGSNVSSSHPMFPRDEGQFDRFKPMNTPFENNHHQHNHNHNNNNNFHLMFGS  596

Query  420  PFNLPPSDYSEGLLGVPPL----PKKDILSWY  337
            PF+L   DY E + G   +     ++DI  WY
Sbjct  597  PFDLSTFDYKEEVPGAAAIDTLSKQQDIPLWY  628



>ref|XP_004171661.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Cucumis sativus]
Length=632

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 19/154 (12%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  478  LGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYFRNQGL  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN------------VSSIETLPFMF  427
             I GN F  SN+SS+  MFT  + QF++ K +N+PF              ++      MF
Sbjct  538  MIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNNNNNNNNNNNFHLMF  597

Query  426  GPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  337
              PF+L   DY E + GV  +     ++DI  WY
Sbjct  598  SSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  631



>gb|AFK80347.1| ethylene-insensitive 3 [Cucumis sativus]
Length=635

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 87/157 (55%), Gaps = 22/157 (14%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++I++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  478  LGVPEDGQKLISELMSIYDTNIQGNKNNLNTGNSATTENQNLPQLKIQPQQDDYFRNQGL  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN---------------VSSIETLP  436
             I GN F  SN+SS+  MFT  + QF++ K +N+PF                 ++     
Sbjct  538  MIEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNTPFENNHHHHNNNNNNNNNNNNNNNFH  597

Query  435  FMFGPPFNLPPSDYSEGLLGVPPL----PKKDILSWY  337
             MF  PF+L   DY E + GV  +     ++DI  WY
Sbjct  598  LMFSSPFDLSTFDYKEEVSGVAAIDTLSKQQDIPLWY  634



>ref|XP_002312841.2| EIN3-like family protein [Populus trichocarpa]
 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa]
Length=625

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 21/155 (14%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNS----GPAKEQPL---QQTN-------IQ  601
            GVPEDGQ+MI++LMS YDTNIQGNK +NP N+    G    QP    QQ N       IQ
Sbjct  471  GVPEDGQKMISELMSNYDTNIQGNKNTNPVNNLVTGGHHVFQPKIQHQQDNHNVFQPKIQ  530

Query  600  CHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVS-SIETLPFM  430
              QG   ++QG +I GN+F+ESNI+S   +F+  G QF++ K LNSPF  S +  +   M
Sbjct  531  HQQGNHFRSQGNVIDGNVFKESNINSNHQLFSQEGGQFDRFKPLNSPFETSQNNSSFNLM  590

Query  429  FGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  337
            F  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  591  FSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  625



>ref|XP_006384758.1| EIN3-like family protein [Populus trichocarpa]
 gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa]
Length=617

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 6/140 (4%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-II  562
            GVPEDGQ+MI++LMS YDTNIQGNK +N  N+   +   + Q  IQ  Q    ++Q  +I
Sbjct  478  GVPEDGQKMISELMSIYDTNIQGNKNTNRGNNLVTEGHNVFQPKIQHQQDNHFRSQSNMI  537

Query  561  PGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVSSIET-LPFMFGPPFNLPPSDYSE  388
             G+IF+ SNI+    MF+  G QF++ K LNSPF  +   +    MFG PF+L   DY +
Sbjct  538  NGSIFEGSNINQNHQMFSQEGGQFDRFKPLNSPFETNQNNSGFNLMFGSPFDLSSFDYKD  597

Query  387  GL--LGVPPLPK-KDILSWY  337
             L  LG+  LPK +D+ +W+
Sbjct  598  DLQVLGMDTLPKHQDVSTWF  617



>ref|XP_004501972.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004501973.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=624

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 87/146 (60%), Gaps = 16/146 (11%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQP-LQQTNIQCHQGGFLQNQG  568
            GLGVPEDGQ+MI DLM+ YDTN+QGN      N   A E P L Q NIQ  QG F ++QG
Sbjct  484  GLGVPEDGQKMIGDLMTGYDTNVQGN------NRVAAVENPNLPQPNIQPQQGSFYRSQG  537

Query  567  IIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN----VSSIETLPFMFGPPFNLP  406
            I+  GN+FQE+++S+   MF   + QF++ KALNSPF      +       MFG   +L 
Sbjct  538  IVMGGNLFQETSMSNNHHMFARDEGQFDRFKALNSPFENHHNHNHNNNYHLMFGSHCDLT  597

Query  405  PSDYSEGL--LGVPPLPKK-DILSWY  337
              D+ + +  +GV  L K+ DI  WY
Sbjct  598  SFDFKDDMHGVGVDGLQKQPDISIWY  623



>gb|KJB20248.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20249.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
 gb|KJB20250.1| hypothetical protein B456_003G140600 [Gossypium raimondii]
Length=615

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 87/141 (62%), Gaps = 9/141 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI++LMS YD NIQG+K  NP N+  A+ Q +    IQ  Q  + + +  
Sbjct  478  GLGVPEDGQKMISELMSVYDNNIQGSKNMNPGNNPIAEGQNILHPKIQQPQDEYFRGE--  535

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV--SSIETLPFMFGPPFNLPPSDY  394
              GN F++S++ +   MF  G+ QF++ K LNS F    ++  + P MFG PF+L   DY
Sbjct  536  --GNFFEDSSMPNNHQMFPQGEGQFDRFKGLNSLFETEHNNNNSFPLMFGSPFDLSTFDY  593

Query  393  SEGL--LGVPPLPKKDILSWY  337
             E L  +G+  +P++D+  W+
Sbjct  594  KEDLQTVGMDTIPRQDVSIWF  614



>ref|XP_002276380.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
 ref|XP_010659025.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Vitis vinifera]
Length=616

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 87/145 (60%), Gaps = 15/145 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH------QGGF  583
            GLG+PEDGQ+MI+DLMSFYDTN+Q NK  NP N    ++Q   Q   Q           F
Sbjct  477  GLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGNLNVMEDQNQPQQQQQQQKFQLQLDDNF  536

Query  582  LQNQGIIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFN  412
              NQG++  GNI +E+N+     +F+S + QF+Q KA +SPF+ +  + +  F FG PFN
Sbjct  537  F-NQGVMMGGNITEETNMPLNHSVFSSSEIQFDQCKAFDSPFDTNPNDNIADFRFGSPFN  595

Query  411  LPPSDYSEGLLGVPPLPKKDILSWY  337
            L   DY+     V PLPK+D+  WY
Sbjct  596  LAAVDYT-----VDPLPKQDVSMWY  615



>ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
 gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis]
Length=617

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 12/144 (8%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-II  562
            GVPEDGQ+MI++LMS YDTN+QGNK  N  N+   +   L Q  I   Q  + ++Q  ++
Sbjct  475  GVPEDGQKMISELMSIYDTNVQGNK--NSGNNQVTEGHNLFQPKIHHQQDNYFRSQSNVM  532

Query  561  PGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFN-----VSSIETLPFMFGPPFNLPPS  400
              NIF++SNI +   MF+  G QF++ KALNSPF       ++  +   MFG PF+L   
Sbjct  533  DANIFEDSNIHNNHQMFSQDGSQFDRFKALNSPFESSNQHNNNNSSFNLMFGSPFDLSSF  592

Query  399  DYSEGL--LGVPPLPK-KDILSWY  337
            DY E L  L +  LPK +D   W+
Sbjct  593  DYKEDLQGLAMESLPKQQDAAIWF  616



>ref|XP_011043514.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Populus euphratica]
Length=632

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 91/155 (59%), Gaps = 21/155 (14%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNKISNPRNS----GPAKEQP---LQQTN-------IQ  601
            GVPEDGQ+MI++LMS YDTNIQ NK +NP N+    G    QP    QQ N       IQ
Sbjct  478  GVPEDGQKMISELMSIYDTNIQSNKNTNPVNNLVTGGHHVFQPKIQRQQDNHNVFQPKIQ  537

Query  600  CHQGGFLQNQG-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPFNVS-SIETLPFM  430
              QG   ++QG +I GN+F+E NI+S   +F+  G QF++ K LNSPF  S +  +   M
Sbjct  538  HQQGNHFRSQGNVIGGNVFKEYNINSNHQLFSQEGGQFDRFKPLNSPFETSQNNSSFNLM  597

Query  429  FGPPFNLPPSDYSEGL--LGVPPLPK--KDILSWY  337
            F  P +L   +Y E L  LG+  LPK  +D+  W+
Sbjct  598  FSSPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF  632



>gb|KDP42896.1| hypothetical protein JCGZ_23838 [Jatropha curcas]
Length=619

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 83/149 (56%), Gaps = 15/149 (10%)
 Frame = -1

Query  738  GVPEDGQRMINDLMSFYDTNIQGNK--ISNPRNSGPAKEQPLQQTNIQCHQ--GGFLQNQ  571
            GVPEDGQ+MI++LMS YDTNIQGNK   +        +   L Q  I  H     + + Q
Sbjct  470  GVPEDGQKMISELMSIYDTNIQGNKNTNAGNNGVNVNESHSLFQPKIHHHHQPDNYFRGQ  529

Query  570  G-IIPGNIFQESNISSTRPMFT-SGDQFEQPKALNSPF------NVSSIETLPFMFGPPF  415
              +I GNIF+ESNI +   MF+   +QFE+ KALNSPF        ++     F FG PF
Sbjct  530  ANVIEGNIFEESNIHNNHQMFSQDSNQFERFKALNSPFESNHHPTAAATNNSSFKFGSPF  589

Query  414  NLPPSDYSEGLLGV--PPLPK-KDILSWY  337
            +L   DY E L G+    LPK +D+  W+
Sbjct  590  DLASFDYKEDLQGLVMDALPKQQDVSIWF  618



>dbj|BAB64344.1| EIN3-like protein [Cucumis melo]
Length=693

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 79/133 (59%), Gaps = 8/133 (6%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPEDGQ++ ++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + +NQG+
Sbjct  477  LGVPEDGQKLTSELMSIYDTNIQGNKNNLNTVNSATTENQNLPQLKIQPQQDDYFRNQGL  536

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN-----VSSIETLPFMFGPPFNLP  406
             + GN F  SN+SS+  MFT  + QF++ K +NSPF       ++      MF  PF+L 
Sbjct  537  MMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNNNNFHLMFSSPFDLS  596

Query  405  PSDYSEGLLGVPP  367
              DY E +  V P
Sbjct  597  TFDYKEEVPSVQP  609



>gb|AFK45610.1| unknown [Lotus japonicus]
Length=238

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 85/152 (56%), Gaps = 16/152 (11%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQP-------LQQTNIQCHQGG  586
            GLGVPEDGQ+MI DLMS YDTN+QG+K  +  N   A E P        QQ  IQ  QG 
Sbjct  86   GLGVPEDGQKMIGDLMSVYDTNVQGSKNLSSSNRVVAAENPNVPQPSIQQQQGIQQQQGS  145

Query  585  FLQNQGII-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNV---SSIETLPFMFGP  421
            F +   +I  GN F+E+NIS+   MF   + QF++ KALNSPF     SS      MFG 
Sbjct  146  FFRGHSVIMEGNFFEEANISTNHHMFAREENQFDRFKALNSPFEAPHQSSNNNFHLMFGS  205

Query  420  PFNLPPSDYSEGL---LGVPPLPKK-DILSWY  337
            P +L   D+ E +   +G+    K+ DI  WY
Sbjct  206  PCDLASFDFKEDMQQGVGMEAHQKQPDISIWY  237



>gb|KHN33829.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=621

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 7/143 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI+DLMS YDTN Q NK  +  N   A+   L Q  I+  Q  F ++QGI
Sbjct  478  GLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVAAENPSLPQPGIRQQQDNFFRSQGI  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIETLPFMFGPPFNLPPSDY  394
             + GN ++E+N+ +   MF   + QF++ KALN+ PF  +       MFG P +L   D+
Sbjct  538  TMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPPFESNHNNNFHLMFGSPCDLASFDF  597

Query  393  SEGLL---GVPPLPKK-DILSWY  337
             E +    G+  L K+ DI  WY
Sbjct  598  KEDMQGGGGMDALQKQADISIWY  620



>ref|XP_003543159.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=621

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 7/143 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI+DLMS YDTN Q NK  +  N   A+   L Q  I+  Q  F ++QGI
Sbjct  478  GLGVPEDGQKMISDLMSIYDTNFQSNKNLSSSNHVAAENPSLPQPGIRQQQDNFFRSQGI  537

Query  564  -IPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIETLPFMFGPPFNLPPSDY  394
             + GN ++E+N+ +   MF   + QF++ KALN+ PF  +       MFG P +L   D+
Sbjct  538  TMEGNFYEEANMPNNHHMFAREESQFDRFKALNAPPFESNHNNNFHLMFGSPCDLASFDF  597

Query  393  SEGLL---GVPPLPKK-DILSWY  337
             E +    G+  L K+ DI  WY
Sbjct  598  KEDMQGGGGMDALQKQADISIWY  620



>gb|KHG09663.1| ethylene insensitive 3 -like protein [Gossypium arboreum]
Length=634

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 9/142 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI++LMS YD N+Q NK ++P  +   + Q L Q   Q  Q  F + QG+
Sbjct  496  GLGVPEDGQKMISNLMSIYDNNVQANKNASPIKNPVTEGQNLLQPKTQQQQDEFFRGQGL  555

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS---SIETLPFMFGPPFNLPPSD  397
               + F ESNI +   +   G+ QF+Q K  NSPF  +   +      MFG PF+L   D
Sbjct  556  ---SFFNESNIPANNQILPQGEAQFDQLKTSNSPFETTYNNNNNGFKLMFGSPFDLSSFD  612

Query  396  YSEGLL--GVPPLPKKDILSWY  337
            Y++ L   G+  +PK+D+  W+
Sbjct  613  YNDDLQADGMDAMPKQDVSIWF  634



>ref|XP_006470438.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006470439.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
Length=621

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 81/149 (54%), Gaps = 18/149 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  580
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  478  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----HQQEYY  532

Query  579  QNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPFMFGPP  418
              QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      +      MF  P
Sbjct  533  HGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGNNNNFSLMFESP  592

Query  417  FNLPPSDYSEGL--LGVPPLPKKDILSWY  337
            F+L   DY E     GV  +PK D   W+
Sbjct  593  FDLGSFDYKEDFQAAGVDTMPKHDTSVWF  621



>gb|KDO66375.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66376.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66377.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=582

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 18/149 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  580
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  439  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----HQQEYY  493

Query  579  QNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPFMFGPP  418
              QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      S      MF  P
Sbjct  494  HGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSLMFESP  553

Query  417  FNLPPSDYSEGL--LGVPPLPKKDILSWY  337
            F+L   DY E     GV  +PK D   W+
Sbjct  554  FDLGSFDYKEDFQAAGVDTMPKHDSSVWF  582



>gb|KDO66378.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66379.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
 gb|KDO66380.1| hypothetical protein CISIN_1g0070172mg [Citrus sinensis]
Length=621

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 18/149 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  580
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  478  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPGNNAVVTEGQNTLQPRAQ-----HQQEYY  532

Query  579  QNQG-IIPGNIFQESNI-SSTRPMFTSGD-QFEQPKALNSPFN---VSSIETLPFMFGPP  418
              QG ++ GN+F+ SN+  +   MFT  + QF++ K +NSPF      S      MF  P
Sbjct  533  HGQGAVMDGNLFEGSNMHENNHLMFTREENQFDRFKIMNSPFENNSSGSNNNFSLMFESP  592

Query  417  FNLPPSDYSEGL--LGVPPLPKKDILSWY  337
            F+L   DY E     GV  +PK D   W+
Sbjct  593  FDLGSFDYKEDFQAAGVDTMPKHDSSVWF  621



>ref|XP_003555660.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN46383.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=624

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 10/146 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDG++MI DLMS YDTN+Q NK  +  N   A+   L Q  IQ     F ++QGI
Sbjct  478  GLGVPEDGKKMITDLMSIYDTNVQSNKNLSSSNHVSAENPNLPQPGIQQQHDNFFRSQGI  537

Query  564  -IPGNIFQESNIS-STRPMFTSGD-QFEQPKALNS-PFNVS-SIETLPFMFGPPFNLPPS  400
             + GN F+E+N+S +   MF   + QF++ KALN+ PF  + +      MFG P +L   
Sbjct  538  SMEGNFFEEANMSNNNHHMFAREEGQFDRFKALNAPPFETNHNNNNFHLMFGSPCDLASF  597

Query  399  DYSE----GLLGVPPLPKK-DILSWY  337
            D+ E    G++G+  L K+ DI  WY
Sbjct  598  DFKEDMQGGVVGMDALQKQPDISIWY  623



>ref|XP_006446382.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446383.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59622.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59623.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=621

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 78/149 (52%), Gaps = 18/149 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  580
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  478  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAVVTEGQNTLQPRAQ-----HQQEYY  532

Query  579  QNQG-IIPGNIFQESNISSTRPMF--TSGDQFEQPKALNSPFN---VSSIETLPFMFGPP  418
              QG ++ GN+F+ SN+     +      +QF++ K +NSPF      S      MF  P
Sbjct  533  HGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKIMNSPFENNSSGSNNNFSLMFESP  592

Query  417  FNLPPSDYSEGL--LGVPPLPKKDILSWY  337
            F+L   DY E     GV  +PK D   W+
Sbjct  593  FDLGSFDYKEDFQAAGVDTMPKHDSSVWF  621



>ref|XP_006446380.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 ref|XP_006446381.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59620.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
 gb|ESR59621.1| hypothetical protein CICLE_v10014617mg [Citrus clementina]
Length=596

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 78/149 (52%), Gaps = 18/149 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-----QPLQQTNIQCHQGGFL  580
            GLGVPEDGQ+MI++LMS YD NIQGN+  NP N+    E     QP  Q     HQ  + 
Sbjct  453  GLGVPEDGQKMISELMSIYDNNIQGNRNVNPSNNAVVTEGQNTLQPRAQ-----HQQEYY  507

Query  579  QNQG-IIPGNIFQESNISSTRPMF--TSGDQFEQPKALNSPFN---VSSIETLPFMFGPP  418
              QG ++ GN+F+ SN+     +      +QF++ K +NSPF      S      MF  P
Sbjct  508  HGQGAVMDGNLFEGSNMHDNNHLMFPREENQFDRFKIMNSPFENNSSGSNNNFSLMFESP  567

Query  417  FNLPPSDYSEGL--LGVPPLPKKDILSWY  337
            F+L   DY E     GV  +PK D   W+
Sbjct  568  FDLGSFDYKEDFQAAGVDTMPKHDSSVWF  596



>ref|XP_010106127.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07787.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=617

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 81/143 (57%), Gaps = 12/143 (8%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNI-QGNKISNPRNSGPAKEQPLQQTN--IQCHQGGFLQN  574
            GLG+PEDGQ+MI+DL+SFYD N+ Q  K  NP N    +    QQ N   Q   G + Q 
Sbjct  479  GLGLPEDGQKMISDLLSFYDINMPQRRKSLNPGNFTATEHHDPQQQNYQFQMDDGFYSQG  538

Query  573  QGIIPGNIFQ--ESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNLP  406
             G++ GN     ++NI S   +F S D QF+Q KA +S  + +  + +    FG PFNL 
Sbjct  539  SGVMGGNTNAPLQTNIPSHHAVFPSSDVQFDQCKAFDSSLDNNPTDNISDIRFGSPFNLA  598

Query  405  PSDYSEGLLGVPPLPKKDILSWY  337
            P++Y+     V  LPK+D+  WY
Sbjct  599  PAEYT-----VDSLPKQDVSLWY  616



>gb|KJB83827.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
 gb|KJB83828.1| hypothetical protein B456_013G266300 [Gossypium raimondii]
Length=594

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 83/141 (59%), Gaps = 8/141 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI+DLMS YD N+Q NK  +P  +   + Q L Q   Q  Q  F + QG+
Sbjct  457  GLGVPEDGQKMISDLMSIYDNNVQANKNVSPIKNPVTEGQNLLQLKTQQQQDEFFRGQGL  516

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS--SIETLPFMFGPPFNLPPSDY  394
               + F ESNI +   +   G+ QF++ K  NSPF  +  +  +   MFG PF+L   DY
Sbjct  517  ---SFFNESNIPANNQILPQGEAQFDRLKTSNSPFETTYNNNNSFKLMFGSPFDLSSFDY  573

Query  393  SEGL--LGVPPLPKKDILSWY  337
            ++ L  +GV  +PK+D+  W+
Sbjct  574  NDDLQAVGVDTMPKQDVSIWF  594



>gb|AHC70433.1| ethylene insensitive 3 protein [Cucurbita pepo subsp. pepo]
Length=618

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 81/147 (55%), Gaps = 20/147 (14%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            LGVPED Q+MI +LMS YDTNIQGN+ + N  NS   + Q L Q  IQ  Q  + +NQGI
Sbjct  479  LGVPEDDQKMIRELMSIYDTNIQGNQSNVNTGNSAITENQNLPQLKIQPQQDEYFRNQGI  538

Query  564  -IPGNIFQESNISSTRPMFTSGDQFEQPKALNSP------FNVSSIETLPFMFGPPFNLP  406
             + GN F+ SN+SS+        QF Q K +NSP       + ++      MFG PF+L 
Sbjct  539  MMDGNFFEGSNVSSS--------QFNQFKPMNSPFENNHHEHNNNNNNFHMMFGSPFDLS  590

Query  405  PSDYSEGLLGVPPL----PKKDILSWY  337
              D+ E L G   +     ++DI  WY
Sbjct  591  TFDFKEELPGAAAIDTLSKQQDIPLWY  617



>ref|XP_003543154.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
 gb|KHN33830.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=618

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 6/142 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GL V ++GQ+MI DLM+ YDTN++GNK ++  N   A+   L Q  +Q  Q  F++ QGI
Sbjct  476  GLEVSDNGQKMITDLMTNYDTNVRGNKKTSSCNHLAAENFDLPQHAMQQQQDNFIRGQGI  535

Query  564  IP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLPPSDY  394
               GNIF E+N+ +   MF   + QF++ KALN+PF  + +      MFG   +L   D+
Sbjct  536  TAEGNIFDEANMPNNHHMFAREEGQFDRFKALNAPFETNHNNNNFHSMFGSLCDLASFDF  595

Query  393  SEGL--LGVPPLPKK-DILSWY  337
             E +  +G+  L K+ DI  WY
Sbjct  596  KEDMQGVGMDTLQKQPDISIWY  617



>gb|AFI61908.1| ethylene insensitive 3-like 2 protein [Paeonia suffruticosa]
Length=607

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (54%), Gaps = 5/138 (4%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQC-HQGGFLQNQGI  565
            L VPE+GQ+ I++LMSFYD N  GN   NP N    ++  LQ   I C  Q  FLQ +G+
Sbjct  471  LRVPEEGQKSIDELMSFYDLNFHGNGNINPGNMAMTQDLNLQHPKIHCQQQDRFLQGRGV  530

Query  564  -IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-NVSSIETLPFMFGPPFNLPPSDYS  391
             I G++F +SNI +   +F  G QF+  K    P  N     T   +FG P +L   DY+
Sbjct  531  TIDGDLFADSNIPNNHQIFPRGGQFDGCKVSIPPLINHHDDNTYNMIFGSPVHLASVDYA  590

Query  390  EGLLGVPPLPKKDILSWY  337
               L +  L K+D  +WY
Sbjct  591  G--LAMESLSKQDGSTWY  606



>ref|XP_010247605.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=618

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 7/142 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGFLQNQG  568
            GLG+PEDGQ+ I++LMSFYD+N+Q NK SNP N      Q  + Q  +Q  +  + Q   
Sbjct  477  GLGLPEDGQKTISELMSFYDSNLQRNKCSNPGNVAAMDGQNSEPQPKVQLEENFYGQGSA  536

Query  567  IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP--FMFGPPFNLPPSD  397
             + GN+F+E+N+     MF   + QF+Q K  + P   ++ + +P  F FG PFN+P  D
Sbjct  537  -VGGNMFEENNMPMNHQMFPREEIQFDQYKVFDPPAYETNHDDIPSDFRFGSPFNMPSVD  595

Query  396  YSEGL--LGVPPLPKKDILSWY  337
            + E L    V  + K +   WY
Sbjct  596  FGEVLPRGTVETMSKTESSIWY  617



>ref|XP_002310961.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 ref|XP_006379422.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEE88328.1| hypothetical protein POPTR_0008s01200g [Populus trichocarpa]
 gb|ERP57219.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 15/139 (11%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PEDG++ I+DLMSFYDTN+Q +K  NP ++        QQ   Q         QG 
Sbjct  476  GLGLPEDGKKSISDLMSFYDTNLQRDKNMNPGSAN-------QQQKFQFQLDDSFYGQGA  528

Query  564  IPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNLPPSDY  394
            I G NI + +++      F S + QF+  KA +S F+ +  + +  F FG PF +PP DY
Sbjct  529  IMGNNITEVTSMPVNSSAFPSTEMQFDHCKAFDSAFDANVNDNVADFRFGSPFTMPPVDY  588

Query  393  SEGLLGVPPLPKKDILSWY  337
            S     + P+PK+D   WY
Sbjct  589  S-----MDPMPKQDAGMWY  602



>gb|KDO53815.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53816.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53817.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53818.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
 gb|KDO53819.1| hypothetical protein CISIN_1g007174mg [Citrus sinensis]
Length=614

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 24/146 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQCHQG  589
            GLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q    
Sbjct  482  GLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQLQLD  535

Query  588  GFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPF  415
                NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F  PF
Sbjct  536  DSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRFNSPF  592

Query  414  NLPPSDYSEGLLGVPPLPKKDILSWY  337
            N+   DY      + P+PK+D+  WY
Sbjct  593  NIASVDYP-----MDPIPKQDVSMWY  613



>ref|XP_006432540.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006432541.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 ref|XP_006471295.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471296.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471297.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471298.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X4 [Citrus 
sinensis]
 gb|ESR45780.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
 gb|ESR45781.1| hypothetical protein CICLE_v10000617mg [Citrus clementina]
Length=614

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 79/146 (54%), Gaps = 24/146 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQCHQG  589
            GLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q    
Sbjct  482  GLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQLQLD  535

Query  588  GFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPF  415
                NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F  PF
Sbjct  536  DSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRFNSPF  592

Query  414  NLPPSDYSEGLLGVPPLPKKDILSWY  337
            N+   DY      + P+PK+D+  WY
Sbjct  593  NIASVDYP-----MDPIPKQDVSMWY  613



>emb|CAB95830.1| hypothetical protein [Cicer arietinum]
Length=354

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 78/143 (55%), Gaps = 17/143 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI +LMS YDTN+ GNK ++  N    + Q L Q  IQ  Q  F  +QG+
Sbjct  221  GLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVAVENQNLSQPCIQQQQDNFFSSQGM  280

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLPPSDYS  391
                + + +N       FT  + QF++ K +NSPF  + +   +  MFG P +L   D+ 
Sbjct  281  ----VMEAANF------FTRDESQFDRFKPINSPFETNHNNNNIHLMFGSPCDLASFDFK  330

Query  390  EGL----LGVPPLPKK-DILSWY  337
            E +    +G+    K+ D+  WY
Sbjct  331  EDIQLQGVGIDTFHKQPDMSIWY  353



>ref|XP_006432536.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432537.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432538.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006432539.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 ref|XP_006471293.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Citrus 
sinensis]
 gb|ESR45776.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45777.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45778.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
 gb|ESR45779.1| hypothetical protein CICLE_v10000608mg [Citrus clementina]
Length=617

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 10/141 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ--QTNIQCHQGGFLQNQ  571
            GL +P+DGQ+MI DLMSFYDTN Q NK  N  N     +Q  Q  Q   Q        +Q
Sbjct  481  GLELPDDGQKMITDLMSFYDTNHQQNKSLNSGNLNAIGDQNQQQEQRKFQLQMDDSFYSQ  540

Query  570  GIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNLPPS  400
            G + G N+  +SN+     +F+S + +F+Q KA +SP++ +  +++  F F  PFN+   
Sbjct  541  GAVMGRNMPGQSNMPMNNSVFSSAEIRFDQCKAFDSPYDANPSDSIADFRFNSPFNMASV  600

Query  399  DYSEGLLGVPPLPKKDILSWY  337
            DY+     +  +PK+D+  WY
Sbjct  601  DYA-----MDSIPKQDVSLWY  616



>gb|AAL76271.1|AF467783_1 transcription factor EIL2 [Vigna radiata]
Length=622

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 80/144 (56%), Gaps = 8/144 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-QGGFLQNQG  568
            GL V EDG++ I+DLM+ YDTN+QGNK  +  N    +     Q  +Q H Q  F++ +G
Sbjct  478  GLEVSEDGKKRISDLMTNYDTNVQGNKNMSSCNRVAGEVLNFPQHGMQQHQQDNFIRGRG  537

Query  567  I-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFNLPPS  400
            I + GN+F E+ +S+    F   + QF++ KALNSPF  +      F  MFG   +L   
Sbjct  538  ITMEGNVFDEATMSNNHHTFARDECQFDRFKALNSPFETNHNNNNNFHSMFGSFCDLASF  597

Query  399  DYSEGL--LGVPPLPKK-DILSWY  337
            D+ E +  +G+  L K+ D   WY
Sbjct  598  DFKEDMQGVGMDALQKQTDFSVWY  621



>ref|NP_001275851.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
 gb|ADI40102.1| ethylene-insensitive 3-like 1 protein [Citrus sinensis]
Length=614

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 79/146 (54%), Gaps = 24/146 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK--------ISNPRNSGPAKEQPLQQTNIQCHQG  589
            GLG+P+DGQ+MI+DLMSFYDTN+Q NK        ++  RN  P      +Q   Q    
Sbjct  482  GLGLPDDGQKMISDLMSFYDTNLQPNKSMSQGCLNVTEDRNQQP------EQQKFQLQLD  535

Query  588  GFLQNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPF  415
                NQG+    + +  N+    P+F+S +  F+Q KA +SPF+ +  + +  F F  PF
Sbjct  536  DSFYNQGV---GVMKGGNMPVNNPVFSSTEVHFDQCKAFDSPFDNNPGDNIAEFRFNSPF  592

Query  414  NLPPSDYSEGLLGVPPLPKKDILSWY  337
            N+   +Y      + P+PK+D+  WY
Sbjct  593  NVASVNYP-----MDPIPKQDVSMWY  613



>ref|XP_004491182.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004491183.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2 [Cicer 
arietinum]
Length=611

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 78/143 (55%), Gaps = 17/143 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI +LMS YDTN+ GNK ++  N    + Q L Q  IQ  Q  F  +QG+
Sbjct  478  GLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVAVENQNLSQPCIQQQQDNFFSSQGM  537

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVS-SIETLPFMFGPPFNLPPSDYS  391
                + + +N       FT  + QF++ K +NSPF  + +   +  MFG P +L   D+ 
Sbjct  538  ----VMEAANF------FTRDESQFDRFKPINSPFETNHNNNNIHLMFGSPCDLASFDFK  587

Query  390  EGL----LGVPPLPKK-DILSWY  337
            E +    +G+    K+ D+  WY
Sbjct  588  EDIQLQGVGIDTFHKQPDMSIWY  610



>ref|XP_007146084.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
 gb|ESW18078.1| hypothetical protein PHAVU_006G011300g [Phaseolus vulgaris]
Length=624

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK--ISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQ  571
            GL V EDG++ I+DLMS YDTN+QGN   IS+  N   A+   L Q  +Q     F++++
Sbjct  479  GLEVSEDGKKRISDLMSNYDTNVQGNSKNISSSCNRVAAEVLNLTQHGMQQQHDNFIRSR  538

Query  570  G-IIPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPPFNLPPS  400
            G  + GN+F E+ +S+    F   + QF++ KALN+PF  +   +    MFG   +L   
Sbjct  539  GNTMEGNVFDEATMSNNHHTFARDECQFDRFKALNTPFETNHNNSNFHSMFGSFCDLASF  598

Query  399  DYSE---GLLGVPPLPKK-DILSWY  337
            D+ E   G++G+  + K+ D   WY
Sbjct  599  DFKEDMQGVIGMDVVQKQPDFSVWY  623



>ref|XP_008368189.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=659

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L  QG+
Sbjct  525  GLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLXGQGL  584

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L P  
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHLSPVG  644

Query  396  Y  394
            Y
Sbjct  645  Y  645



>ref|XP_010106128.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
 gb|EXC07788.1| Protein ETHYLENE INSENSITIVE 3 [Morus notabilis]
Length=607

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 21/146 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNI-QGNKISNP------RNSGPAKEQPLQQTNIQCHQGG  586
            GL +PEDGQ+MI+DLMSFYD N  Q +K  NP       N  PA+    Q+   Q     
Sbjct  472  GLDLPEDGQKMISDLMSFYDNNAQQRSKDLNPGTLNAMENHNPAQ----QKYQFQIDDSY  527

Query  585  FLQNQGIIP-GNIFQESNISSTRPMFTSGD-QFEQPKALNSPF-NVSSIETLPFMFGPPF  415
            F   QG++  GNI +++NISS   +F S + QF+Q KA +SPF N  +   +   F  PF
Sbjct  528  F--GQGVVMGGNIPEQANISSQNAVFPSTEVQFDQCKAFDSPFDNNPNDNIVDLRFSSPF  585

Query  414  NLPPSDYSEGLLGVPPLPKKDILSWY  337
            N+ P ++      V  LPK+D+  WY
Sbjct  586  NMAPVEFP-----VDSLPKQDVSLWY  606



>gb|ADE41153.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=659

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L  QG+
Sbjct  525  GLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLYGQGL  584

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L P  
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHLSPVG  644

Query  396  Y  394
            Y
Sbjct  645  Y  645



>gb|AGI41323.1| EIN3-like protein [Malus domestica]
Length=659

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI++LMSFYD+NIQ NK  NP N     +   QQ N Q      L  QG+
Sbjct  525  GLGIAEDGQKMISELMSFYDSNIQQNKNCNPGNLNDVDDCNQQQANFQFPMNDNLYGQGL  584

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L P  
Sbjct  585  DIGRNMNMSEQSPMPMLHPDFSSPEVQFDQLMAFDSPFGNNSNEDVDIRFGSPLHLSPVG  644

Query  396  Y  394
            Y
Sbjct  645  Y  645



>ref|XP_007146083.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
 gb|ESW18077.1| hypothetical protein PHAVU_006G011200g [Phaseolus vulgaris]
Length=619

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK-ISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG  568
            GL V EDGQ+MI+DLM+ Y+TN+QGNK IS+      A+   L+Q  +Q     F++ QG
Sbjct  476  GLEVSEDGQKMISDLMTNYETNVQGNKNISSCNRIMAAENSCLRQHGMQQPHDNFIRGQG  535

Query  567  I-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPF--MFGPPFNLPPS  400
            I + GNIF E N+S+   +F   + Q E+ KA+N+PF  +      F  MFG   +L   
Sbjct  536  ITMEGNIFDEPNMSNNHHIFAREEGQIERFKAMNAPFETNHNNNNNFNSMFGSFCDLASF  595

Query  399  DYSEGLLGV  373
            D+ E + G 
Sbjct  596  DFKEDMQGA  604



>ref|XP_002315400.1| EIN3-like family protein [Populus trichocarpa]
 gb|EEF01571.1| EIN3-like family protein [Populus trichocarpa]
Length=603

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 76/139 (55%), Gaps = 15/139 (11%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GL + EDGQ+ I+DLMSFYDTN+Q +K  NP ++        QQ   Q         QG 
Sbjct  476  GLRLSEDGQKTISDLMSFYDTNLQRDKNINPGSAN-------QQQKFQFQLDDSFYGQGA  528

Query  564  IPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLP-FMFGPPFNLPPSDY  394
            + G NI + +++    P+F+S + QF+  KA +S F+ +  + +  F FG PF  PP DY
Sbjct  529  MVGNNITEATSMPVNNPVFSSTENQFDHCKAFDSAFDTNVNDNITDFRFGSPFPSPPVDY  588

Query  393  SEGLLGVPPLPKKDILSWY  337
            S  L+      K+D+  WY
Sbjct  589  SMDLIQ-----KQDVGMWY  602



>ref|XP_010067064.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067065.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 ref|XP_010067066.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Eucalyptus 
grandis]
 gb|KCW65129.1| hypothetical protein EUGRSUZ_G02632 [Eucalyptus grandis]
Length=617

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 74/139 (53%), Gaps = 7/139 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+G+PEDGQ+ I++LMSFYD N+Q N  S  +   P+ EQ L   N+Q   G  L   G 
Sbjct  482  GIGLPEDGQKTISNLMSFYDVNLQQNSTSAGKLGAPSNEQQL--LNVQHSMGDSLFAHGA  539

Query  567  IIPGNIFQESNISSTRPMFTS-GDQFEQPKALNSPFNVSSIE-TLPFMFGPPFNLPPSDY  394
             + G   +E N+     +F S G Q +Q KA +SPF     + T+   FG PF++  +  
Sbjct  540  FMGGKTHEEINLPLNHSVFQSMGSQHDQSKAFDSPFEFCLNDGTVDSRFGSPFSVTAAAA  599

Query  393  SEGLLGVPPLPKKDILSWY  337
                + +  LPK+D   WY
Sbjct  600  DCNRMDL--LPKQDGFVWY  616



>ref|XP_009341360.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=659

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 68/121 (56%), Gaps = 4/121 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI++LMSFYD NIQ NK  NP N     ++  QQ N Q      L  QG 
Sbjct  525  GLGIAEDGQKMISELMSFYDGNIQQNKNCNPGNLNDVDDRNQQQANFQFPMNDNLYGQGP  584

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ ++S +    P F+S + QF+Q  A +SPF  +S E +   FG P +L P  
Sbjct  585  DIGHNMNMSEQSPMPMLHPDFSSPEIQFDQLMAFDSPFGNNSNEDVDIRFGSPLHLAPVG  644

Query  396  Y  394
            Y
Sbjct  645  Y  645



>ref|XP_003545483.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=610

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (54%), Gaps = 14/141 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N   A+   L Q ++Q  Q  F   QG 
Sbjct  478  GLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNCVTAENHNLSQASLQ-RQDSFFPGQGM  536

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVS-SIETLPFMFGPPFNLPPSDYS  391
            ++ GN+F               D+F+    +N+PF+ + +   +  MF  P +L   D+ 
Sbjct  537  VLEGNLFAREE--------GQFDRFKATMNMNTPFDTNHNNNNIHLMFNSPCDLSSFDFK  588

Query  390  EGL--LGVPPLPKKDILS-WY  337
            E +  +G+  L K+  +S WY
Sbjct  589  EDIQGVGMDSLQKQQEVSIWY  609



>gb|ADE41155.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=625

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 73/140 (52%), Gaps = 8/140 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGV EDGQ+MI+DLMSFYD+NIQ NK  NP N     ++  QQ N Q      L   G+
Sbjct  489  GLGVAEDGQKMISDLMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLFGHGV  548

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L    
Sbjct  549  DIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHLAHVG  608

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+     + P   +D   W+
Sbjct  609  YN----AMDPPVNQDASPWF  624



>ref|XP_008357657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=625

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 8/140 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGV EDGQ+MI++LMSFYD+NIQ NK  NP N     ++  QQ N Q      L   G+
Sbjct  489  GLGVAEDGQKMISELMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLFGHGV  548

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L    
Sbjct  549  DIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHLAHVG  608

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+     + P   +D   W+
Sbjct  609  YN----AMDPPVNQDASPWF  624



>gb|AGI41325.1| EIN3-like protein [Malus domestica]
Length=625

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 73/140 (52%), Gaps = 8/140 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGV EDGQ+MI++LMSFYD+NIQ NK  NP N     ++  QQ N Q      L   G+
Sbjct  489  GLGVAEDGQKMISELMSFYDSNIQQNKNCNPGNLNVIDDRNQQQANYQFPMNDNLFGHGV  548

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   N+ + S +    P F+S + QF+Q  A  SPF  +S E +   F  PF+L    
Sbjct  549  DIGRNMNMSEPSPMLMLHPGFSSPEVQFDQLMAFESPFGNNSSEDVDIRFDSPFHLAHVG  608

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+     + P   +D   W+
Sbjct  609  YN----AMDPPVNQDASPWF  624



>gb|EYU46131.1| hypothetical protein MIMGU_mgv1a003270mg [Erythranthe guttata]
Length=595

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 68/141 (48%), Gaps = 31/141 (22%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQRMINDLM  YD N   NK S      P+KE             G+++NQG 
Sbjct  481  GLGVPEDGQRMINDLMLCYDDNALTNKGS----IAPSKE-------------GYIRNQGM  523

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS-IETLPFMFGPPFNLPPSDYS  391
            ++  NIF++ N           DQ      +NS  N +   E    MF  PFN+   DY+
Sbjct  524  VLENNIFEDIN---------RFDQCNNRVVMNSTLNPNHPTENFQLMFNSPFNISNVDYT  574

Query  390  EGLLGVPP---LPKKDILSWY  337
            E   GV     + K+D+  WY
Sbjct  575  ESYAGVSRDNNMQKQDLGIWY  595



>gb|KHN38437.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=469

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 24/148 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N    +   L Q ++Q  Q  +   QG 
Sbjct  333  GLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVAVENHNLSQASLQ-QQESYFPGQGM  391

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKA-----LNSPF--NVSSIETLPFMFGPPFNL  409
            ++ GN F                QF++ KA      ++PF  N S+   +  MF  P +L
Sbjct  392  VLEGNFFAREE-----------GQFDRFKATMNMNTHTPFDTNHSNNNNIHLMFNSPCDL  440

Query  408  PPSDYSE---GLLGVPPLPKKDILS-WY  337
               D+ E   G +G+ PL K+  +S WY
Sbjct  441  SSFDFKEDIQGGVGMDPLHKQQEVSIWY  468



>ref|XP_008231880.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=622

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 21/152 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G G+ +DGQ+MI++LMSFYD+NI  NK SNP N    +    QQ   +         QG+
Sbjct  475  GFGLADDGQKMISELMSFYDSNIHPNKNSNPGNLNVVEGHNQQQAGFRFAMNDNFFGQGV  534

Query  564  IPGNIFQE---------SNISSTRPM------FTSGD-QFEQPKALNSPFNVSSIETLPF  433
              G    E          NIS T PM      F S + QF+Q    +SPF  +  +T+  
Sbjct  535  DMGRNMSEPNSMPVDMGCNISETTPMPMHRQAFPSAEVQFDQCTIFDSPFGDNPNDTVDL  594

Query  432  MFGPPFNLPPSDYSEGLLGVPPLPKKDILSWY  337
             F  P +L P+DY+     V   PK+D   W+
Sbjct  595  RFDSPLHLAPADYN-----VLDPPKQDASFWF  621



>gb|KGN46075.1| hypothetical protein Csa_6G051520 [Cucumis sativus]
Length=431

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 74/145 (51%), Gaps = 20/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSG----PAKEQPLQQT-NIQCHQGGFL  580
            GLG+PEDGQ+MI+DL+SFYD+N+Q +K   P NSG    P      QQ    Q      L
Sbjct  297  GLGLPEDGQKMISDLLSFYDSNLQQDK---PLNSGNLDMPDDHNQQQQLPKFQLQVDDNL  353

Query  579  QNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPFN  412
             +Q  + GN   I Q ++ SS +  F      E   A ++PF +   + +  F FG PFN
Sbjct  354  YSQAAMVGNTMPIQQHADFSSNKHPFD-----EYKAAFDTPFGMYPNDNISDFRFGSPFN  408

Query  411  LPPSDYSEGLLGVPPLPKKDILSWY  337
            L   DY+        LPK+D   WY
Sbjct  409  LASIDYA---AADTQLPKQDTPLWY  430



>ref|XP_003519487.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 [Glycine max]
Length=614

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 76/148 (51%), Gaps = 24/148 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N    +   L Q ++Q  Q  +   QG 
Sbjct  478  GLGVPEDGQKMISDLMTIYDTNVVGNKNLSSSNCVAVENHNLSQASLQ-QQESYFPGQGM  536

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKA-----LNSPF--NVSSIETLPFMFGPPFNL  409
            ++ GN F                QF++ KA      ++PF  N S+   +  MF  P +L
Sbjct  537  VLEGNFFAREE-----------GQFDRFKATMNMNTHTPFDTNHSNNNNIHLMFNSPCDL  585

Query  408  PPSDYSE---GLLGVPPLPKKDILS-WY  337
               D+ E   G +G+ PL K+  +S WY
Sbjct  586  SSFDFKEDIQGGVGMDPLHKQQEVSIWY  613



>gb|AHC70432.1| ethylene insensitive 3-like protein [Cucurbita pepo subsp. pepo]
Length=599

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 72/150 (48%), Gaps = 44/150 (29%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNK---ISNPRNSGPAKEQPLQQTNIQCHQGGFLQN  574
             LGVPEDGQ+ I++LMS Y+TNIQGNK   I+   N                      QN
Sbjct  479  SLGVPEDGQKHISELMSIYNTNIQGNKNNVITITEN----------------------QN  516

Query  573  QGI-IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFN-----VSSIETLPFMFGPPFN  412
            QGI I  N F+ S++SS+  MFT        + +NS F       ++      MFG PF+
Sbjct  517  QGIMIDANFFEGSSLSSSHQMFT--------RPMNSSFENNHQNNNNNNNFHLMFGSPFD  568

Query  411  LPPSDYSE----GLLGVPPLPK-KDILSWY  337
            L   DY E    G   +  LPK +DI  WY
Sbjct  569  LSTFDYKEEVHGGAAAIDTLPKHQDIPLWY  598



>gb|KHN26027.1| Protein ETHYLENE INSENSITIVE 3 [Glycine soja]
Length=614

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 8/140 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            GLGVPEDGQ+MI+DLM+ YDTN+ GNK  +  N   A+   L Q ++Q  Q  F   QG 
Sbjct  478  GLGVPEDGQKMISDLMTIYDTNVVGNKNLSSTNCVTAENHNLSQASLQ-RQDSFFPGQGM  536

Query  567  IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            ++ GN+F        R   T           ++  N ++I     MF  P +L   D+ E
Sbjct  537  VLEGNLFAREEGQFDRFKATMNMNMNMNTPFDTNHNNNNIH---LMFNSPCDLSSFDFKE  593

Query  387  GL--LGVPPLPKKDILS-WY  337
             +  +G+  L K+  +S WY
Sbjct  594  DIQGVGMDSLQKQQEVSIWY  613



>ref|XP_004140927.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004140928.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform 2 [Cucumis 
sativus]
Length=615

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 74/145 (51%), Gaps = 20/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSG----PAKEQPLQQT-NIQCHQGGFL  580
            GLG+PEDGQ+MI+DL+SFYD+N+Q +K   P NSG    P      QQ    Q      L
Sbjct  481  GLGLPEDGQKMISDLLSFYDSNLQQDK---PLNSGNLDMPDDHNQQQQLPKFQLQVDDNL  537

Query  579  QNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPFN  412
             +Q  + GN   I Q ++ SS +  F      E   A ++PF +   + +  F FG PFN
Sbjct  538  YSQAAMVGNTMPIQQHADFSSNKHPFD-----EYKAAFDTPFGMYPNDNISDFRFGSPFN  592

Query  411  LPPSDYSEGLLGVPPLPKKDILSWY  337
            L   DY+        LPK+D   WY
Sbjct  593  LASIDYAAADTQ---LPKQDTPLWY  614



>ref|XP_008456656.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 ref|XP_008456657.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
Length=615

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 14/142 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT--NIQCHQGGFLQNQ  571
            GLG+PEDGQ+MI+DL+SFYD+N+Q +K  N  N     +   QQ     Q      L  Q
Sbjct  481  GLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLDMQDDHNQQQQLPKFQLQVDDNLYCQ  540

Query  570  GIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPFNLPP  403
              + GN   I Q  + SS +  F      E   A +SPF +   + +  F FG PFNL  
Sbjct  541  ATMVGNTMPIQQHPDFSSNKHPFD-----EYKAAFDSPFGMYPNDNISDFRFGSPFNLAS  595

Query  402  SDYSEGLLGVPPLPKKDILSWY  337
             DY+        LPK+D   WY
Sbjct  596  IDYAAADTQ---LPKQDTPLWY  614



>ref|NP_001284429.1| ETHYLENE INSENSITIVE 3-like 1 protein [Cucumis melo]
 dbj|BAB64345.1| EIN3-like protein [Cucumis melo]
Length=615

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 70/142 (49%), Gaps = 14/142 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQT--NIQCHQGGFLQNQ  571
            GLG+PEDGQ+MI+DL+SFYD+N+Q +K  N  N     +   QQ     Q      L  Q
Sbjct  481  GLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLDMQDDHNQQQQLPKFQLQVDDNLYCQ  540

Query  570  GIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLP-FMFGPPFNLPP  403
              + GN   I Q  + SS +  F      E   A +SPF +   + +  F FG PFNL  
Sbjct  541  ATMVGNTMPIQQHPDFSSNKHPFD-----EYKAAFDSPFGMYPNDNISDFRFGSPFNLAS  595

Query  402  SDYSEGLLGVPPLPKKDILSWY  337
             DY+        LPK+D   WY
Sbjct  596  IDYAAADTQ---LPKQDTPLWY  614



>ref|XP_009759370.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana sylvestris]
Length=608

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            N G 
Sbjct  477  GLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILANQNMQQNQTVELPMDDNFNLGH  536

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +     QE++++      ++  Q++Q K   ++PF  +  +   + FG PFN+  SDYS 
Sbjct  537  MEAEA-QETSMTMNSAYTSTEFQYDQCKLPFDAPFTGNLNDITDYRFGSPFNMGGSDYS-  594

Query  387  GLLGVPPLPKKDILSWY  337
                +  L K+DI +WY
Sbjct  595  ----MDQLTKQDISTWY  607



>gb|AAP04001.1| EIL5 [Nicotiana tabacum]
Length=608

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            N G 
Sbjct  477  GLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILANQNMQQNQTVELPMDDNFNLGH  536

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +     QE++++      ++  Q++Q K   ++PF  +  +   + FG PFN+  SDYS 
Sbjct  537  MEAEA-QETSMTMNSAYTSTEFQYDQCKLPFDAPFTGNLNDITDYRFGSPFNMGGSDYS-  594

Query  387  GLLGVPPLPKKDILSWY  337
                +  L K+DI +WY
Sbjct  595  ----MDQLTKQDISTWY  607



>ref|XP_009355060.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009355061.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=606

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = -1

Query  729  EDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGIIPG--  556
            +DGQ+MI++LMSFYD+N+Q N+  NP N    + +  QQ+  Q         QG+  G  
Sbjct  475  DDGQKMISELMSFYDSNVQQNQNCNPGNLHIVENRNQQQSKYQFPMNDNFFGQGVDTGCN  534

Query  555  -NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL  382
             N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L P+DY+  +
Sbjct  535  INMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVNMRFDSPLHLAPADYN--V  592

Query  381  LGVPPLPKKDILSWY  337
            +  P  PK+D   W+
Sbjct  593  MDTP--PKQDAPPWF  605



>gb|AIS20827.1| EIL [Pyrus x bretschneideri]
Length=600

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 74/135 (55%), Gaps = 8/135 (6%)
 Frame = -1

Query  729  EDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGIIPG--  556
            +DGQ+MI++LMSFYD+N+Q N+  NP N    + +  QQ+  Q         QG+  G  
Sbjct  469  DDGQKMISELMSFYDSNVQQNQNCNPGNLHIVENRNQQQSKYQFPMNDNFFGQGVDTGCN  528

Query  555  -NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSEGL  382
             N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L P+DY+  +
Sbjct  529  INMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVNMRFDSPLHLAPADYN--V  586

Query  381  LGVPPLPKKDILSWY  337
            +  P  PK+D   W+
Sbjct  587  MDTP--PKQDAPPWF  599



>ref|XP_010243659.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Nelumbo nucifera]
Length=615

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 76/142 (54%), Gaps = 8/142 (6%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+ I +LMSFYD+N+Q NK  NP       +    Q  IQ  +  + +    
Sbjct  475  GLGLTEDGQKTIGELMSFYDSNLQRNKGPNPGGVVLGGQNSALQPKIQLEENIYGEGAS-  533

Query  564  IPGNIFQESNISSTRPMFTSGD-QFEQPKALNS-PFNVSSIE-TLPFMFGPPFNLPPSDY  394
            I GN+F+E+N+     MF   + QF+Q K  ++ P+  ++ + T  F FG  FN+P  D+
Sbjct  534  IGGNMFEENNMPMNHQMFHREEIQFDQCKVFDAPPYETNNGDLTSDFRFG-SFNIPSVDF  592

Query  393  SEGL---LGVPPLPKKDILSWY  337
             E L       PL K++   WY
Sbjct  593  GEDLPRGTVETPLSKQENSIWY  614



>ref|XP_009595535.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Nicotiana tomentosiformis]
Length=609

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 7/137 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            N G 
Sbjct  478  GLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILTNQNMQQNQTVELPMDDNFNLGH  537

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +     QE++++       +  Q++Q K   ++PF  +  +   + FG PFN+  SDYS 
Sbjct  538  LEAEA-QETSMTMNSAYPLTDFQYDQRKLPFDTPFAGNLNDITDYRFGSPFNMGGSDYS-  595

Query  387  GLLGVPPLPKKDILSWY  337
                +  L K+DI +WY
Sbjct  596  ----IDQLTKQDISTWY  608



>ref|XP_008346133.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
 ref|XP_008346139.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=606

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 4/117 (3%)
 Frame = -1

Query  729  EDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGIIPG--  556
            +DGQ+MI++LMSFYD+N+Q NK  NP N      +  QQ+  Q         QG+  G  
Sbjct  475  DDGQKMISELMSFYDSNVQQNKNCNPGNLHIVDNRNQQQSKYQLPMNDNFFGQGVDTGCN  534

Query  555  -NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYS  391
             N  + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L P+DY+
Sbjct  535  INXSEPAPMPMLHPGFASQEVQFDQCIAFDSPFGNNPIENVDMRFDSPLHLAPADYN  591



>gb|ACM89299.1| EIN3-like protein EIL1 [Eriobotrya japonica]
Length=558

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = -1

Query  729  EDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGIIPG--  556
            +DGQ+MI++LMSFYD+N+Q NK  NP N      +  QQ+  Q         QG+  G  
Sbjct  427  DDGQKMISELMSFYDSNVQQNKNYNPGNLHIVDNRNQQQSKYQFPMNDNFFGQGVDTGCN  486

Query  555  -NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDY  394
             N+ + + +    P F S + QF+Q  A +SPF  + IE +   F  P +L P+DY
Sbjct  487  INMSEPAPMPMLHPGFASPEVQFDQCIAFDSPFGNNPIENVDMRFDSPLHLAPADY  542



>gb|ADZ97022.2| EIL6, partial [Nicotiana tabacum]
Length=607

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 69/136 (51%), Gaps = 7/136 (5%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ            N G 
Sbjct  478  GLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILTNQNMQQNQTVELPMDDNFNLGH  537

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPKA-LNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +     QE++++       +  Q++Q K   ++PF  +  +   + FG PFN+  SDYS 
Sbjct  538  LEAEA-QETSMTMNSAYPLTDFQYDQRKLPFDTPFAGNLNDITDYRFGSPFNMGGSDYS-  595

Query  387  GLLGVPPLPKKDILSW  340
                +  L K+DI +W
Sbjct  596  ----IDQLTKQDISTW  607



>ref|XP_007141570.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
 gb|ESW13564.1| hypothetical protein PHAVU_008G207000g [Phaseolus vulgaris]
Length=611

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 19/144 (13%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQ----GGFLQ  577
            GLGVPEDGQ+MINDLM+ YDTN+ GN   +  N  PA+     QT +Q HQ      F  
Sbjct  478  GLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNNFVPAENHNFSQTILQQHQQDSRDSFFA  537

Query  576  NQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS-IETLPFMFGPPFNLPP  403
             QG++  GN F                QFE+ K +N   N+++  +T   MF P  +L  
Sbjct  538  GQGMVTEGNFFAREE-----------GQFERFKTMNMNMNMNAPFDTNHMMFNPQCDLSS  586

Query  402  SDYSEGL-LGVPPLPKKDILS-WY  337
             D  +   +G+ P+ K+  +S W+
Sbjct  587  FDLKDIQGVGMDPVHKQQEVSIWF  610



>gb|AAK67355.1|AF387795_1 transcription factor [Cucumis melo]
Length=621

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 78/135 (58%), Gaps = 16/135 (12%)
 Frame = -1

Query  732  PEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQP---LQQTNIQCHQGGFLQNQGI  565
            PEDGQ++I++L+  YDTNIQGNK + N  NS   + Q    ++++N+  ++    ++QG+
Sbjct  480  PEDGQKLISELI--YDTNIQGNKNNLNTGNSATTENQKSPSIKRSNL--NKMIDFRDQGL  535

Query  564  I-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPFN------VSSIETLPFMFGPPFNL  409
            +  GN F  SN+SS+  MFT  + Q ++ K +NSPF        ++      MF  PF+L
Sbjct  536  MMEGNFFDGSNVSSSHQMFTRDEGQSDRFKPMNSPFENNHHHHNNNNNNFHLMFSSPFDL  595

Query  408  PPSDYSEGLLGVPPL  364
               DY E + GV  +
Sbjct  596  STFDYKEEVPGVAAI  610



>gb|EYU35998.1| hypothetical protein MIMGU_mgv1a003505mg [Erythranthe guttata]
Length=581

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 58/137 (42%), Gaps = 44/137 (32%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQRMINDLMSFYD+N+                                  QGI
Sbjct  488  GLGVPEDGQRMINDLMSFYDSNV----------------------------------QGI  513

Query  564  IPGNIFQESNISSTRPMFTSGDQFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPPSDYSE  388
            +       +N +        G  F+  K A ++PFN    E  P MF  PF++P  D   
Sbjct  514  VFEENNNNNNSNMHNSGSIFGGPFDHRKAAADAPFNAGPAENFPLMFSSPFDMPSMDN--  571

Query  387  GLLGVPPLPKKDILSWY  337
                   LPK+D+  W+
Sbjct  572  -------LPKQDVSIWF  581



>gb|AGV54673.1| ethylene insensitive protein 3 [Phaseolus vulgaris]
Length=609

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 73/144 (51%), Gaps = 20/144 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS-GPAKEQPLQQTNIQCHQ----GGFL  580
            GLGVPEDGQ+MINDLM+ YDTN+ GN   +  ++  PA+     QT +Q HQ      F 
Sbjct  477  GLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFVPAENHNFSQTILQQHQQDSRDSFF  536

Query  579  QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP  403
              QG++  GN F                QFE+ K +N   N +  +T   MF P  +L  
Sbjct  537  AGQGMVTEGNFFAREE-----------GQFERFKTMNMNMN-APFDTNHMMFNPQCDLSS  584

Query  402  SDYSEGL-LGVPPLPKKDILS-WY  337
             D  +   +G+ P+ K+  +S W+
Sbjct  585  FDLKDIQGVGMDPVHKQQEVSIWF  608



>gb|AGV54306.1| transcription factor EIL1 [Phaseolus vulgaris]
Length=610

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 21/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNS-GPAKEQPLQQTNIQCHQ-----GGF  583
            GLGVPEDGQ+MINDLM+ YDTN+ GN   +  ++  PA+     QT +Q HQ       F
Sbjct  477  GLGVPEDGQKMINDLMTVYDTNVVGNNNLSSNSNFVPAENHNFSQTILQQHQQDSRDSNF  536

Query  582  LQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLP  406
               QG++  GN F                QFE+ K +N   N +  +T   MF P  +L 
Sbjct  537  FAGQGMVTEGNFFAREE-----------GQFERFKTMNMNMN-APFDTNHMMFNPQCDLS  584

Query  405  PSDYSEGL-LGVPPLPKKDILS-WY  337
              D  +   +G+ P+ K+  +S W+
Sbjct  585  SFDLKDIQGVGMDPVHKQQEVSIWF  609



>gb|ADE41154.1| ethylene insensitive 3 class transcription factor [Malus domestica]
Length=611

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 10/140 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ ++GQ+  ++LMSFYD+NIQ NK  NP N      +  QQ+  Q         QG+
Sbjct  477  GLGLVDNGQK--SELMSFYDSNIQQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFFGQGM  534

Query  564  IPGNIFQESNIS---STRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G     S ++      P F S + QF+Q  A +SPF  ++ E +   F  P +L P+D
Sbjct  535  DVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESPLHLAPAD  594

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+  ++  P  PK+D   W+
Sbjct  595  YN--VMDQP--PKQDASLWF  610



>emb|CDP16004.1| unnamed protein product [Coffea canephora]
Length=608

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 10/140 (7%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-QGGFLQNQGI  565
            LG+PEDGQ+MI+ LMS YD ++Q     +      A++Q LQQ  IQ H    F +    
Sbjct  473  LGIPEDGQKMISGLMSMYDDSVQEKTCFDFGIDTAAEDQNLQQQIIQLHGDQSFFRPGVT  532

Query  564  IPGNIFQESNISSTRPMFTSG----DQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
            + G+I +E++++ +   F S     D        +S FN +    L F FGP FN+   D
Sbjct  533  MGGSISKETSLTLSHSAFPSTEFLYDNGNCKSTDDSGFNGNLNSNLDFSFGPEFNMESVD  592

Query  396  YSEGLLGVPPLPKKDILSWY  337
            YS  L      PK+DI +WY
Sbjct  593  YSMDL-----FPKEDITTWY  607



>gb|AGI41324.1| EIN3-like protein [Malus domestica]
Length=611

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 72/140 (51%), Gaps = 10/140 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ ++GQ+  ++LMSFYD+NI  NK  NP N      +  QQ+  Q         QG+
Sbjct  477  GLGLVDNGQK--SELMSFYDSNIHQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFFGQGM  534

Query  564  IPGNIFQESNIS---STRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G     S ++      P F S + QF+Q  A +SPF  ++ E +   F  P +L P+D
Sbjct  535  DVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESPLHLAPAD  594

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+  ++  P  PK+D   W+
Sbjct  595  YN--VMDQP--PKQDASLWF  610



>gb|ACD87815.1| putative ethylene insensitive transcription factor [Vicia faba]
Length=638

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 74/157 (47%), Gaps = 32/157 (20%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQG--------  589
            GLGV ED Q+MI+DLMS YDTNI GNK ++  N      Q L Q NIQ  Q         
Sbjct  492  GLGVSEDSQKMISDLMSVYDTNIIGNKNASSTNCATVGNQNLSQHNIQQQQQHTIQQQQQ  551

Query  588  -GFLQNQGII--PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS---IETLPFMF  427
              F  +QG++    N F                QF++ KA+ +PF  +       L FM 
Sbjct  552  ENFFSSQGMVMEAANFFTREE-----------SQFDRFKAVTTPFETNHPNNNNNLHFMI  600

Query  426  GPPFNLPPSDYSE------GLLGVPPLPKK-DILSWY  337
            G P +L   D+ E      G++G+  L K+ D  +WY
Sbjct  601  GSPCDLASFDFREDIQQLQGVVGMENLHKQPDGPTWY  637



>ref|NP_001234546.1| EIL3 protein [Solanum lycopersicum]
 gb|AAK58859.1|AF328786_1 EIL3 [Solanum lycopersicum]
Length=601

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 14/139 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPL-QQTNIQCHQGGFLQNQG  568
            GLG+PED QR+I+DL++ YD N Q N       S     Q L QQ  ++      L   G
Sbjct  473  GLGLPEDDQRIISDLITSYDNNFQQNGSICSGISEILVNQSLPQQQTVE------LPMDG  526

Query  567  IIPGNIFQESNISSTRPMFTSGD-QFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPPSDY  394
             I     + S   ++ P++ S + Q++Q K + ++PF  +  +   + FG PFNL  SDY
Sbjct  527  NINLGHMETSAQETSMPVYRSTEFQYDQCKMSFDAPFGGNINDITDYRFGSPFNLGGSDY  586

Query  393  SEGLLGVPPLPKKDILSWY  337
            +     V  L K+DI +WY
Sbjct  587  A-----VEQLTKQDISTWY  600



>ref|XP_008231879.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Prunus mume]
Length=601

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q         QG+
Sbjct  472  GLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNFYGQGL  531

Query  564  IPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  463
            + G N+ + +++    P+F   + QF+  K  +SP+
Sbjct  532  VIGRNMSEPTSLPMLHPVFPPTEIQFDPCKLFDSPY  567



>ref|XP_008364747.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Malus domestica]
Length=611

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 72/140 (51%), Gaps = 10/140 (7%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ ++GQ+  ++LMSFYD+NI  NK  NP N      +  QQ+  Q         QG+
Sbjct  477  GLGLVDNGQK--SELMSFYDSNIXQNKNCNPANLHIVDNRNQQQSKYQFPMNDNFFGQGM  534

Query  564  IPGNIFQESNIS---STRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G     S ++      P F S + QF+Q  A +SPF  ++ E +   F  P +L P+D
Sbjct  535  DVGRNINMSELAPMPMLHPGFASPEVQFDQCLAFDSPFGNNTNENVDIRFESPLHLAPAD  594

Query  396  YSEGLLGVPPLPKKDILSWY  337
            Y+  ++  P  PK+D   W+
Sbjct  595  YN--VMDQP--PKQDASLWF  610



>ref|XP_009355361.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=627

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 64/121 (53%), Gaps = 4/121 (3%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDG++MI++LMSFYD+NIQ N   NP N     ++  QQ N Q         QG+
Sbjct  491  GLGIAEDGKKMISELMSFYDSNIQQNNNCNPGNLNVIDDRNQQQANYQFPVNDTFFGQGV  550

Query  564  IPG---NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSD  397
              G   NI + S +    P F+S + QF+Q  A  SP   +  E +   F  PF+L P  
Sbjct  551  DIGRNMNISEPSPMLMLHPGFSSPEVQFDQLMAFESPVGNNYSEDVDIRFDSPFHLAPVG  610

Query  396  Y  394
            Y
Sbjct  611  Y  611



>emb|CDY06379.1| BnaC05g31510D [Brassica napus]
Length=487

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 77/159 (48%), Gaps = 28/159 (18%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ QG 
Sbjct  334  GIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVTESQLLQPTVQNHQ-EHLQFQGN  388

Query  567  IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPF----NVSSIETLPFMF-  427
            ++ G+ F++ NI       MF       SG +++     N+ F    N +S      +F 
Sbjct  389  MVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDTAHTNNNNFEAAHNNASSNRFQLVFD  448

Query  426  GPPFNLPPSDYSEGLL---------GVPPLPKKDILSWY  337
             PPF++   DY + +          G+    ++D+  W+
Sbjct  449  SPPFDMASFDYRDDMSMPGVVGTMDGMQQQKQQDVSIWF  487



>ref|XP_007220648.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
 gb|EMJ21847.1| hypothetical protein PRUPE_ppa003493mg [Prunus persica]
Length=570

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q         QG+
Sbjct  441  GLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNFYGQGL  500

Query  564  IPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  463
            + G N+ + +++     +F S + QF+  K  +SP+
Sbjct  501  VIGRNMSEPTSLPMLHSVFPSTEIQFDPCKLFDSPY  536



>gb|ABK35086.1| EIL2 [Prunus persica]
Length=601

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ EDGQ+MI+ LMSFYD+N+Q NK SNP N    ++   QQ   Q         QG+
Sbjct  472  GLGLAEDGQKMISQLMSFYDSNVQQNKNSNPGNLNVVEDHNQQQVKFQFPMEDNFYGQGL  531

Query  564  IPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPF  463
            + G N+ + +++     +F S + QF+  K  +SP+
Sbjct  532  VIGRNMSEPTSLPMLHSVFPSTEIQFDPCKLFDSPY  567



>gb|AAL76272.1|AF467784_1 transcription factor EIL1 [Vigna radiata]
Length=609

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 63/127 (50%), Gaps = 24/127 (19%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNI-----QCHQGGFL  580
            GLGVPEDGQ+MINDLM+ YDTNI GN   +  N   A+ Q   QT +        +  + 
Sbjct  478  GLGVPEDGQKMINDLMTIYDTNIIGNNNLSSNNFVAAENQNFSQTMLQQQQQDSRRDNYF  537

Query  579  QNQGIIP-GNIFQESNISSTRPMFTSGDQFEQPKA--LNSPFNVSSIETLPFMFGPPFNL  409
              QG++  GN F                QFE+ KA  +N+PF+ + +     +F P  +L
Sbjct  538  TGQGMMTEGNFFAREE-----------GQFERFKAMNMNAPFDTNHM-----LFSPQCDL  581

Query  408  PPSDYSE  388
               D+ +
Sbjct  582  SSFDFKD  588



>dbj|BAI44821.1| ethylene insensitive 3-like [Daucus carota]
Length=619

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 71/124 (57%), Gaps = 9/124 (7%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKISNPR----NSGPAKEQPLQQTNIQCHQGGFLQN  574
            +G+P+DG++MI++LMSFYD NI  N+  N      N     +  +QQ   Q     F   
Sbjct  475  VGLPDDGEKMISELMSFYDNNIHQNQNQNLNMNSGNLNILGDHNMQQQKFQLDDNFF--G  532

Query  573  QGIIPG-NIFQESNISSTRPMFTSGD-QFEQPKALNSPFNVSSIET-LPFMFGPPFNLPP  403
            QGI+ G NI Q ++I   +P++ S D QF Q KA +S F+ +S    L F +G PFNL  
Sbjct  533  QGIVMGDNISQGTSIPLNQPVYPSTDFQFGQCKAYDSVFDANSNGNPLDFQYGSPFNLGT  592

Query  402  SDYS  391
            +DY+
Sbjct  593  ADYT  596



>ref|XP_010544313.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=615

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 74/144 (51%), Gaps = 12/144 (8%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTN-IQCHQGGFLQNQG  568
            G GVPEDGQ+MI +LMS YD N QGN+ ++   +     QP  + + +Q H   F  ++G
Sbjct  476  GFGVPEDGQKMITELMSMYDRNFQGNQATSMVENQSLNLQPKARNDELQQH---FNHSEG  532

Query  567  -IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMF-GPPFNLPPSDY  394
              I GN  ++  I +      +G QF  P++ +S  N S+      +F   PF+L   DY
Sbjct  533  SSIEGNFLEDLPIKNMFSQGNNGIQFPNPQS-DSAHNNSNNGGFQIVFDSTPFDLASFDY  591

Query  393  SE-----GLLGVPPLPKKDILSWY  337
             +     G+ G P   ++D+  W+
Sbjct  592  RDDLQAVGMDGTPEQQQQDVSIWF  615



>emb|CBI29154.3| unnamed protein product [Vitis vinifera]
Length=148

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN  646
            GLG+PEDGQ+MI+DLMSFYDTN+Q NK  NP N
Sbjct  109  GLGLPEDGQKMISDLMSFYDTNLQRNKSLNPGN  141



>emb|CDY19606.1| BnaA05g20140D [Brassica napus]
Length=460

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 19/135 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ QG 
Sbjct  308  GIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQFQGN  362

Query  567  IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPFNVS----SIETLPFMF-  427
            ++ G+ F++ NI       MF       SG +++     N+ F  +    S      +F 
Sbjct  363  MVEGSFFEDLNIPNRVNHQMFFQGNNNNSGFKYDAAHTNNNNFEAAHNNGSSNRFQLVFD  422

Query  426  GPPFNLPPSDYSEGL  382
             PPF++   DY + +
Sbjct  423  SPPFDMASFDYRDDM  437



>ref|XP_009145590.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Brassica 
rapa]
Length=614

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 68/136 (50%), Gaps = 20/136 (15%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ QG 
Sbjct  461  GIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQFQGN  515

Query  567  IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALN-----SPFNVSSIETLPFMF  427
            ++ G+ F++ NI       MF       SG +++     N     +  N SS      +F
Sbjct  516  MVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTNNNNNFEAAHNNSSSNRFQLVF  575

Query  426  -GPPFNLPPSDYSEGL  382
              PPF++   DY + +
Sbjct  576  DSPPFDMASFDYRDDM  591



>ref|XP_009145591.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Brassica 
rapa]
Length=613

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 19/135 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+GVPEDGQ+MI++LMS YD N+Q    SN   +    E  L Q  +Q HQ   LQ QG 
Sbjct  461  GIGVPEDGQKMISELMSMYDRNVQ----SNQNQTSMVMETQLLQPTVQNHQ-EHLQFQGN  515

Query  567  IIPGNIFQESNI--SSTRPMF------TSGDQFEQPKALNSPFNVS----SIETLPFMF-  427
            ++ G+ F++ NI       MF       SG +++     N+ F  +    S      +F 
Sbjct  516  MVEGSFFEDLNIPNRVNNQMFFQGNNNNSGFKYDAAHTNNNNFEAAHNNGSSNRFQLVFD  575

Query  426  GPPFNLPPSDYSEGL  382
             PPF++   DY + +
Sbjct  576  SPPFDMASFDYRDDM  590



>ref|XP_011091876.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Sesamum indicum]
Length=580

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 71/145 (49%), Gaps = 20/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRN----SGPAKEQP---LQQTNIQCHQGG  586
            GLG+PEDGQ++I++LMS Y+ N Q     +  N     G  ++QP   LQQ +    QG 
Sbjct  446  GLGIPEDGQKVISELMSSYNGNNQHGNTFHSENFHILEGQNQQQPAAYLQQNDDDSKQGA  505

Query  585  FLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPK-ALNSPFNVSSIETLP-FMFGPPFN  412
               +QGI  G     S+   +   F    Q++Q K + NS F  +  + +  F FG P N
Sbjct  506  --SSQGIFQGTSVPLSSSVFSSSAF----QYDQCKSSCNSSFTSNVSDNISDFRFGSPLN  559

Query  411  LPPSDYSEGLLGVPPLPKKDILSWY  337
                DY      V PLPK ++  WY
Sbjct  560  STQLDY-----FVDPLPKHEVSLWY  579



>gb|ACJ85584.1| unknown [Medicago truncatula]
 gb|AFK35026.1| unknown [Medicago truncatula]
Length=615

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 69/145 (48%), Gaps = 21/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGFLQNQG  568
            G GV EDGQ+MI+DLMS YDT++ GN  ++  N    + Q L      Q  Q  F  NQG
Sbjct  480  GFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNCVVIENQNLSQPIIQQQQQDNFFLNQG  539

Query  567  -IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPF--MFGPPFNLPPSD  397
             ++  N F               +QF++ KA+NSPF  +         M+G   +L   D
Sbjct  540  MVMEANFFTREE-----------NQFDRFKAMNSPFEANLNNNNNMHPMYGSSCDLASFD  588

Query  396  YSEGL-----LGVPPLPKK-DILSW  340
            + E L     +G+  L K+ D+  W
Sbjct  589  FKEDLQLQGGVGMDALYKQPDVSIW  613



>ref|XP_003617086.1| Ethylene insensitive 3-like protein [Medicago truncatula]
 gb|AET00045.1| ethylene insensitive transcription factor [Medicago truncatula]
Length=615

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 69/145 (48%), Gaps = 21/145 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQ-QTNIQCHQGGFLQNQG  568
            G GV EDGQ+MI+DLMS YDT++ GN  ++  N    + Q L      Q  Q  F  NQG
Sbjct  480  GFGVSEDGQKMISDLMSGYDTHVIGNNNASSTNCVVIENQNLSQPIIQQQQQDNFFLNQG  539

Query  567  -IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPF--MFGPPFNLPPSD  397
             ++  N F               +QF++ KA+NSPF  +         M+G   +L   D
Sbjct  540  MVMEANFFTREE-----------NQFDRFKAMNSPFEANLNNNNNMHPMYGSSCDLASFD  588

Query  396  YSEGL-----LGVPPLPKK-DILSW  340
            + E L     +G+  L K+ D+  W
Sbjct  589  FKEDLQLQGGVGMDALYKQPDVSIW  613



>ref|XP_004306440.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Fragaria vesca 
subsp. vesca]
Length=604

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 70/147 (48%), Gaps = 21/147 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ +DGQ+MI++LMS YD N +  + SNP N    ++   QQ N Q   G    +QG+
Sbjct  467  GLGLADDGQKMISELMSSYDGNTR--QTSNPGNFSVVQDPNHQQVNYQFEVGDNFYSQGM  524

Query  564  IPGNIFQESNISSTRPMFTSGD-------QFEQPKALNSPFNVSS---IETLPFMFGPPF  415
                +   SN+    PM            QF+Q K  +S F  +S   I  L F  G  F
Sbjct  525  ----VMDRSNVPEPAPMPMHQQVLPSPEVQFDQCKVFDSSFGNNSNDAIADLRFGTGSQF  580

Query  414  NLPPSDYSEGLLGVPPLPKKDILS-WY  337
            +L   DY+ G      L K+D  S WY
Sbjct  581  SLAHLDYTAG----NSLLKQDASSIWY  603



>ref|XP_010544311.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
 ref|XP_010544312.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Tarenaya hassleriana]
Length=632

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (52%), Gaps = 26/159 (16%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLGVPEDGQ+MI +LM  YD N+Q N+ S+   +     QP  Q + + +Q G  ++  +
Sbjct  477  GLGVPEDGQKMITELMDMYDRNVQNNQASSMVENESMMLQPKAQNHQEQNQFGN-RDGNM  535

Query  564  IPGNIFQESNI-------SSTRPMFTSGDQFEQPKALNSPF---------NVSSIETLPF  433
            + G+ F++ N        +S+  M+  G+   + K ++SPF         N SS   L F
Sbjct  536  VEGSFFEDLNFPNSCNNNNSSSQMYMQGNS--EFKFMSSPFAATQNSDDNNGSSNSPLEF  593

Query  432  MF-GPPFNLPPSD-----YSEGLLGVPP-LPKKDILSWY  337
            +F   PF+L   D      + G+ G+PP   ++D+  W+
Sbjct  594  VFDSTPFDLASFDDRNDMQAVGMEGMPPKRQERDVSIWF  632



>ref|XP_009339245.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339246.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339249.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
 ref|XP_009339251.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Pyrus x bretschneideri]
Length=611

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+ ++GQ+  ++LMSFYD+NIQ NK  NP N      +  QQ+  Q         QG+
Sbjct  477  GLGLVDNGQK--SELMSFYDSNIQQNKNCNPANLHIVDNRNSQQSKYQFPMNDNFFGQGV  534

Query  564  IPGNIFQESNISSTRPM------FTSGD-QFEQPKALNSPFNVSSIETLPFMFGPPFNLP  406
               ++ +  N+S   PM      F S + QF+Q  A + PF  ++ E +   F  P +L 
Sbjct  535  ---DVGRNINMSELAPMPMLHPGFASPEVQFDQCMAFDPPFGNNTNENVDIRFESPLHLA  591

Query  405  PSDY  394
            P DY
Sbjct  592  PVDY  595



>ref|XP_010509301.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X1 [Camelina 
sativa]
 ref|XP_010509308.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X2 [Camelina 
sativa]
 ref|XP_010509316.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X3 [Camelina 
sativa]
Length=629

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQ+MI++LMS YD N+Q N+ S    S   +  PL Q  IQ HQ        +
Sbjct  469  GIGVPEDGQKMISELMSMYDRNVQSNQTSMVMES---QSVPLLQPTIQNHQEHLQFPGNM  525

Query  564  IPGNIFQE  541
            + G+ F++
Sbjct  526  VEGSFFED  533



>ref|XP_010509323.1| PREDICTED: protein ETHYLENE INSENSITIVE 3 isoform X4 [Camelina 
sativa]
Length=630

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            G+GVPEDGQ+MI++LMS YD N+Q N+ S    S   +  PL Q  IQ HQ        +
Sbjct  470  GIGVPEDGQKMISELMSMYDRNVQSNQTSMVMES---QSVPLLQPTIQNHQEHLQFPGNM  526

Query  564  IPGNIFQE  541
            + G+ F++
Sbjct  527  VEGSFFED  534



>ref|XP_009417872.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417873.1| PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein [Musa acuminata 
subsp. malaccensis]
Length=622

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 15/140 (11%)
 Frame = -1

Query  741  LGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGII  562
            LG+P DGQR I++LMS YD N+  NK  N R  G ++ +   Q   +     F Q    I
Sbjct  492  LGIPSDGQRSIDELMSLYDKNLNANKSFNSRGIGMSEGRTPLQPRTRVEDNFFPQGTKAI  551

Query  561  PGNIFQESNISSTRPMFTSGDQFEQPKALNSPF-----NVSSIETLPFMFGPPFNLPPSD  397
             G + + SN+   +  F   +          PF     N S   +    +G  F++P  D
Sbjct  552  GGMLEEVSNLVQQQQQFPVRENV-------MPFQQQFGNPSDEMSGDLCYGSAFSMPSMD  604

Query  396  YSEGLLGVPPLPKKDILSWY  337
            YS+ L     L K +  +W+
Sbjct  605  YSDAL---HRLQKAEAANWF  621



>ref|XP_006347695.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Solanum tuberosum]
Length=604

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 20/142 (14%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQGI  565
            GLG+PED QR+I+DL++ YD N Q N       SG      + +  +  +       +  
Sbjct  476  GLGLPEDDQRIISDLITSYDNNFQQN---GSICSG------ISEILVNQNLQQQQTVELP  526

Query  564  IPGNI----FQESNISSTRPMFTSGD-QFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPP  403
            + GN      + S   ++ P + S + Q++Q K + ++PF  +  +   + FG PFNL  
Sbjct  527  MDGNFNLGHMETSAQETSMPAYRSTEFQYDQCKMSFDAPFGGNINDITDYRFGSPFNLGG  586

Query  402  SDYSEGLLGVPPLPKKDILSWY  337
            SDY+     +  L K+DI +WY
Sbjct  587  SDYA-----MEQLTKQDISTWY  603



>ref|XP_009135708.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
 ref|XP_009135709.1| PREDICTED: protein ETHYLENE INSENSITIVE 3-like [Brassica rapa]
Length=581

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 15/128 (12%)
 Frame = -1

Query  744  GLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQNQG-  568
            G+GVPEDGQ+MI++LMS YD N+  N+ S    +       L Q  +Q HQ   LQ QG 
Sbjct  439  GIGVPEDGQKMISELMSMYDRNVHSNQTSMVMENQSVS---LLQPTVQNHQ-EHLQFQGN  494

Query  567  IIPGNIFQESNI-----SSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMF-GPPFNLP  406
            ++  + F++ NI     +S +  F    Q     +  +  N  S      +F  PPF++ 
Sbjct  495  VVESSFFEDLNIPNRANNSNQTFF----QGSNSNSFEAAVNNGSSNRFQLVFDSPPFDMA  550

Query  405  PSDYSEGL  382
              DY + +
Sbjct  551  SFDYRDDM  558



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420