BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF003A13

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    480   3e-169   Cucumis melo [Oriental melon]
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    480   4e-169   Cucumis sativus [cucumbers]
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    476   3e-167   Sesamum indicum [beniseed]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    474   6e-167   Carya cathayensis
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    474   1e-166   Nicotiana tomentosiformis
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    473   1e-166   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    473   1e-166   
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    473   2e-166   
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    473   3e-166   Solanum tuberosum [potatoes]
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    472   5e-166   Nicotiana sylvestris
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    472   5e-166   Nicotiana sylvestris
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    472   7e-166   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    471   9e-166   Phoenix dactylifera
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    471   9e-166   Cucumis sativus [cucumbers]
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    471   1e-165   Nicotiana sylvestris
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    471   1e-165   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    471   1e-165   Nicotiana sylvestris
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    471   1e-165   Nicotiana sylvestris
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    471   1e-165   Nelumbo nucifera [Indian lotus]
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    471   2e-165   Nicotiana tomentosiformis
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    471   2e-165   Nicotiana tomentosiformis
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    471   2e-165   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    470   2e-165   Nicotiana tomentosiformis
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    470   3e-165   Setaria italica
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    470   3e-165   Elaeis guineensis
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    470   3e-165   Nicotiana tomentosiformis
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    470   3e-165   Nelumbo nucifera [Indian lotus]
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    470   3e-165   Nicotiana sylvestris
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    470   4e-165   Nicotiana tabacum [American tobacco]
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    469   6e-165   Solanum tuberosum [potatoes]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    469   7e-165   Prunus mume [ume]
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    469   7e-165   Solanum lycopersicum
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    469   7e-165   Nicotiana sylvestris
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    469   7e-165   Nicotiana sylvestris
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    469   7e-165   Zea mays [maize]
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    469   8e-165   Solanum lycopersicum
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    469   9e-165   Nicotiana tomentosiformis
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        469   9e-165   Panicum virgatum
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    469   1e-164   Phoenix dactylifera
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    469   1e-164   Solanum tuberosum [potatoes]
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    469   1e-164   Nicotiana sylvestris
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    468   1e-164   Sesamum indicum [beniseed]
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    468   1e-164   Nicotiana tomentosiformis
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    468   2e-164   Nicotiana tomentosiformis
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    468   2e-164   
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    468   2e-164   Nicotiana sylvestris
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    468   2e-164   Sedum alfredii
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    468   3e-164   
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    468   3e-164   Setaria italica
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    468   3e-164   Nicotiana sylvestris
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    468   3e-164   Solanum tuberosum [potatoes]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    468   3e-164   Nelumbo nucifera [Indian lotus]
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    468   3e-164   Sesamum indicum [beniseed]
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    468   3e-164   Cucumis melo [Oriental melon]
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    467   5e-164   Nicotiana tomentosiformis
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    467   5e-164   Musa acuminata subsp. malaccensis [pisang utan]
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    467   5e-164   Petunia sp.
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    467   6e-164   Nicotiana tomentosiformis
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    467   6e-164   Kalanchoe fedtschenkoi [lavender-scallops]
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    466   9e-164   Nicotiana tabacum [American tobacco]
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    466   9e-164   Solanum tuberosum [potatoes]
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    466   9e-164   Elaeis guineensis
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    466   9e-164   Nicotiana sylvestris
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    466   1e-163   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    466   1e-163   Petunia sp.
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    466   1e-163   Populus euphratica
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    466   1e-163   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             466   1e-163   Prunus persica
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  466   1e-163   Solanum lycopersicum
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    466   1e-163   Nicotiana tabacum [American tobacco]
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    466   2e-163   Brachypodium distachyon [annual false brome]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    466   2e-163   Prunus mume [ume]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             466   2e-163   Prunus persica
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    466   2e-163   Solanum tuberosum [potatoes]
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    466   2e-163   Elaeis guineensis
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    465   2e-163   Cicer arietinum [garbanzo]
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    465   2e-163   Nicotiana sylvestris
gb|AAC25775.1|  chlorophyll a/b binding protein                         465   3e-163   Medicago sativa [alfalfa]
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          465   3e-163   Sorghum bicolor [broomcorn]
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 465   4e-163   Solanum tuberosum [potatoes]
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          464   4e-163   Sorghum bicolor [broomcorn]
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          464   4e-163   Ricinus communis
gb|AFK40061.1|  unknown                                                 464   5e-163   Medicago truncatula
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          464   5e-163   Spinacia oleracea
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  464   6e-163   Populus trichocarpa [western balsam poplar]
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                464   6e-163   Erythranthe guttata [common monkey flower]
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         464   7e-163   Jatropha curcas
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    464   9e-163   Setaria italica
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             464   1e-162   Hevea brasiliensis [jebe]
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    464   1e-162   Phoenix dactylifera
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    464   1e-162   Eucalyptus grandis [rose gum]
gb|AGJ50622.1|  chlorophyll a/b binding protein                         464   1e-162   Salicornia brachiata
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    463   1e-162   Populus euphratica
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    464   1e-162   Spinacia oleracea
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           463   1e-162   Solanum tuberosum [potatoes]
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          463   1e-162   Sorghum bicolor [broomcorn]
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                466   2e-162   Erythranthe guttata [common monkey flower]
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    463   2e-162   
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    463   2e-162   Fragaria vesca subsp. vesca
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    463   2e-162   Populus euphratica
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    463   2e-162   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    463   2e-162   Cucumis melo [Oriental melon]
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    463   2e-162   Petunia sp.
ref|NP_001142284.1|  uncharacterized protein LOC100274453               463   2e-162   Zea mays [maize]
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      463   2e-162   Lemna gibba
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          463   2e-162   Ricinus communis
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         463   2e-162   Musa balbisiana [starchy banana]
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    462   2e-162   Brachypodium distachyon [annual false brome]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    462   3e-162   Cucumis sativus [cucumbers]
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  462   3e-162   Populus trichocarpa [western balsam poplar]
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    462   3e-162   Spinacia oleracea
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    462   3e-162   Malus domestica [apple tree]
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    465   3e-162   
gb|AAR10886.1|  chlorophyll a/b binding protein                         462   4e-162   Trifolium pratense [peavine clover]
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    462   4e-162   Vitis vinifera
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    462   5e-162   Fragaria vesca subsp. vesca
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    462   5e-162   Citrus sinensis [apfelsine]
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    462   5e-162   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                462   5e-162   Erythranthe guttata [common monkey flower]
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    462   5e-162   Solanum tuberosum [potatoes]
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    461   5e-162   Oxytropis campestris subsp. johannensis
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                462   6e-162   Erythranthe guttata [common monkey flower]
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                462   6e-162   Erythranthe guttata [common monkey flower]
gb|ACN31249.1|  unknown                                                 460   6e-162   Zea mays [maize]
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             462   6e-162   
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             461   8e-162   Prunus persica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             461   9e-162   Prunus persica
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    461   9e-162   Eucalyptus grandis [rose gum]
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    461   9e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    461   1e-161   Fragaria vesca subsp. vesca
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             461   1e-161   Prunus persica
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    460   1e-161   Oxytropis arctobia
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    461   1e-161   Glycine max [soybeans]
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     462   1e-161   Homo sapiens [man]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  461   1e-161   Populus trichocarpa [western balsam poplar]
gb|AAB61237.1|  chlorophyll a/b-binding protein                         461   1e-161   Mesembryanthemum crystallinum
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    461   2e-161   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ90643.1|  predicted protein                                      461   2e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          461   2e-161   Amborella trichopoda
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       461   2e-161   Triticum urartu
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    461   2e-161   Pisum sativum [garden pea]
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    461   2e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    459   2e-161   Oxytropis lambertii
ref|NP_001043493.1|  Os01g0600900                                       460   2e-161   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    461   2e-161   Ginkgo biloba [ginkgo]
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             460   2e-161   Phyllostachys edulis [kikko-chiku]
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    460   2e-161   
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     460   3e-161   Eucalyptus grandis [rose gum]
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          460   3e-161   
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             460   3e-161   Citrus clementina [clementine]
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             461   3e-161   
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     461   3e-161   Eucalyptus grandis [rose gum]
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    460   3e-161   Eucalyptus grandis [rose gum]
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    460   3e-161   Vitis vinifera
ref|NP_001062939.1|  Os09g0346500                                       460   3e-161   
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    460   3e-161   
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             460   4e-161   Pisum sativum [garden pea]
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    459   4e-161   Elaeis guineensis
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    459   4e-161   
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    459   4e-161   Malus domestica [apple tree]
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    462   6e-161   
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    459   6e-161   Pisum sativum [garden pea]
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  459   7e-161   Zea mays [maize]
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                459   7e-161   Erythranthe guttata [common monkey flower]
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             459   7e-161   Mangifera indica
gb|AAB61238.1|  chlorophyll a/b-binding protein                         459   7e-161   Mesembryanthemum crystallinum
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    470   7e-161   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             459   7e-161   Populus trichocarpa [western balsam poplar]
dbj|BAJ85110.1|  predicted protein                                      459   7e-161   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    459   7e-161   
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    459   8e-161   Fragaria vesca subsp. vesca
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    459   8e-161   Populus euphratica
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    459   8e-161   Nicotiana sylvestris
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          459   9e-161   Ricinus communis
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             459   9e-161   Pachysandra terminalis
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              458   9e-161   
dbj|BAJ93064.1|  predicted protein                                      459   1e-160   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                459   1e-160   Erythranthe guttata [common monkey flower]
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    458   1e-160   Oryza brachyantha
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    458   1e-160   Pisum sativum [garden pea]
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    457   1e-160   Oxytropis splendens
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    458   1e-160   Pyrus x bretschneideri [bai li]
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                458   1e-160   Erythranthe guttata [common monkey flower]
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          458   2e-160   Triticum aestivum [Canadian hard winter wheat]
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            457   2e-160   Solanum tuberosum [potatoes]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             458   2e-160   Ophiopogon japonicus
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                458   2e-160   Erythranthe guttata [common monkey flower]
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    458   2e-160   Zea mays [maize]
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                458   2e-160   Erythranthe guttata [common monkey flower]
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             457   2e-160   Dimocarpus longan [longan]
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    457   2e-160   
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    457   2e-160   Nicotiana sylvestris
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             457   2e-160   Phyllostachys edulis [kikko-chiku]
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    457   3e-160   
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    457   3e-160   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    456   3e-160   Oxytropis maydelliana
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     461   3e-160   Eucalyptus grandis [rose gum]
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             457   3e-160   Phaseolus vulgaris [French bean]
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                457   3e-160   Erythranthe guttata [common monkey flower]
gb|KJB66916.1|  hypothetical protein B456_010G165100                    457   3e-160   Gossypium raimondii
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    457   3e-160   Brachypodium distachyon [annual false brome]
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    457   4e-160   Nicotiana tomentosiformis
dbj|BAJ87045.1|  predicted protein                                      457   4e-160   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          457   4e-160   Triticum urartu
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    457   4e-160   Nicotiana tomentosiformis
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    457   4e-160   Pyrus x bretschneideri [bai li]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       457   5e-160   Nicotiana sylvestris
gb|AHM26643.1|  a-b binding protein                                     457   5e-160   Pyrus x bretschneideri [bai li]
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    458   5e-160   
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    457   5e-160   
gb|AAA80593.1|  chlorophyll a/b binding protein                         457   6e-160   Solanum tuberosum [potatoes]
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 457   6e-160   Morus notabilis
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    462   6e-160   
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    457   6e-160   Nicotiana sylvestris
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    457   6e-160   Nicotiana sylvestris
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    456   6e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    456   7e-160   Brachypodium distachyon [annual false brome]
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          456   7e-160   Triticum urartu
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    456   7e-160   Dendrocalamus latiflorus [sweet bamboo]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             456   7e-160   Canarium album [Chinese white-olive]
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    456   7e-160   Petunia sp.
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    456   8e-160   Cucumis sativus [cucumbers]
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          456   8e-160   Spinacia oleracea
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          456   9e-160   
gb|AAB61236.1|  chlorophyll a/b-binding protein                         456   9e-160   Mesembryanthemum crystallinum
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    456   1e-159   Petunia sp.
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    456   1e-159   Fragaria vesca subsp. vesca
gb|KJB57287.1|  hypothetical protein B456_009G156900                    456   1e-159   Gossypium raimondii
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    456   1e-159   Nicotiana tomentosiformis
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         456   1e-159   Jatropha curcas
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                456   1e-159   Erythranthe guttata [common monkey flower]
gb|ACU23974.1|  unknown                                                 456   1e-159   Glycine max [soybeans]
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    456   1e-159   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    456   1e-159   Solanum tuberosum [potatoes]
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        456   1e-159   Triticum urartu
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          456   2e-159   
dbj|BAK03973.1|  predicted protein                                      456   2e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241277.1|  uncharacterized protein LOC100805310               455   2e-159   Glycine max [soybeans]
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    454   2e-159   Glycine soja [wild soybean]
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            455   2e-159   Phaseolus vulgaris [French bean]
dbj|BAJ90772.1|  predicted protein                                      455   2e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          455   3e-159   Triticum urartu
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        455   3e-159   Fagus crenata
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             455   3e-159   Phaseolus vulgaris [French bean]
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             455   3e-159   Phaseolus vulgaris [French bean]
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 455   3e-159   Morus notabilis
dbj|BAK02173.1|  predicted protein                                      455   3e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        454   4e-159   Glycine soja [wild soybean]
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                455   4e-159   Erythranthe guttata [common monkey flower]
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    468   4e-159   
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   4e-159   Solanum tuberosum [potatoes]
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    453   4e-159   Oxytropis maydelliana
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    454   5e-159   Cucumis melo [Oriental melon]
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   5e-159   Solanum tuberosum [potatoes]
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    454   5e-159   Fragaria vesca subsp. vesca
gb|AAA80591.1|  chlorophyll a/b binding protein                         454   6e-159   Solanum tuberosum [potatoes]
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    454   6e-159   Bambusa oldhamii
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            454   6e-159   Phaseolus vulgaris [French bean]
gb|ABK20976.1|  unknown                                                 454   6e-159   Picea sitchensis
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     454   6e-159   Euphorbia esula [wolf's milk]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    454   6e-159   
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    454   6e-159   Nicotiana tomentosiformis
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          454   6e-159   Triticum urartu
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             454   6e-159   Gossypium hirsutum [American cotton]
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               454   7e-159   Erythranthe guttata [common monkey flower]
gb|KJB69716.1|  hypothetical protein B456_011G041600                    454   7e-159   Gossypium raimondii
gb|ACN41907.1|  chlorophyll A/B binding protein                         454   7e-159   Gardenia jasminoides
dbj|BAJ86427.1|  predicted protein                                      454   8e-159   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          454   9e-159   
dbj|BAJ89881.1|  predicted protein                                      453   1e-158   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    452   1e-158   Spinacia oleracea
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          453   1e-158   Triticum urartu
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 453   1e-158   
emb|CAC38830.1|  chlorophyll a/b binding protein                        453   1e-158   Pinus contorta
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     453   1e-158   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             453   2e-158   Phaseolus vulgaris [French bean]
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    452   2e-158   Solanum nigrum
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    453   2e-158   
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    453   2e-158   
gb|AAA18529.1|  chlorophyll A/B binding protein                         452   2e-158   
gb|AAA80592.1|  chlorophyll a/b binding protein                         452   2e-158   
gb|ACU23816.1|  unknown                                                 452   2e-158   
gb|ACN40194.1|  unknown                                                 453   3e-158   
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    452   3e-158   
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    452   3e-158   
emb|CDP06328.1|  unnamed protein product                                452   3e-158   
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    452   3e-158   
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    452   3e-158   
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    452   3e-158   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         452   4e-158   
gb|AAA80594.1|  chlorophyll a/b binding protein                         452   5e-158   
emb|CAA47950.1|  chlorophyll a/b binding protein                        452   5e-158   
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    452   5e-158   
prf||1204205B  protein 1B,chlorophyll binding                           452   5e-158
prf||1503276A  chlorophyll a/b binding protein                          451   6e-158
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    452   8e-158   
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    451   8e-158   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          450   9e-158   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          453   1e-157   
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                451   1e-157   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    451   1e-157   
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     451   1e-157   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    450   1e-157   
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    456   1e-157   
gb|ABK22510.1|  unknown                                                 451   1e-157   
dbj|BAJ87240.1|  predicted protein                                      451   1e-157   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    451   1e-157   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     451   1e-157   
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    450   2e-157   
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          451   2e-157   
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    451   2e-157   
emb|CDP06329.1|  unnamed protein product                                450   2e-157   
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          455   3e-157   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     450   3e-157   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             450   3e-157   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    449   4e-157   
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    449   5e-157   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    449   5e-157   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     449   5e-157   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          449   5e-157   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                450   5e-157   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    449   5e-157   
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    449   5e-157   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    449   6e-157   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    448   6e-157   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          449   6e-157   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         449   7e-157   
gb|AEY85026.1|  light-harvesting complex II protein                     449   7e-157   
emb|CDP06330.1|  unnamed protein product                                449   8e-157   
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    449   8e-157   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    449   8e-157   
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    449   9e-157   
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             449   9e-157   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         448   1e-156   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                448   2e-156   
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    448   2e-156   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    448   2e-156   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         447   2e-156   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          447   3e-156   
gb|ACN40044.1|  unknown                                                 447   4e-156   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    447   4e-156   
dbj|BAD97888.1|  CAB homologue1                                         446   5e-156   
gb|ACF84273.1|  unknown                                                 447   5e-156   
gb|EMT25652.1|  hypothetical protein F775_43704                         461   5e-156   
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       447   8e-156   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    446   1e-155   
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    444   1e-155   
gb|ACF85694.1|  unknown                                                 446   1e-155   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            444   1e-155   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         446   1e-155   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    446   2e-155   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    445   3e-155   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    445   3e-155   
gb|AFK39586.1|  unknown                                                 444   3e-155   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    444   4e-155   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          444   5e-155   
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         443   1e-154   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    443   2e-154   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    442   3e-154   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    442   3e-154   
gb|ABK23849.1|  unknown                                                 442   3e-154   
gb|ABK23263.1|  unknown                                                 442   3e-154   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          442   4e-154   
gb|ABK26071.1|  unknown                                                 442   4e-154   
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       442   5e-154   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    442   5e-154   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       441   7e-154   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    441   7e-154   
gb|ABK22330.1|  unknown                                                 441   2e-153   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             440   2e-153   
emb|CAA61432.1|  LHCII type I protein                                   440   2e-153   
gb|ACN40027.1|  unknown                                                 440   3e-153   
sp|P06671.1|CB22_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    439   4e-153   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    439   5e-153   
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    439   7e-153   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    438   1e-152   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    438   1e-152   
ref|XP_002960494.1|  light-harvesting complex                           438   1e-152   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             438   1e-152   
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       438   1e-152   
ref|XP_002967230.1|  light-harvesting complex                           438   1e-152   
pdb|4LCZ|A  Chain A, Crystal Structure Of A Multilayer-packed Maj...    436   2e-152   
prf||1615137B  chlorophyll a/b binding protein P27                      436   2e-152
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             437   2e-152   
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    437   3e-152   
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        436   3e-152   
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    437   3e-152   
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    437   4e-152   
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             436   6e-152   
emb|CDY35271.1|  BnaC03g59520D                                          436   8e-152   
ref|NP_001044090.1|  Os01g0720500                                       436   9e-152   
emb|CDY26306.1|  BnaA09g26570D                                          436   9e-152   
emb|CDY66768.1|  BnaAnng22920D                                          436   9e-152   
emb|CAH59405.1|  light harvesting protein 1                             434   1e-151   
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       436   1e-151   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     436   1e-151   
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    436   1e-151   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    436   1e-151   
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             436   1e-151   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     436   1e-151   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    436   1e-151   
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             435   2e-151   
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    435   2e-151   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    435   2e-151   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    435   2e-151   
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    434   3e-151   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    434   4e-151   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    434   4e-151   
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             434   4e-151   
emb|CDX84316.1|  BnaC04g10780D                                          434   6e-151   
emb|CDY17247.1|  BnaA05g09410D                                          434   6e-151   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         434   7e-151   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   8e-151   
emb|CDX99866.1|  BnaC05g22880D                                          433   9e-151   
emb|CDX98158.1|  BnaC07g09400D                                          433   1e-150   
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             433   1e-150   
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             433   1e-150   
emb|CAG25596.1|  putative chlorophyll a/b binding protein               432   2e-150   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    432   2e-150   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             432   2e-150   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    432   3e-150   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    432   3e-150   
gb|AAT08647.1|  chloroplast chlorophyll A-B binding protein 3C          430   4e-150   
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg                431   4e-150   
emb|CDX79562.1|  BnaC03g18980D                                          432   4e-150   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               431   5e-150   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    431   7e-150   
ref|XP_002879498.1|  LHB1B1                                             431   8e-150   
gb|EMS50795.1|  Chlorophyll a-b binding protein, chloroplastic          433   9e-150   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    431   1e-149   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    431   1e-149   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    431   1e-149   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    430   2e-149   
ref|XP_010235395.1|  PREDICTED: chlorophyll a-b binding protein o...    430   2e-149   
emb|CDY17248.1|  BnaA05g09400D                                          430   3e-149   
sp|P04159.1|CB21_PEA  RecName: Full=Chlorophyll a-b binding prote...    427   5e-149   
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          427   5e-149   
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             428   1e-148   
emb|CDX84315.1|  BnaC04g10770D                                          429   3e-148   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     426   4e-148   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    427   4e-148   
gb|AAB18404.1|  chlorophyll a/b binding protein                         427   4e-148   
sp|Q00827.1|CB48_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    426   8e-148   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    426   1e-147   
gb|AAP44089.1|  chlorophyll a/b binding protein                         425   2e-147   
sp|P09755.1|CB22_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    424   2e-147   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    424   4e-147   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    424   7e-147   
dbj|BAA32346.1|  light-harvesting chlorophyll a/b-binding protein...    422   2e-146   
ref|XP_001774812.1|  predicted protein                                  421   6e-146   
ref|XP_001774452.1|  predicted protein                                  421   7e-146   
gb|EYU29603.1|  hypothetical protein MIMGU_mgv1a025305mg                420   8e-146   
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    421   9e-146   
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    420   1e-145   
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    420   1e-145   
ref|XP_001755762.1|  predicted protein                                  420   1e-145   
ref|XP_001779318.1|  predicted protein                                  420   1e-145   
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    420   2e-145   
gb|AHC95482.1|  chlorophyll A/B binding protein                         420   2e-145   
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    420   2e-145   
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    419   2e-145   
ref|XP_001762089.1|  predicted protein                                  420   2e-145   
ref|XP_001751426.1|  predicted protein                                  420   2e-145   
ref|XP_010412864.1|  PREDICTED: uncharacterized protein LOC104699228    430   2e-145   
ref|XP_001757271.1|  predicted protein                                  419   3e-145   
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    419   3e-145   
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    419   5e-145   
ref|XP_001754234.1|  predicted protein                                  419   5e-145   
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    418   6e-145   
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    418   6e-145   
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    418   7e-145   
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             418   8e-145   
ref|XP_001761868.1|  predicted protein                                  418   9e-145   
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   418   9e-145   
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    417   1e-144   
emb|CAA43907.1|  chlorophyll a/b-binding protein                        417   1e-144   
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    417   2e-144   
ref|XP_001751359.1|  predicted protein                                  417   2e-144   
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    417   2e-144   
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    417   2e-144   
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    417   3e-144   
gb|ABK22382.1|  unknown                                                 417   3e-144   
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    416   3e-144   
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    417   3e-144   
ref|XP_001775090.1|  predicted protein                                  417   3e-144   
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    417   4e-144   
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          416   5e-144   
sp|P08222.1|CB22_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    414   6e-144   
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    416   6e-144   
gb|KJB06589.1|  hypothetical protein B456_001G192000                    416   7e-144   
gb|AEY78525.1|  chlorophyll a/b-binding protein                         416   8e-144   
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   416   8e-144   
gb|AFJ25031.1|  chlorophyll a/b binding protein                         416   8e-144   
ref|XP_001751602.1|  predicted protein                                  416   8e-144   
gb|KJB10748.1|  hypothetical protein B456_001G220900                    416   9e-144   
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    416   9e-144   
emb|CAA52750.1|  chlorophyll a/b binding protein                        416   1e-143   
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                416   1e-143   



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   480 bits (1236),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   480 bits (1235),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 232/239 (97%), Positives = 236/239 (99%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   476 bits (1225),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 228/240 (95%), Positives = 234/240 (98%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KPKP SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  47   TGNGRVSMRKTVAKPKPASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  106

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  107  ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  166

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  167  LGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  226

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  286



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   474 bits (1221),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 235/239 (98%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAG+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   474 bits (1219),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 228/240 (95%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   473 bits (1218),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 235/239 (98%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   473 bits (1218),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 235/239 (98%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   473 bits (1217),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 235/239 (98%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   473 bits (1217),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 234/240 (98%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRFTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   472 bits (1215),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   472 bits (1215),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   472 bits (1214),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  KPKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GGGRVTMRKTGAKPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   471 bits (1213),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  +PKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKTFSRPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   471 bits (1212),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 235/239 (98%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  19   GNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  76

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  77   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  136

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  137  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  196

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  197  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  255



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   471 bits (1213),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   471 bits (1212),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK+A + KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKSAARSKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   471 bits (1212),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   471 bits (1212),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   471 bits (1212),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  31   GQGRVTMRKTVVKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  90

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  91   DPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  150

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  151  GNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  210

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  211  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  269



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   471 bits (1211),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  26   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   471 bits (1211),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   471 bits (1211),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   470 bits (1210),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   470 bits (1210),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  26   GEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   470 bits (1210),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
             G  + TMRKT  KPKPV++GSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  27   NGEGRITMRKTVPKPKPVAAGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  147  LGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   470 bits (1210),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   470 bits (1210),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   470 bits (1209),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   470 bits (1209),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   469 bits (1208),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRITMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEA+WFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAIWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   469 bits (1208),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
             G  + TMRKTA KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   VGEGRVTMRKTASKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   469 bits (1208),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            +GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   SGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  267



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   469 bits (1208),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   469 bits (1207),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   469 bits (1207),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  144  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  203

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  204  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   469 bits (1207),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   469 bits (1207),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   469 bits (1206),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  22   GEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  81

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  82   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  141

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  142  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  201

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  202  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  260



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   469 bits (1206),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 233/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK+ G+PKP++SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKSVGRPKPIASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLG ADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGPADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   469 bits (1206),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   469 bits (1206),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   468 bits (1205),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/240 (95%), Positives = 233/240 (97%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   468 bits (1205),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   468 bits (1204),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  23   TGNGKATMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  82

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  83   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  142

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  143  LGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  202

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNF PGK
Sbjct  203  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK  262



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   468 bits (1205),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFSKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   468 bits (1204),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGS WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKVTMRKTASKAKPVSSGSLWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   468 bits (1204),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN+K TMRKTA K KP  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DP+TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  144  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  203

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  204  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  143  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  202

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 
Sbjct  203  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGN  261



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENL DHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLVDHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K  MRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  30   GEGRVTMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  89

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  90   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  149

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPE F
Sbjct  150  GNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEKF  209

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  210  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  268



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 233/240 (97%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   468 bits (1203),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 233/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA   KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GTGRITMRKTA--TKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  265



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   467 bits (1202),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAML ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLAALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR++GGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVSGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLVDPVNNNAWAYATNFVPGK  267



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   467 bits (1201),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  KPK   SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GGGRVTMRKTGAKPKSAPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   467 bits (1201),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   467 bits (1201),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKVTMRKTASKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK G+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKVGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            F ELKVKE+KNGRLAMFSMFGFF+QAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  207  FTELKVKEIKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   467 bits (1201),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKT  KPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRISMRKTGAKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   466 bits (1200),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL+NL DHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   466 bits (1200),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKT  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTTTKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   466 bits (1200),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRVTMRKTVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   466 bits (1200),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPL+NL DHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK  267



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score =   466 bits (1200),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQA+VTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  207  FAELKVKEIKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   466 bits (1200),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LS
Sbjct  28   TGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   466 bits (1199),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 229/239 (96%), Positives = 232/239 (97%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   466 bits (1199),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPKP+SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW YATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWNYATNFVPGK  267



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   466 bits (1199),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
             G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   VGEGRITMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   466 bits (1199),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLG ADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGPADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   466 bits (1199),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVK +KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKHIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   466 bits (1198),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   466 bits (1198),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
             G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   VGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   466 bits (1198),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
             G  + TMRKTA + K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   VGEGRVTMRKTASRSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   466 bits (1198),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   466 bits (1198),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK+ G+ +PV S SPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKSVGRSRPVVSDSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   465 bits (1197),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G ++FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  266



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   465 bits (1197),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSG  PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGKVTMRKTVIKAKPVSSGSPWYGPDRVKYLGPFSGNSPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   465 bits (1196),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_002460622.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
 gb|EER97143.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
Length=262

 Score =   465 bits (1196),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  144  GNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  203

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 
Sbjct  204  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGN  262



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   465 bits (1196),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRITMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
 gb|EES01022.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
Length=265

 Score =   464 bits (1195),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   464 bits (1195),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 227/240 (95%), Positives = 232/240 (97%), Gaps = 1/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            + N + TMRKTAGKP   SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  29   SSNGRVTMRKTAGKPA-ASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   464 bits (1195),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score =   464 bits (1195),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW++ATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSFATNFVPGK  267



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   464 bits (1194),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 228/239 (95%), Positives = 231/239 (97%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNF PGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK  264



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score =   464 bits (1194),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  25   TGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  84

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  85   ADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  144

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  145  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  204

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  205  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  264



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   464 bits (1194),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVTMRKTASKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004969083.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Setaria italica]
Length=265

 Score =   464 bits (1193),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 231/240 (96%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAG-KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G  + TMRKT G KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  26   GEGRITMRKTGGAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   464 bits (1193),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 233/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GNA+ +MRK+ GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNARVSMRKSVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   464 bits (1193),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT GKP P  SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRVTMRKTIGKPVP--SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   464 bits (1193),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT GKP  VSSGSPWYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTVGKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   464 bits (1193),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK V+SGSPWYGPDRVKYLGPFSGEPPSYLTGE PGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLTGELPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFF+QAIVTGKGPLENLADHLADPVNNNAW+YATN VPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLADPVNNNAWSYATNLVPGK  267



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   463 bits (1192),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 231/239 (97%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  205  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score =   464 bits (1193),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/236 (94%), Positives = 231/236 (98%), Gaps = 0/236 (0%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  32   RVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPE  91

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  92   TFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  151

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAEL
Sbjct  152  SLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAEL  211

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW++ATNFVPGK
Sbjct  212  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSFATNFVPGK  267



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score =   463 bits (1192),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE PGDYGWDTAGLS
Sbjct  28   TGNGRFTMRKTAAKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEKPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWA+L  LGCVFPELLSRNGVKFGEAVWFK G+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAILERLGCVFPELLSRNGVKFGEAVWFKVGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_002455901.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
 gb|EES01021.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
Length=266

 Score =   463 bits (1192),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score =   466 bits (1198),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  87   TGNGRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  146

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  147  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  206

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPG SFDPLGLA+DPEA
Sbjct  207  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGASFDPLGLAEDPEA  266

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  267  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  326



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   463 bits (1192),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQ+ILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQNILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   463 bits (1192),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAAKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 231/239 (97%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  205  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSS SPWYGP+RVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK G+QIFS+GGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN++  MRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSRVNMRKSAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKT  K KP SS SPWYGPDRVKYLGPFSGE PSYLTGEFP DYGWDTAGLS
Sbjct  28   TGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNG+KFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|NP_001142284.1| uncharacterized protein LOC100274453 [Zea mays]
 gb|ACF88086.1| unknown [Zea mays]
 gb|ACG28627.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|AFW83181.1| light harvesting chlorophyll a/b binding protein1 isoform 1 [Zea 
mays]
 gb|AFW83182.1| light harvesting chlorophyll a/b binding protein1 isoform 2 [Zea 
mays]
Length=264

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPKP +SGSPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  26   GEGRITMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPVENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEF GDYGWDTAGLSA
Sbjct  28   GEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFAGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   463 bits (1191),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 231/240 (96%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   GEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010231015.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=263

 Score =   462 bits (1190),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKT  K KPVSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  25   GEARITMRKTVAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  205  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  263



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   462 bits (1190),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN++ TMRK+A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSRVTMRKSA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLTDPVNNNAWAYATNFVPGK  265



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   462 bits (1190),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  264



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   462 bits (1190),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW +ATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK  267



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   462 bits (1190),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 231/239 (97%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA KP  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRKTAKKPA-VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  265



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   465 bits (1197),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 227/239 (95%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  102  GTGRITMRKTATKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  159

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  160  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  219

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  220  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  279

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  280  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  338



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   462 bits (1189),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G AKFTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   462 bits (1189),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 222/236 (94%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + TMRK+  K K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  35   RVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  94

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  95   TFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  154

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            +L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  155  NLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  214

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  215  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  270



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   462 bits (1189),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT  K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTGAKSKAVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   462 bits (1189),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 225/236 (95%), Positives = 230/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   462 bits (1189),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 231/240 (96%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   GEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score =   462 bits (1189),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TG  + +MRKT+ KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TGTGRISMRKTSAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  207  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   462 bits (1189),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRK+A K KP S GSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVTMRKSAAKAKPASFGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVP K
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPRK  267



>gb|AEV59640.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis campestris subsp. johannensis]
 gb|AEV59644.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis splendens]
Length=239

 Score =   461 bits (1185),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G +KFTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  1    GASKFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  60

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  61   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  120

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  121  GNPSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  180

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  181  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  239



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score =   462 bits (1188),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            T   +F+MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  25   TTTGRFSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  84

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  85   ADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  144

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  145  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  204

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  205  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  264



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score =   462 bits (1188),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            T   +F+MRKTA KPKP +SGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  25   TTTGRFSMRKTAAKPKPAASGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  84

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  85   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  144

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  145  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  204

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  205  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  264



>gb|ACN31249.1| unknown [Zea mays]
Length=233

 Score =   460 bits (1184),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 224/233 (96%), Positives = 228/233 (98%), Gaps = 0/233 (0%)
 Frame = -1

Query  737  MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA  558
            MRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  1    MRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA  60

Query  557  KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLI  378
            KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLI
Sbjct  61   KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI  120

Query  377  HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVK  198
            HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVK
Sbjct  121  HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVK  180

Query  197  ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  181  ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  233



>ref|XP_006449645.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
 gb|ESR62885.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
Length=264

 Score =   462 bits (1188),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 225/236 (95%), Positives = 230/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   461 bits (1187),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   461 bits (1187),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  264



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   461 bits (1187),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GKGRVTMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   461 bits (1187),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 229/239 (96%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK  GKP   SSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GQGRVTMRKAGGKPA-ASSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   461 bits (1187),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K K VSS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAAKSKNVSSVSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
 ref|XP_008227797.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
Length=265

 Score =   461 bits (1186),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MR+ A KP  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRRAARKPA-VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AEV59639.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis arctobia]
Length=239

 Score =   460 bits (1183),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G +KFTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  1    GASKFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  60

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  61   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  120

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  121  GNPSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  180

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  181  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  239



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   461 bits (1185),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AAH53854.1| Unknown (protein for IMAGE:5194336), partial [Homo sapiens]
 gb|AAI11385.1| Unknown (protein for IMAGE:5198300), partial [Homo sapiens]
Length=287

 Score =   462 bits (1188),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  49   GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSA  108

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  109  DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  168

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  169  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  228

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWA+ATNFVPGK
Sbjct  229  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAFATNFVPGK  287



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   461 bits (1185),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 230/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWAYATNF PGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK  264



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   461 bits (1186),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKTKSVSSDSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFTKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



>gb|ADL41158.1| chloroplast light-harvesting chlorophyll a/b binding protein 
[Triticum aestivum]
Length=266

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAFATNFVPGK  266



>dbj|BAJ90643.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=265

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFS+GGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  207  AELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006856963.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/241 (93%), Positives = 231/241 (96%), Gaps = 1/241 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKP-KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGL  582
            +G  + +MRK  GKP K VSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGL
Sbjct  28   SGEGRVSMRKPVGKPSKAVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGL  87

Query  581  SADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLD  402
            SADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLD
Sbjct  88   SADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLD  147

Query  401  YLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPE  222
            YLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPE
Sbjct  148  YLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPE  207

Query  221  AFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  42
            AFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG
Sbjct  208  AFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  267

Query  41   K  39
            K
Sbjct  268  K  268



>gb|EMS51039.1| Chlorophyll a-b binding protein 3C, chloroplastic [Triticum urartu]
Length=265

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GEARVTMRKTAAKAKPVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKF EAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFREAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWA+ATNFVPGK
Sbjct  207  AELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAFATNFVPGK  265



>sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; 
AltName: Full=LHCII type I CAB-8; Flags: Precursor [Pisum 
sativum]
 emb|CAA39883.1| chlorophyll a/b binding protein [Pisum sativum]
Length=268

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  30   GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  89

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  90   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  149

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  150  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  209

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  210  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  268



>dbj|BAJ08392.1| light harvesting chlorophyll a/b-binding protein Lhcb1 [Hordeum 
vulgare subsp. vulgare]
Length=266

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPVSS SPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKPVSSSSPWYGSDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>gb|AEV59645.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis lambertii]
Length=237

 Score =   459 bits (1182),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 223/237 (94%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  749  AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  570
            +KFTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP
Sbjct  1    SKFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  60

Query  569  ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGN  390
            ETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGN
Sbjct  61   ETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGN  120

Query  389  PSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAE  210
            PSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAE
Sbjct  121  PSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE  180

Query  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  181  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  237



>ref|NP_001043493.1| Os01g0600900 [Oryza sativa Japonica Group]
 sp|P12331.2|CB22_ORYSJ RecName: Full=Chlorophyll a-b binding protein 2, chloroplastic; 
AltName: Full=LHCII type I CAB-2; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD52990.1| putative a/b-binding protein precursor [Oryza sativa Japonica 
Group]
 dbj|BAF05407.1| Os01g0600900 [Oryza sativa Japonica Group]
 gb|EAY74827.1| hypothetical protein OsI_02717 [Oryza sativa Indica Group]
 gb|EAZ44370.1| hypothetical protein OsJ_28992 [Oryza sativa Japonica Group]
 dbj|BAG99560.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00551.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71822.1| chlorophyll a/b-binding protein [Oryza sativa]
Length=261

 Score =   460 bits (1184),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK+A KPKP +SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEGRITMRKSAAKPKPAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  143  GNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  202

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  203  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  261



>gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Ginkgo biloba]
Length=270

 Score =   461 bits (1185),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K    SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  32   GEGRITMRKTASKKVVASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  91

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFS+GGLDYL
Sbjct  92   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSDGGLDYL  151

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AF
Sbjct  152  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAF  211

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  212  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK  270



>gb|ABQ81856.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   460 bits (1184),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G+A+ TMRKT  KPK V+SGSPWYGPDRV YLGP SGEPPSYLTGEF GDYGWDTAGLSA
Sbjct  28   GDARMTMRKTGAKPK-VASGSPWYGPDRVLYLGPLSGEPPSYLTGEFAGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009363087.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=265

 Score =   460 bits (1184),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRKTGKKPA-VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  265



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   460 bits (1184),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 232/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT GKP  VSSGSPWYGPDR K+LGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTVGKP--VSSGSPWYGPDRAKHLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK  265



>gb|EMT29002.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   460 bits (1184),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIIDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_006449643.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 ref|XP_006467513.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467514.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR62883.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 gb|KDO78114.1| hypothetical protein CISIN_1g024654mg [Citrus sinensis]
Length=264

 Score =   460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/236 (95%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   461 bits (1187),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/236 (95%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  70   RISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  127

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  128  TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  187

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  188  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  247

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  248  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  303



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   461 bits (1187),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRK   KP  VSSGSPWYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  64   GNGRISMRKAVRKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  121

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  122  DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  181

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNP+LIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  182  GNPNLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  241

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK
Sbjct  242  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK  300



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 229/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNP+L+HAQSILAIWA QV+LMGAVEGYRI GGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPNLVHAQSILAIWASQVILMGAVEGYRIGGGPLGEVVDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|NP_001062939.1| Os09g0346500 [Oryza sativa Japonica Group]
 sp|P12330.2|CB21_ORYSJ RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD28469.1| putative chlorophyll a-b binding protein, chloroplast precursor 
(LHCII type I CAB) (LHCP) [Oryza sativa Japonica Group]
 dbj|BAD29115.1| putative chlorophyll a-b binding protein, chloroplast precursor 
(LHCII type I CAB) (LHCP) [Oryza sativa Japonica Group]
 dbj|BAF24853.1| Os09g0346500 [Oryza sativa Japonica Group]
 dbj|BAG96567.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96573.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96613.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87574.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84405.1| hypothetical protein OsI_30987 [Oryza sativa Indica Group]
Length=265

 Score =   460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/240 (93%), Positives = 230/240 (96%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G A+ TMRKTA KPKP  SSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  26   GEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGG+FDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   460 bits (1183),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   459 bits (1182),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRKT+ K  P  SGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVTMRKTSTKRVP--SGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   459 bits (1182),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   459 bits (1182),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>ref|XP_008343203.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008362557.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=332

 Score =   462 bits (1188),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  95   GNGRVSMRKTGKKPA-VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  153

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  154  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  213

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF
Sbjct  214  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  273

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  274  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  332



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   459 bits (1182),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  31   GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  90

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  91   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  150

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  151  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  210

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  211  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  269



>ref|NP_001148439.1| chlorophyll a-b binding protein 2 [Zea mays]
 ref|XP_008675450.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Zea mays]
 ref|XP_008675451.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Zea mays]
 gb|ACG31472.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA58854.1| TPA: chlorophyll a-b binding protein 2 [Zea mays]
Length=264

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPKP +SGSPWYG DRV YLGP SG PPSYLTGEFPGDYGWDTAGLSA
Sbjct  26   GEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK  264



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            T + + +MRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  25   TSSGRISMRKTAAKPKPAASSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  84

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  85   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  144

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  145  LGNPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  204

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  205  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  264



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MR+TA   KP  SGSPWYGPDRVKYL PFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRRTA---KPTPSGSPWYGPDRVKYLSPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAGKTKNVSSDSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGA+EGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAIEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score =   470 bits (1209),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 233/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            +GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   SGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  267


 Score =   470 bits (1209),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 225/240 (94%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  315  TGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  374

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  375  ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  434

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  435  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  494

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  495  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  554



>ref|XP_002302798.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
 gb|EEE82071.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
Length=266

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRK AGK     SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  30   GNGRVSMRKAAGKV--ADSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>dbj|BAJ85110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADP+NNNAWA+ATNFVPGK
Sbjct  208  AELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPINNNAWAFATNFVPGK  266



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   459 bits (1181),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  264



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   459 bits (1180),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  205  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  263



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   459 bits (1180),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 226/239 (95%), Positives = 229/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN   +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GNGCISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLIHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSM GFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  205  AELKVKELKNGRLAMFSMLGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   459 bits (1180),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKTA KP  VSS SPWYGPDRVKYLGPFSGE PSYLT EFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTAAKP--VSSSSPWYGPDRVKYLGPFSGESPSYLTSEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   459 bits (1180),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 231/239 (97%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTAAKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWASQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score =   459 bits (1180),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKT G+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GVGRVSMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNP+L+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  149  GNPNLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVIDPLYPGGSFDPLGLADDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAY TNFV GK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYPTNFVSGK  267



>tpg|DAA58853.1| TPA: hypothetical protein ZEAMMB73_924562 [Zea mays]
Length=259

 Score =   458 bits (1179),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPKP +SGSPWYG DRV YLGP SG PPSYLTGEFPGDYGWDTAGLSA
Sbjct  21   GEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSA  80

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  81   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  140

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  141  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  200

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK
Sbjct  201  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK  259



>dbj|BAJ93064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   459 bits (1180),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKVKQVASGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAFATNFVPGK  266



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score =   459 bits (1180),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA KPK VSS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  32   RVSMRKTAAKPKQVSSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPE  91

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  92   TFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  151

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAEL
Sbjct  152  SLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAEL  211

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  212  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_006660556.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   458 bits (1179),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 223/240 (93%), Positives = 229/240 (95%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRK-TAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G A+ TMRK TA KPK  +SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  24   GEARITMRKGTAAKPKVAASGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLS  83

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  84   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  143

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  144  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  203

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  204  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   458 bits (1179),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAF
Sbjct  148  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  208  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>gb|AEV59643.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis splendens]
Length=236

 Score =   457 bits (1176),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/236 (94%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  749  AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  570
            +KFTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP
Sbjct  1    SKFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  60

Query  569  ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGN  390
            ETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGN
Sbjct  61   ETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGN  120

Query  389  PSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAE  210
            PSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAE
Sbjct  121  PSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAE  180

Query  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  42
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPG
Sbjct  181  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPG  236



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   458 bits (1179),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K K VSSGSPWYGPDR KYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRVTMRKTAAKSKKVSSGSPWYGPDRAKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEA WFKAGAQIFS+GGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEATWFKAGAQIFSQGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYR+AGGPLGEITDPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAW+YATNF PG+
Sbjct  209  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWSYATNFAPGQ  267



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score =   458 bits (1179),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 231/240 (96%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  25   TGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  84

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  85   ADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  144

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIW  QV+LMGAVEGYRIAGGPLG++ DPLYPGGSFDPLGLA+DPEA
Sbjct  145  LGNPSLVHAQSILAIWGFQVLLMGAVEGYRIAGGPLGDVVDPLYPGGSFDPLGLAEDPEA  204

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAWA+ATNFVPGK
Sbjct  205  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVGNNAWAFATNFVPGK  264



>gb|AAB18209.1| chlorophyll a/b-binding protein WCAB precursor [Triticum aestivum]
Length=266

 Score =   458 bits (1179),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLA+DPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  266



>gb|AFW90565.1| chlorophyll a-b binding protein 3C-like mRNA [Solanum tuberosum]
Length=233

 Score =   457 bits (1175),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/233 (95%), Positives = 227/233 (97%), Gaps = 0/233 (0%)
 Frame = -1

Query  737  MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA  558
            MRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  1    MRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFA  60

Query  557  KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLI  378
            KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+
Sbjct  61   KNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLV  120

Query  377  HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVK  198
            HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVK
Sbjct  121  HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVK  180

Query  197  ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            E+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  181  EIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  233



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   458 bits (1178),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 230/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRISMRKTG---KSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWASQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            +ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  SELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score =   458 bits (1178),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/237 (92%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  749  AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  570
            ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADP
Sbjct  24   SRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADP  83

Query  569  ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGN  390
            ETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct  84   ETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGN  143

Query  389  PSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAE  210
            PSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAE
Sbjct  144  PSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE  203

Query  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  204  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  260



>ref|XP_008675448.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Zea mays]
 tpg|DAA58850.1| TPA: chlorophyll a-b binding protein 48, Precursor [Zea mays]
Length=264

 Score =   458 bits (1178),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPKP +SGSPWYG DRV YLGP SG PPSYLTGEFPGDYGWDTAGLSA
Sbjct  26   GEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHL DPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNNAWAYATNFVPGK  264



>gb|EYU19649.1| hypothetical protein MIMGU_mgv1a011927mg [Erythranthe guttata]
Length=266

 Score =   458 bits (1178),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/236 (93%), Positives = 228/236 (97%), Gaps = 0/236 (0%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA KPKP SS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTAAKPKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPE  90

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  91   TFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  150

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAEL
Sbjct  151  SLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL  210

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  211  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   457 bits (1177),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 229/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRKT    + VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWD AGLSA
Sbjct  28   GNGRVTMRKTG---RQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDAAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG++TDPLYPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGKVTDPLYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGR AMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  205  AELKVKEIKNGRSAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   457 bits (1177),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWXYATNFVPGK  265



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   457 bits (1177),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABQ81857.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   457 bits (1177),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKT  KPK  +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTGAKPK-ATSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGV+FGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVQFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTG GP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGNGPIENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   457 bits (1177),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWXYATNFVPGK  265



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   457 bits (1177),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>gb|AEV59642.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis maydelliana]
Length=238

 Score =   456 bits (1174),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 222/238 (93%), Positives = 229/238 (96%), Gaps = 0/238 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G +KFTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  1    GASKFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  60

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  61   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  120

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  121  GNPSLVHAQSILAIWAVQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  180

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  42
            AE KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPG
Sbjct  181  AEXKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPG  238



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   461 bits (1186),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 229/239 (96%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  123  GNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  179

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  180  DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  239

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  240  GNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  299

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  300  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  358



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   457 bits (1177),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 222/236 (94%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|EYU29604.1| hypothetical protein MIMGU_mgv1a023200mg [Erythranthe guttata]
 gb|EYU30287.1| hypothetical protein MIMGU_mgv1a011913mg [Erythranthe guttata]
 gb|EYU30288.1| hypothetical protein MIMGU_mgv1a020332mg [Erythranthe guttata]
Length=267

 Score =   457 bits (1177),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 219/237 (92%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  749  AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP  570
            ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADP
Sbjct  31   SRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADP  90

Query  569  ETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGN  390
            ETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGN
Sbjct  91   ETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGN  150

Query  389  PSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAE  210
            PSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAE
Sbjct  151  PSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAE  210

Query  209  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  211  LKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   457 bits (1176),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   KP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTA--TKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_010237260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=266

 Score =   457 bits (1176),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K KPV SGSPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKPVPSGSPWYGADRVLYLGPLSGQPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHITDPVNNNAWAFATNFVPGK  266



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   457 bits (1176),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>dbj|BAJ87045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   457 bits (1176),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPS +HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSFVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADP+NNNAWA+ATNFVPGK
Sbjct  208  AELKVKEVKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPINNNAWAFATNFVPGK  266



>gb|EMS50796.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   457 bits (1176),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RN VKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNDVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  266



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   457 bits (1176),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   457 bits (1176),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA K K VS GSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKTAAKSKNVSCGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGC+FPELLSRN VKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNRVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGG FDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGKFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFF+QAIVTGKGP+ENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  209  AELKVKELKNGRLAMFSMFGFFLQAIVTGKGPIENLADHLSDPVNNNAWSYATNFVPGK  267



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   457 bits (1175),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   457 bits (1175),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  28   GNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  206  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  264



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   458 bits (1178),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  55   GNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  112

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  113  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  172

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  173  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  232

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  233  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  291



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   457 bits (1175),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 225/239 (94%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRK A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKXA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWATQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  207  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   457 bits (1175),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 227/240 (95%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVIDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   457 bits (1175),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TG  + +MRKT  +    SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGGGRVSMRKTGSRG--ASSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=399

 Score =   462 bits (1188),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 225/236 (95%), Positives = 230/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264


 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 159/207 (77%), Gaps = 20/207 (10%)
 Frame = -1

Query  599  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLS---------------RNGV  465
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++                N  
Sbjct  193  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNN  252

Query  464  KFGEAVWFK-----AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  300
             +  A  F      AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG
Sbjct  253  AWAYATNFVPGKKFAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG  312

Query  299  GPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP  120
            GPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP
Sbjct  313  GPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGP  372

Query  119  LENLADHLADPVNNNAWAYATNFVPGK  39
            LENLADHLADPVNNNAWAYATNFVPGK
Sbjct  373  LENLADHLADPVNNNAWAYATNFVPGK  399



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   457 bits (1175),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 219/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFS+GGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   457 bits (1175),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 218/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>dbj|BAA00536.1| type I light-harvesting chlorophyll a/b-binding protein [Oryza 
sativa Japonica Group]
 prf||1707316A chlorophyll a/b binding protein 1
Length=265

 Score =   456 bits (1174),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 222/240 (93%), Positives = 229/240 (95%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G A+ TMRKTA KPKP  SSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  26   GEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGG+FDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+K GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKEIKKGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_003578592.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=265

 Score =   456 bits (1174),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTA KPK  +SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GEGRITMRKTAAKPKVSASGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAWA+ATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWAFATNFVPGK  265



>gb|EMS50797.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   456 bits (1174),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K VSS SPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVSSDSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  266



>gb|AFV34722.1| light harvesting chlorophyll a/b-binding protein 1-1 [Dendrocalamus 
latiflorus]
Length=265

 Score =   456 bits (1174),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 229/239 (96%), Gaps = 1/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKT  KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTGAKPKP-ASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWAFQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   456 bits (1174),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 228/239 (95%), Gaps = 3/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN +  MRKT  KP    SGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVNMRKTFNKPP---SGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   456 bits (1174),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 218/240 (91%), Positives = 227/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            T N K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  27   TRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADP TFAKNR+LEVIH RW MLGALGCVFPEL +RNGVKFGEAVWFKAG+QIF EGGLDY
Sbjct  87   ADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  147  LGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAEL+VKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  207  FAELEVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 gb|KGN58532.1| hypothetical protein Csa_3G664560 [Cucumis sativus]
Length=265

 Score =   456 bits (1174),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 225/238 (95%), Positives = 230/238 (97%), Gaps = 2/238 (1%)
 Frame = -1

Query  752  NAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSAD  573
            N + TMRK+ GKP   SSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSAD
Sbjct  30   NGRVTMRKS-GKPA-ASSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSAD  87

Query  572  PETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLG  393
            PETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  88   PETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLG  147

Query  392  NPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFA  213
            NPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF+
Sbjct  148  NPSLIHAQSILAIWASQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFS  207

Query  212  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score =   456 bits (1174),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 230/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRK+AGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  89   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW +ATNFVPG 
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGN  267



>gb|EMT29003.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   456 bits (1174),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G+A+ TMRKTA K K V SGSPWYG DRV YLGP SGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  28   GDARVTMRKTAAKAKQVVSGSPWYGSDRVLYLGPLSGEPPSYLNGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHL DPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLTDPVNNNAWAFATNFVPGK  266



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   456 bits (1174),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRK AGK K  +  SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSA  88

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAF
Sbjct  149  GNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAF  208

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  209  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 218/240 (91%), Positives = 227/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  87

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW KAG+QIFSEGGLDY
Sbjct  88   ADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDY  147

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLG + DPLYPGGSFDPLGLA+DPEA
Sbjct  148  LGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEA  207

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE KNGRLAMFSMFGFF+QAIVTGKGPLENLADHL DPVNNNAW+YATNFVP K
Sbjct  208  FAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPVNNNAWSYATNFVPRK  267



>ref|XP_011460161.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=263

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSA
Sbjct  27   GTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSA  84

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  85   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  144

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  145  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAF  204

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  205  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  263



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/239 (92%), Positives = 229/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + +MRKTA K  P  SGSPWYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNGRVSMRKTATKAAP--SGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLIHAQSILAIWACQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 218/240 (91%), Positives = 230/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   456 bits (1172),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 224/239 (94%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  81

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  82   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYL  141

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWACQVVLMGAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  142  GNPSLIHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  201

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  202  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  260



>gb|EYU43278.1| hypothetical protein MIMGU_mgv1a011933mg [Erythranthe guttata]
Length=266

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 231/240 (96%), Gaps = 2/240 (1%)
 Frame = -1

Query  752  NAKFTMRKTAGKPKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            N + +MRKTAGKPKP   SSGSPWYGPDRVKYLGPFSGE PSYLTGEF GDYGWDTAGLS
Sbjct  27   NGRVSMRKTAGKPKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGEFAGDYGWDTAGLS  86

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  87   ADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  146

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEA
Sbjct  147  LGNPSLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEA  206

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  207  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   456 bits (1172),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 222/239 (93%), Positives = 230/239 (96%), Gaps = 2/239 (1%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSY TGEFPGDYGWDTAGLSA
Sbjct  28   GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYRTGEFPGDYGWDTAGLSA  85

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  86   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  145

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAF
Sbjct  146  GNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAF  205

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKELK+GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  AELKVKELKHGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   456 bits (1173),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 229/240 (95%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  29   GEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  88

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  89   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  148

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  149  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  208

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  209  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  268



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   456 bits (1172),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 227/240 (95%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  206  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|EMS51257.1| Chlorophyll a-b binding protein 1, chloroplastic [Triticum urartu]
Length=285

 Score =   456 bits (1174),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/239 (92%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK  +S SPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  27   GEGRITMRKTAGKPKVAASSSPWYGSDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSA  86

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  87   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  146

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  147  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  206

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  207  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|EMT02412.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=261

 Score =   456 bits (1172),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 220/239 (92%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DP+TFAKNRELEVIH RWAMLGALGCVFPELL+R+GVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPKTFAKNRELEVIHCRWAMLGALGCVFPELLARDGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  143  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  202

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  203  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  261



>dbj|BAK03973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   456 bits (1172),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK  +S SPWYG DRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEGRITMRKTAGKPKVAASSSPWYGSDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLA+DPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|NP_001241277.1| uncharacterized protein LOC100805310 [Glycine max]
 gb|ACU24438.1| unknown [Glycine max]
Length=263

 Score =   455 bits (1171),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/236 (94%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  30   RVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  147

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  148  SLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  207

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|KHN41291.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic 
[Glycine soja]
Length=231

 Score =   454 bits (1168),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 223/233 (96%), Positives = 228/233 (98%), Gaps = 2/233 (1%)
 Frame = -1

Query  737  MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA  558
            MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  1    MRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA  58

Query  557  KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLI  378
            KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLI
Sbjct  59   KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLI  118

Query  377  HAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVK  198
            HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVK
Sbjct  119  HAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVK  178

Query  197  ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  179  ELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  231



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   455 bits (1171),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/236 (94%), Positives = 228/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLVHAQSILAIWATQVLLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSM GFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMVGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>dbj|BAJ90772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   455 bits (1171),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/239 (91%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKT  K K V+S SPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTTAKAKQVASSSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHITDPVNNNAWAFATNFVPGK  266



>gb|EMS45686.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=266

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 216/239 (90%), Positives = 227/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K V+S SPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQVASSSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE+VWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGESVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGL DDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLVDDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            +ELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  SELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  266



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/236 (94%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  31   RVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  264



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/236 (93%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+FPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/236 (93%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+FPGDYGWDTAGLSADPE
Sbjct  31   RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQFPGDYGWDTAGLSADPE  88

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  148

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  149  SLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  208

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  209  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 221/240 (92%), Positives = 229/240 (95%), Gaps = 2/240 (1%)
 Frame = -1

Query  758  TGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            TG  + +MRKT  +    SSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLS
Sbjct  28   TGGGRVSMRKTGSRV--ASSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLS  85

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFA+NRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  86   ADPETFARNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDY  145

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEA
Sbjct  146  LGNPSLIHAQSILAIWASQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEA  205

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  206  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>dbj|BAK02173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   455 bits (1170),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/239 (91%), Positives = 228/239 (95%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G A+ TMRKTA K K +SS +PWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  28   GEARVTMRKTAAKAKQLSSSNPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSA  87

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  88   DPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  147

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAF
Sbjct  148  GNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAF  207

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  208  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  266



>gb|KHN28981.1| Chlorophyll a-b binding protein 3, chloroplastic [Glycine soja]
Length=263

 Score =   454 bits (1169),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 222/236 (94%), Positives = 229/236 (97%), Gaps = 2/236 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  567
            + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE
Sbjct  30   RVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  566  TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  387
            TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNP  147

Query  386  SLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAEL  207
            SL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAEL
Sbjct  148  SLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAEL  207

Query  206  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  208  KVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|EYU35814.1| hypothetical protein MIMGU_mgv1a011908mg [Erythranthe guttata]
Length=267

 Score =   455 bits (1170),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/238 (92%), Positives = 230/238 (97%), Gaps = 2/238 (1%)
 Frame = -1

Query  746  KFTMRKTAGKPKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSAD  573
            + +MRKTAGKPKP   SSGSPWYGPDRVKYLGPFSGE PSYL+GEFPGDYGWDTAGLSAD
Sbjct  30   RISMRKTAGKPKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLSGEFPGDYGWDTAGLSAD  89

Query  572  PETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLG  393
            PETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  90   PETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  149

Query  392  NPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFA  213
            NPSL+HAQSILAIW  QVVLMGA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFA
Sbjct  150  NPSLVHAQSILAIWGVQVVLMGAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA  209

Query  212  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  210  ELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   468 bits (1204),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 223/239 (93%), Positives = 232/239 (97%), Gaps = 0/239 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  576
            G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA
Sbjct  386  GEGRITMRKTAGKPKQVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  445

Query  575  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  396
            DPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  446  DPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  505

Query  395  GNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAF  216
            GNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAF
Sbjct  506  GNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAF  565

Query  215  AELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  566  AELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  624


 Score =   457 bits (1177),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 220/240 (92%), Positives = 229/240 (95%), Gaps = 1/240 (0%)
 Frame = -1

Query  755  GNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLS  579
            G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLS
Sbjct  29   GEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLS  88

Query  578  ADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDY  399
            ADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDY
Sbjct  89   ADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDY  148

Query  398  LGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEA  219
            LGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEA
Sbjct  149  LGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEA  208

Query  218  FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  39
            FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  209  FAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260