BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF003A04

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764361.1|  PREDICTED: uncharacterized protein LOC104216095    376   8e-129   Nicotiana sylvestris
ref|XP_009607482.1|  PREDICTED: uncharacterized protein LOC104101695    375   2e-128   Nicotiana tomentosiformis
ref|XP_006345847.1|  PREDICTED: uncharacterized protein LOC102602810    371   3e-127   Solanum tuberosum [potatoes]
ref|XP_004239713.1|  PREDICTED: uncharacterized protein LOC101266725    369   3e-126   
ref|XP_011101526.1|  PREDICTED: uncharacterized protein LOC105179587    360   1e-122   Sesamum indicum [beniseed]
gb|EYU32449.1|  hypothetical protein MIMGU_mgv1a012632mg                354   2e-120   Erythranthe guttata [common monkey flower]
ref|XP_011031598.1|  PREDICTED: uncharacterized protein LOC105130...    352   1e-119   Populus euphratica
ref|XP_006379512.1|  hypothetical protein POPTR_0008s03030g             351   3e-119   Populus trichocarpa [western balsam poplar]
ref|XP_006436548.1|  hypothetical protein CICLE_v10032582mg             350   1e-118   
ref|XP_008456550.1|  PREDICTED: uncharacterized protein LOC103496...    347   9e-118   Cucumis melo [Oriental melon]
ref|XP_004159242.1|  PREDICTED: uncharacterized protein SYNPCC700...    347   2e-117   
ref|XP_011024313.1|  PREDICTED: uncharacterized protein LOC105125526    346   2e-117   Populus euphratica
emb|CDO99821.1|  unnamed protein product                                346   4e-117   Coffea canephora [robusta coffee]
ref|XP_002315341.2|  hypothetical protein POPTR_0010s23740g             350   6e-117   
ref|XP_002270872.1|  PREDICTED: uncharacterized protein LOC100249596    345   8e-117   Vitis vinifera
ref|XP_004138686.1|  PREDICTED: uncharacterized protein SYNPCC700...    345   1e-116   Cucumis sativus [cucumbers]
ref|XP_010694519.1|  PREDICTED: uncharacterized protein LOC104907303    344   2e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006398904.1|  hypothetical protein EUTSA_v10014494mg             342   1e-115   Eutrema salsugineum [saltwater cress]
gb|KJB75124.1|  hypothetical protein B456_012G025500                    342   2e-115   Gossypium raimondii
ref|XP_010067191.1|  PREDICTED: uncharacterized protein LOC104454136    341   9e-115   Eucalyptus grandis [rose gum]
ref|XP_009122596.1|  PREDICTED: uncharacterized protein LOC103847290    340   1e-114   Brassica rapa
emb|CDX70224.1|  BnaA10g25730D                                          340   1e-114   
ref|XP_010552941.1|  PREDICTED: uncharacterized protein LOC104823196    340   1e-114   Tarenaya hassleriana [spider flower]
gb|KGN63024.1|  hypothetical protein Csa_2G384440                       338   3e-114   Cucumis sativus [cucumbers]
ref|XP_008232054.1|  PREDICTED: uncharacterized protein LOC103331...    338   5e-114   Prunus mume [ume]
ref|NP_196064.2|  uncharacterized protein                               337   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423577.1|  PREDICTED: uncharacterized protein LOC104708675    337   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010452341.1|  PREDICTED: uncharacterized protein LOC104734455    336   3e-113   Camelina sativa [gold-of-pleasure]
emb|CDY44856.1|  BnaC09g50560D                                          336   4e-113   Brassica napus [oilseed rape]
ref|XP_007218206.1|  hypothetical protein PRUPE_ppa010633mg             335   8e-113   Prunus persica
ref|XP_003518995.1|  PREDICTED: uncharacterized protein LOC100789...    334   1e-112   Glycine max [soybeans]
ref|XP_010490956.1|  PREDICTED: uncharacterized protein LOC104768633    335   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002871094.1|  hypothetical protein ARALYDRAFT_487226             334   2e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_006288505.1|  hypothetical protein CARUB_v10001769mg             334   2e-112   Capsella rubella
ref|XP_007145503.1|  hypothetical protein PHAVU_007G244000g             331   3e-111   Phaseolus vulgaris [French bean]
gb|KDP45068.1|  hypothetical protein JCGZ_01568                         330   6e-111   Jatropha curcas
ref|XP_007010072.1|  Uncharacterized protein TCM_043378                 332   2e-110   
ref|XP_009361429.1|  PREDICTED: uncharacterized protein LOC103951...    328   3e-110   Pyrus x bretschneideri [bai li]
gb|KJB75126.1|  hypothetical protein B456_012G025500                    328   9e-110   Gossypium raimondii
ref|XP_010907449.1|  PREDICTED: uncharacterized protein LOC105034...    327   1e-109   Elaeis guineensis
ref|XP_008375629.1|  PREDICTED: uncharacterized protein LOC103438867    326   3e-109   
gb|KFK24892.1|  hypothetical protein AALP_AA8G038300                    326   4e-109   Arabis alpina [alpine rockcress]
ref|XP_010243183.1|  PREDICTED: uncharacterized protein LOC104587326    322   1e-107   Nelumbo nucifera [Indian lotus]
ref|XP_008794252.1|  PREDICTED: uncharacterized protein LOC103710353    321   1e-107   Phoenix dactylifera
ref|XP_010090431.1|  hypothetical protein L484_007993                   322   3e-107   Morus notabilis
ref|XP_004513748.1|  PREDICTED: uncharacterized protein SYNPCC700...    318   1e-106   Cicer arietinum [garbanzo]
ref|XP_010267293.1|  PREDICTED: uncharacterized protein LOC104604...    316   3e-105   Nelumbo nucifera [Indian lotus]
ref|XP_006588986.1|  PREDICTED: uncharacterized protein LOC100797...    316   4e-105   
ref|XP_006588989.1|  PREDICTED: uncharacterized protein LOC100797...    314   1e-104   
ref|XP_009397623.1|  PREDICTED: uncharacterized protein LOC103982426    313   2e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004308612.1|  PREDICTED: uncharacterized protein LOC101308...    312   5e-104   Fragaria vesca subsp. vesca
gb|AFK45801.1|  unknown                                                 312   5e-104   Medicago truncatula
gb|AES60498.2|  RAP annotation release 2, galactose-binding-like ...    312   6e-104   Medicago truncatula
gb|EPS69171.1|  hypothetical protein M569_05597                         311   1e-103   Genlisea aurea
ref|XP_008812325.1|  PREDICTED: uncharacterized protein LOC103723244    310   3e-103   Phoenix dactylifera
ref|XP_003590247.1|  (RAP Annotation release2) Galactose-binding ...    308   3e-102   
ref|XP_006436550.1|  hypothetical protein CICLE_v10032582mg             305   5e-102   
ref|XP_004985720.1|  PREDICTED: uncharacterized protein LOC101766...    306   1e-101   Setaria italica
ref|XP_010918716.1|  PREDICTED: uncharacterized protein LOC105043023    306   2e-101   Elaeis guineensis
tpg|DAA43360.1|  TPA: hypothetical protein ZEAMMB73_635178              303   2e-100   
ref|NP_001143018.1|  uncharacterized protein LOC100275482               303   2e-100   
gb|KDO45175.1|  hypothetical protein CISIN_1g026771mg                   303   3e-100   Citrus sinensis [apfelsine]
ref|XP_006436547.1|  hypothetical protein CICLE_v10032582mg             301   1e-99    
dbj|BAK01502.1|  predicted protein                                      301   2e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006843095.1|  hypothetical protein AMTR_s00140p00045980          301   2e-99    Amborella trichopoda
ref|NP_001048959.1|  Os03g0146500                                       300   3e-99    
ref|XP_006649399.1|  PREDICTED: uncharacterized protein LOC102703943    300   5e-99    Oryza brachyantha
gb|EEC74517.1|  hypothetical protein OsI_10013                          300   5e-99    Oryza sativa Indica Group [Indian rice]
ref|XP_006485298.1|  PREDICTED: uncharacterized protein LOC102621...    300   1e-98    
ref|XP_011031600.1|  PREDICTED: uncharacterized protein LOC105130...    296   2e-98    Populus euphratica
ref|XP_008456551.1|  PREDICTED: uncharacterized protein LOC103496...    295   2e-98    Cucumis melo [Oriental melon]
ref|XP_003558814.1|  PREDICTED: uncharacterized protein LOC100828535    295   2e-97    Brachypodium distachyon [annual false brome]
emb|CAB85550.1|  putative protein                                       295   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985719.1|  PREDICTED: uncharacterized protein LOC101766...    293   4e-96    
ref|XP_002532619.1|  conserved hypothetical protein                     292   8e-96    
ref|XP_002981218.1|  hypothetical protein SELMODRAFT_178693             292   1e-95    Selaginella moellendorffii
ref|XP_002982688.1|  hypothetical protein SELMODRAFT_58026              289   3e-95    
ref|XP_008232055.1|  PREDICTED: uncharacterized protein LOC103331...    287   6e-95    Prunus mume [ume]
ref|XP_008232056.1|  PREDICTED: uncharacterized protein LOC103331...    282   4e-93    Prunus mume [ume]
ref|XP_006588985.1|  PREDICTED: uncharacterized protein LOC100797...    281   4e-91    Glycine max [soybeans]
ref|XP_006588992.1|  PREDICTED: uncharacterized protein LOC100797...    278   7e-91    
ref|XP_009361430.1|  PREDICTED: uncharacterized protein LOC103951...    276   7e-91    
ref|XP_006588987.1|  PREDICTED: uncharacterized protein LOC100797...    278   1e-90    
ref|XP_006588991.1|  PREDICTED: uncharacterized protein LOC100797...    278   1e-90    
ref|XP_006588988.1|  PREDICTED: uncharacterized protein LOC100797...    278   2e-90    
gb|KHN02048.1|  hypothetical protein glysoja_046281                     277   4e-90    Glycine soja [wild soybean]
ref|XP_011031599.1|  PREDICTED: uncharacterized protein LOC105130...    271   3e-88    Populus euphratica
ref|XP_011469393.1|  PREDICTED: uncharacterized protein LOC101308...    270   2e-87    Fragaria vesca subsp. vesca
dbj|BAG96419.1|  unnamed protein product                                268   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010267294.1|  PREDICTED: uncharacterized protein LOC104604...    268   6e-87    Nelumbo nucifera [Indian lotus]
ref|XP_011469392.1|  PREDICTED: uncharacterized protein LOC101308...    268   7e-87    Fragaria vesca subsp. vesca
ref|XP_001760515.1|  predicted protein                                  262   5e-84    
ref|XP_006575157.1|  PREDICTED: uncharacterized protein LOC100789...    257   4e-83    Glycine max [soybeans]
ref|XP_006485303.1|  PREDICTED: uncharacterized protein LOC102621...    256   4e-82    
ref|XP_006485299.1|  PREDICTED: uncharacterized protein LOC102621...    253   3e-80    
ref|XP_010907451.1|  PREDICTED: uncharacterized protein LOC105034...    250   4e-80    
emb|CDY58441.1|  BnaC03g71250D                                          226   1e-70    Brassica napus [oilseed rape]
ref|XP_003590248.1|  (RAP Annotation release2) Galactose-binding ...    209   3e-64    
gb|KJB75125.1|  hypothetical protein B456_012G025500                    201   5e-61    Gossypium raimondii
gb|KIZ06268.1|  hypothetical protein MNEG_1694                          182   1e-52    Monoraphidium neglectum
emb|CAN67223.1|  hypothetical protein VITISV_029052                     178   4e-52    Vitis vinifera
gb|KDO45176.1|  hypothetical protein CISIN_1g026771mg                   173   9e-51    Citrus sinensis [apfelsine]
ref|XP_011015662.1|  PREDICTED: uncharacterized protein LOC105119235    172   2e-50    Populus euphratica
ref|XP_005650144.1|  hypothetical protein COCSUDRAFT_28145              176   2e-50    Coccomyxa subellipsoidea C-169
ref|XP_001696559.1|  hypothetical protein CHLREDRAFT_142225             176   3e-50    Chlamydomonas reinhardtii
ref|XP_002945783.1|  hypothetical protein VOLCADRAFT_102752             173   1e-49    Volvox carteri f. nagariensis
ref|XP_005844487.1|  hypothetical protein CHLNCDRAFT_138831             173   1e-49    Chlorella variabilis
gb|KDO45174.1|  hypothetical protein CISIN_1g026771mg                   169   1e-48    Citrus sinensis [apfelsine]
ref|XP_011399169.1|  hypothetical protein F751_4766                     142   1e-38    Auxenochlorella protothecoides
ref|XP_002508023.1|  predicted protein                                  132   2e-33    Micromonas commoda
ref|XP_007515807.1|  predicted protein                                  112   3e-25    Bathycoccus prasinos
ref|XP_010278459.1|  PREDICTED: uncharacterized protein LOC104612...    106   8e-24    Nelumbo nucifera [Indian lotus]
ref|XP_010278460.1|  PREDICTED: uncharacterized protein LOC104612...    106   8e-24    Nelumbo nucifera [Indian lotus]
ref|XP_010278461.1|  PREDICTED: uncharacterized protein LOC104612...    105   1e-23    Nelumbo nucifera [Indian lotus]
ref|XP_010278457.1|  PREDICTED: uncharacterized protein LOC104612...    104   4e-23    Nelumbo nucifera [Indian lotus]
ref|XP_010278456.1|  PREDICTED: uncharacterized protein LOC104612...    104   4e-23    Nelumbo nucifera [Indian lotus]
emb|CDY11292.1|  BnaA03g01280D                                          100   9e-23    Brassica napus [oilseed rape]
ref|XP_007011489.1|  Uncharacterized protein TCM_036761                 102   1e-22    
ref|XP_006851017.1|  hypothetical protein AMTR_s00025p00222570          103   1e-22    
ref|XP_003080940.1|  unnamed protein product                            103   1e-22    Ostreococcus tauri
ref|XP_010929424.1|  PREDICTED: uncharacterized protein LOC105050...    102   1e-22    Elaeis guineensis
ref|XP_010525838.1|  PREDICTED: uncharacterized protein LOC104803...    101   3e-22    Tarenaya hassleriana [spider flower]
ref|XP_009132210.1|  PREDICTED: uncharacterized protein LOC103856828    101   6e-22    
ref|XP_006601096.1|  PREDICTED: uncharacterized protein LOC100813...    100   7e-22    
dbj|BAJ86576.1|  predicted protein                                      100   7e-22    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003539141.1|  PREDICTED: uncharacterized protein LOC100803...  99.8    8e-22    
ref|XP_003572385.1|  PREDICTED: uncharacterized protein LOC100842768    100   9e-22    Brachypodium distachyon [annual false brome]
ref|XP_010525837.1|  PREDICTED: uncharacterized protein LOC104803...    100   9e-22    
gb|ADE77926.1|  unknown                                                 101   1e-21    Picea sitchensis
ref|XP_003549214.1|  PREDICTED: uncharacterized protein LOC100813...    100   1e-21    Glycine max [soybeans]
ref|XP_008812689.1|  PREDICTED: uncharacterized protein LOC103723...    100   1e-21    Phoenix dactylifera
ref|XP_006591051.1|  PREDICTED: uncharacterized protein LOC100803...  99.8    2e-21    
ref|XP_008812687.1|  PREDICTED: uncharacterized protein LOC103723...    100   2e-21    Phoenix dactylifera
ref|XP_010447620.1|  PREDICTED: uncharacterized protein LOC104730...  99.4    2e-21    Camelina sativa [gold-of-pleasure]
ref|XP_011003440.1|  PREDICTED: uncharacterized protein LOC105110...  98.2    4e-21    Populus euphratica
emb|CDX72292.1|  BnaC07g43140D                                        98.2    5e-21    
ref|XP_011003439.1|  PREDICTED: uncharacterized protein LOC105110...  98.2    6e-21    Populus euphratica
ref|XP_010447621.1|  PREDICTED: uncharacterized protein LOC104730...  97.8    7e-21    Camelina sativa [gold-of-pleasure]
ref|XP_009137990.1|  PREDICTED: uncharacterized protein LOC103862030  97.4    9e-21    Brassica rapa
ref|XP_009793530.1|  PREDICTED: uncharacterized protein LOC104240...  96.3    2e-20    Nicotiana sylvestris
ref|XP_006284411.1|  hypothetical protein CARUB_v10005582mg           96.7    2e-20    Capsella rubella
gb|AIA25853.1|  hypothetical protein                                  95.9    3e-20    Fargesia spathacea [umbrella bamboo]
ref|XP_002520346.1|  conserved hypothetical protein                   95.5    4e-20    
ref|XP_004246068.1|  PREDICTED: uncharacterized protein LOC101245...  95.5    4e-20    Solanum lycopersicum
emb|CDY13410.1|  BnaA03g51280D                                        95.5    5e-20    Brassica napus [oilseed rape]
ref|XP_007161671.1|  hypothetical protein PHAVU_001G088800g           95.1    6e-20    Phaseolus vulgaris [French bean]
gb|AIA25856.1|  hypothetical protein                                  94.7    7e-20    Phyllostachys nidularia [broom bamboo]
ref|XP_001419223.1|  predicted protein                                94.0    8e-20    Ostreococcus lucimarinus CCE9901
emb|CDP09644.1|  unnamed protein product                              94.7    8e-20    Coffea canephora [robusta coffee]
ref|XP_003058632.1|  predicted protein                                95.5    9e-20    Micromonas pusilla CCMP1545
ref|XP_004973914.1|  PREDICTED: uncharacterized protein LOC101762357  95.1    9e-20    Setaria italica
gb|AIA25860.1|  hypothetical protein                                  94.4    9e-20    Phyllostachys nigra var. henonis
gb|AIA25861.1|  hypothetical protein                                  94.4    1e-19    Phyllostachys edulis [kikko-chiku]
ref|XP_010669557.1|  PREDICTED: uncharacterized protein LOC104886...  93.6    2e-19    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010438082.1|  PREDICTED: uncharacterized protein LOC104721726  93.6    3e-19    Camelina sativa [gold-of-pleasure]
gb|KDP32843.1|  hypothetical protein JCGZ_12135                       93.2    3e-19    Jatropha curcas
ref|XP_006412632.1|  hypothetical protein EUTSA_v10026012mg           92.4    3e-19    
ref|XP_008812688.1|  PREDICTED: uncharacterized protein LOC103723...  93.6    4e-19    Phoenix dactylifera
ref|XP_001757381.1|  predicted protein                                91.7    5e-19    
ref|XP_006412631.1|  hypothetical protein EUTSA_v10026012mg           92.0    8e-19    Eutrema salsugineum [saltwater cress]
ref|XP_006659603.1|  PREDICTED: uncharacterized protein LOC102719139  92.4    8e-19    Oryza brachyantha
ref|XP_009628394.1|  PREDICTED: uncharacterized protein LOC104118...  91.7    9e-19    
tpg|DAA43708.1|  TPA: hypothetical protein ZEAMMB73_804080            90.5    1e-18    
ref|XP_002869344.1|  hypothetical protein ARALYDRAFT_328609           91.7    1e-18    Arabidopsis lyrata subsp. lyrata
ref|XP_003545525.2|  PREDICTED: uncharacterized protein LOC100793...  91.7    1e-18    Glycine max [soybeans]
ref|NP_849478.1|  uncharacterized protein                             91.7    1e-18    Arabidopsis thaliana [mouse-ear cress]
gb|KHN15997.1|  hypothetical protein glysoja_043168                   91.7    1e-18    Glycine soja [wild soybean]
gb|KEH39792.1|  DUF1997 family protein                                90.9    2e-18    Medicago truncatula
ref|XP_010049780.1|  PREDICTED: uncharacterized protein LOC104438...  90.9    2e-18    Eucalyptus grandis [rose gum]
ref|XP_009417802.1|  PREDICTED: uncharacterized protein LOC103998132  90.5    2e-18    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001119084.1|  uncharacterized protein                          91.3    2e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010049779.1|  PREDICTED: uncharacterized protein LOC104438...  90.9    2e-18    Eucalyptus grandis [rose gum]
ref|XP_010432904.1|  PREDICTED: uncharacterized protein LOC104717080  90.9    2e-18    Camelina sativa [gold-of-pleasure]
emb|CBJ28056.1|  conserved unknown protein                            91.7    2e-18    Ectocarpus siliculosus
ref|XP_006483665.1|  PREDICTED: uncharacterized protein LOC102630...  90.9    2e-18    Citrus sinensis [apfelsine]
ref|NP_001062277.1|  Os08g0521800                                     90.9    2e-18    
gb|KEH39793.1|  DUF1997 family protein                                90.9    3e-18    Medicago truncatula
ref|XP_004498601.1|  PREDICTED: uncharacterized protein LOC101493...  89.7    4e-18    
ref|XP_002445875.1|  hypothetical protein SORBIDRAFT_07g027290        89.4    7e-18    Sorghum bicolor [broomcorn]
ref|XP_004498600.1|  PREDICTED: uncharacterized protein LOC101493...  89.4    9e-18    Cicer arietinum [garbanzo]
ref|XP_008663733.1|  PREDICTED: uncharacterized protein LOC103642...  89.4    1e-17    Zea mays [maize]
ref|XP_006483664.1|  PREDICTED: uncharacterized protein LOC102630...  88.6    1e-17    Citrus sinensis [apfelsine]
ref|XP_006450060.1|  hypothetical protein CICLE_v10009318mg           88.6    1e-17    Citrus clementina [clementine]
ref|XP_010648479.1|  PREDICTED: uncharacterized protein LOC100250928  87.0    4e-17    Vitis vinifera
gb|KCW82580.1|  hypothetical protein EUGRSUZ_C03977                   84.7    9e-17    Eucalyptus grandis [rose gum]
ref|XP_006450056.1|  hypothetical protein CICLE_v10009318mg           85.5    1e-16    Citrus clementina [clementine]
gb|KCW82577.1|  hypothetical protein EUGRSUZ_C03977                   84.7    2e-16    Eucalyptus grandis [rose gum]
gb|KCW82578.1|  hypothetical protein EUGRSUZ_C03977                   84.7    2e-16    Eucalyptus grandis [rose gum]
gb|KCW82579.1|  hypothetical protein EUGRSUZ_C03977                   84.3    2e-16    Eucalyptus grandis [rose gum]
ref|XP_011075031.1|  PREDICTED: uncharacterized protein LOC105159...  84.3    4e-16    Sesamum indicum [beniseed]
gb|EMT31097.1|  hypothetical protein F775_01407                       82.0    4e-16    
ref|XP_006483666.1|  PREDICTED: uncharacterized protein LOC102630...  83.6    5e-16    
dbj|BAJ86184.1|  predicted protein                                    82.8    1e-15    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008445108.1|  PREDICTED: uncharacterized protein LOC103488246  82.8    1e-15    Cucumis melo [Oriental melon]
ref|XP_002306644.2|  hypothetical protein POPTR_0005s20200g           83.2    1e-15    
ref|XP_008219816.1|  PREDICTED: uncharacterized protein LOC103319995  82.8    1e-15    Prunus mume [ume]
ref|WP_006632188.1|  hypothetical protein                             81.6    2e-15    Microcoleus vaginatus
ref|XP_008365168.1|  PREDICTED: uncharacterized protein LOC103428...  82.4    2e-15    
ref|WP_007356838.1|  MULTISPECIES: hypothetical protein               81.6    2e-15    Kamptonema
ref|XP_008365169.1|  PREDICTED: uncharacterized protein LOC103428...  82.4    2e-15    
gb|KJB55232.1|  hypothetical protein B456_009G069700                  82.4    2e-15    Gossypium raimondii
gb|KJB55234.1|  hypothetical protein B456_009G069700                  82.4    2e-15    Gossypium raimondii
ref|XP_008365170.1|  PREDICTED: uncharacterized protein LOC103428...  82.4    2e-15    
ref|XP_010095472.1|  hypothetical protein L484_014899                 81.3    3e-15    
ref|XP_007223805.1|  hypothetical protein PRUPE_ppa010657mg           81.6    3e-15    Prunus persica
ref|XP_002991134.1|  hypothetical protein SELMODRAFT_429500           80.9    4e-15    
ref|XP_011003441.1|  PREDICTED: uncharacterized protein LOC105110...  80.9    4e-15    Populus euphratica
ref|WP_009783224.1|  hypothetical protein                             80.5    5e-15    Lyngbya sp. PCC 8106
gb|KJB55231.1|  hypothetical protein B456_009G069700                  80.9    5e-15    Gossypium raimondii
ref|XP_010325657.1|  PREDICTED: uncharacterized protein LOC101245...  80.5    5e-15    Solanum lycopersicum
ref|XP_004138757.1|  PREDICTED: uncharacterized protein LOC101204116  80.9    6e-15    Cucumis sativus [cucumbers]
ref|XP_009793531.1|  PREDICTED: uncharacterized protein LOC104240...  80.1    7e-15    Nicotiana sylvestris
ref|XP_006601098.1|  PREDICTED: uncharacterized protein LOC100813...  79.7    9e-15    
ref|XP_009377348.1|  PREDICTED: uncharacterized protein LOC103965968  80.5    9e-15    
ref|WP_023068083.1|  hypothetical protein                             79.7    1e-14    Lyngbya aestuarii
gb|KGN62886.1|  hypothetical protein Csa_2G379170                     80.5    1e-14    Cucumis sativus [cucumbers]
ref|XP_006591054.1|  PREDICTED: uncharacterized protein LOC100803...  79.3    1e-14    
ref|XP_010325656.1|  PREDICTED: uncharacterized protein LOC101245...  79.7    1e-14    Solanum lycopersicum
gb|KFK29693.1|  hypothetical protein AALP_AA7G166500                  77.4    6e-14    Arabis alpina [alpine rockcress]
ref|XP_009039730.1|  hypothetical protein AURANDRAFT_5676             76.3    8e-14    Aureococcus anophagefferens
gb|KJB55230.1|  hypothetical protein B456_009G069700                  77.0    9e-14    Gossypium raimondii
ref|XP_010929428.1|  PREDICTED: uncharacterized protein LOC105050...  77.0    9e-14    Elaeis guineensis
ref|XP_004296677.1|  PREDICTED: uncharacterized protein LOC101305...  77.4    9e-14    Fragaria vesca subsp. vesca
ref|XP_011462558.1|  PREDICTED: uncharacterized protein LOC101305...  77.0    1e-13    Fragaria vesca subsp. vesca
gb|EYU37480.1|  hypothetical protein MIMGU_mgv1a011869mg              77.0    1e-13    Erythranthe guttata [common monkey flower]
ref|WP_039713949.1|  hypothetical protein                             75.9    2e-13    
ref|WP_015174041.1|  Protein of unknown function DUF1997              75.5    2e-13    Oscillatoria nigro-viridis
ref|WP_015156308.1|  hypothetical protein                             75.1    3e-13    Chroococcidiopsis thermalis
emb|CCH47217.1|  hypothetical protein                                 76.3    3e-13    Lupinus angustifolius
ref|XP_009628396.1|  PREDICTED: uncharacterized protein LOC104118...  75.1    3e-13    Nicotiana tomentosiformis
ref|XP_008812691.1|  PREDICTED: uncharacterized protein LOC103723...  74.7    7e-13    Phoenix dactylifera
ref|XP_006596139.1|  PREDICTED: uncharacterized protein LOC100793...  73.6    1e-12    
ref|WP_015160888.1|  Protein of unknown function (DUF1997)            72.8    2e-12    Chamaesiphon minutus
ref|WP_017718063.1|  hypothetical protein                             72.4    3e-12    Oscillatoria sp. PCC 10802
ref|WP_006456460.1|  hypothetical protein                             72.4    3e-12    Synechococcus sp. PCC 7335
ref|WP_009788862.1|  hypothetical protein                             72.0    4e-12    Synechococcus sp. BL107
gb|EKQ68777.1|  Protein of unknown function (DUF1997)                 72.0    4e-12    Oscillatoriales cyanobacterium JSC-12
ref|XP_010669559.1|  PREDICTED: uncharacterized protein LOC104886...  72.4    4e-12    
ref|WP_036617098.1|  hypothetical protein                             71.6    4e-12    
ref|WP_039726589.1|  MULTISPECIES: hypothetical protein               71.6    5e-12    Lyngbya confervoides
ref|XP_010669561.1|  PREDICTED: uncharacterized protein LOC104886...  71.6    7e-12    
emb|CAK29078.1|  Conserved hypothetical protein                       70.5    1e-11    Synechococcus sp. RCC307
ref|WP_008188841.1|  hypothetical protein                             70.5    1e-11    Moorea producens
ref|WP_043737372.1|  hypothetical protein                             70.5    1e-11    
ref|WP_027840933.1|  hypothetical protein                             70.5    1e-11    Mastigocoleus testarum
ref|WP_014276029.1|  hypothetical protein                             70.1    2e-11    Arthrospira platensis
ref|WP_010468046.1|  hypothetical protein                             69.7    2e-11    Acaryochloris sp. CCMEE 5410
ref|XP_008663740.1|  PREDICTED: uncharacterized protein LOC103642...  70.5    3e-11    Zea mays [maize]
ref|XP_002504818.1|  predicted protein                                70.9    3e-11    Micromonas commoda
ref|WP_041425200.1|  hypothetical protein                             68.9    3e-11    Synechococcus sp. CC9902
gb|ABB26985.1|  conserved hypothetical protein                        68.9    4e-11    Synechococcus sp. CC9902
ref|XP_011075322.1|  PREDICTED: uncharacterized protein LOC105159...  69.3    4e-11    Sesamum indicum [beniseed]
ref|XP_010669560.1|  PREDICTED: uncharacterized protein LOC104886...  69.3    5e-11    
ref|WP_035987698.1|  hypothetical protein                             68.9    5e-11    Leptolyngbya sp. KIOST-1
ref|XP_011075393.1|  PREDICTED: uncharacterized protein LOC105159...  68.6    6e-11    Sesamum indicum [beniseed]
gb|AII47720.1|  hypothetical protein KR52_00860                       68.6    6e-11    Synechococcus sp. KORDI-52
ref|WP_012162365.1|  hypothetical protein                             68.6    7e-11    Acaryochloris marina
ref|WP_015210283.1|  Protein of unknown function (DUF1997)            68.2    7e-11    Cylindrospermum stagnale
ref|WP_026731487.1|  hypothetical protein                             68.2    7e-11    Fischerella sp. PCC 9605
ref|XP_006450055.1|  hypothetical protein CICLE_v10009318mg           68.2    7e-11    
ref|WP_008053494.1|  hypothetical protein                             68.6    7e-11    Arthrospira sp. PCC 8005
gb|KDO67122.1|  hypothetical protein CISIN_1g026171mg                 67.8    8e-11    Citrus sinensis [apfelsine]
ref|WP_006623912.1|  MULTISPECIES: hypothetical protein               68.2    1e-10    Arthrospira
ref|XP_006450058.1|  hypothetical protein CICLE_v10009318mg           67.4    1e-10    
ref|WP_040696294.1|  hypothetical protein                             67.4    1e-10    
gb|KJB47754.1|  hypothetical protein B456_008G040400                  65.1    1e-10    Gossypium raimondii
ref|WP_029633219.1|  hypothetical protein [                           67.4    2e-10    [Scytonema hofmanni] UTEX B 1581
ref|WP_015140407.1|  hypothetical protein                             67.4    2e-10    Nostoc sp. PCC 7524
gb|KJB09911.1|  hypothetical protein B456_001G174500                  66.2    2e-10    Gossypium raimondii
ref|WP_010311904.1|  hypothetical protein                             66.6    2e-10    Synechococcus sp. CB0101
ref|WP_015150341.1|  hypothetical protein                             67.0    2e-10    Oscillatoria acuminata
ref|WP_017311591.1|  hypothetical protein                             67.0    2e-10    Fischerella sp. PCC 9339
ref|XP_008812694.1|  PREDICTED: uncharacterized protein LOC103723...  67.4    2e-10    Phoenix dactylifera
ref|XP_008812692.1|  PREDICTED: uncharacterized protein LOC103723...  67.8    2e-10    Phoenix dactylifera
ref|XP_006450057.1|  hypothetical protein CICLE_v10009318mg           66.6    3e-10    
ref|XP_008812693.1|  PREDICTED: uncharacterized protein LOC103723...  67.0    3e-10    Phoenix dactylifera
ref|XP_010929426.1|  PREDICTED: uncharacterized protein LOC105050...  67.0    3e-10    Elaeis guineensis
ref|WP_016860900.1|  hypothetical protein                             66.2    4e-10    Fischerella muscicola
ref|WP_026719863.1|  hypothetical protein                             66.2    4e-10    Fischerella sp. PCC 9431
ref|WP_015203973.1|  hypothetical protein                             65.1    1e-09    
ref|WP_011128999.1|  hypothetical protein                             64.7    1e-09    
ref|WP_017661849.1|  hypothetical protein                             64.7    1e-09    
ref|WP_041458228.1|  hypothetical protein                             64.7    1e-09    
gb|AFW93583.1|  hypothetical protein ANA_C10789                       64.7    1e-09    
ref|WP_015113502.1|  hypothetical protein                             64.7    1e-09    
ref|WP_026082404.1|  hypothetical protein                             64.3    1e-09    
ref|WP_015185935.1|  hypothetical protein                             64.3    2e-09    
ref|XP_005824975.1|  hypothetical protein GUITHDRAFT_115755           66.2    2e-09    
ref|WP_009456049.1|  MULTISPECIES: hypothetical protein               64.3    2e-09    
ref|WP_041434343.1|  hypothetical protein                             64.3    2e-09    
ref|WP_039742520.1|  hypothetical protein                             64.3    2e-09    
gb|AHF62729.1|  hypothetical protein Syncc8109_0320                   64.3    2e-09    
ref|WP_011820983.1|  hypothetical protein                             63.9    2e-09    
ref|WP_041391623.1|  hypothetical protein                             63.9    2e-09    
gb|ABB34091.1|  conserved hypothetical protein                        63.9    2e-09    
ref|WP_038556642.1|  hypothetical protein                             63.9    2e-09    
gb|ABX09557.1|  conserved hypothetical protein                        63.5    2e-09    
ref|XP_010929427.1|  PREDICTED: uncharacterized protein LOC105050...  64.3    3e-09    
ref|WP_008232931.1|  hypothetical protein                             63.9    3e-09    
ref|WP_036905713.1|  hypothetical protein                             63.5    3e-09    
ref|XP_002970779.1|  hypothetical protein SELMODRAFT_411641           65.5    3e-09    
ref|WP_011824472.1|  hypothetical protein                             63.2    4e-09    
ref|WP_006276049.1|  hypothetical protein                             63.2    4e-09    
ref|WP_016865162.1|  hypothetical protein                             63.2    5e-09    
gb|KIE07514.1|  hypothetical protein DA73_0241285                     62.8    5e-09    
ref|WP_044290760.1|  hypothetical protein                             62.8    6e-09    
ref|WP_006196408.1|  hypothetical protein                             62.4    9e-09    
ref|WP_011318123.1|  hypothetical protein                             62.0    1e-08    
ref|WP_011295414.1|  hypothetical protein                             61.6    1e-08    
ref|XP_001752213.1|  predicted protein                                62.8    2e-08    
gb|AFY53631.1|  Protein of unknown function (DUF1997)                 62.0    2e-08    
ref|WP_041037982.1|  hypothetical protein                             61.6    2e-08    
ref|WP_010998471.1|  hypothetical protein                             61.6    2e-08    
ref|WP_016879255.1|  hypothetical protein                             61.6    2e-08    
ref|WP_009343671.1|  hypothetical protein                             61.6    2e-08    
ref|WP_032522035.1|  hypothetical protein                             60.8    2e-08    
ref|WP_011932298.1|  hypothetical protein                             61.2    2e-08    
ref|WP_006172315.1|  hypothetical protein                             60.8    2e-08    
ref|XP_003060793.1|  predicted protein                                62.8    2e-08    
ref|WP_032525903.1|  hypothetical protein                             60.8    2e-08    
ref|WP_010314612.1|  hypothetical protein                             60.8    3e-08    
ref|WP_015214567.1|  Protein of unknown function DUF1997              60.8    3e-08    
ref|WP_015150342.1|  hypothetical protein                             60.5    4e-08    
ref|WP_019477810.1|  hypothetical protein                             60.5    4e-08    
ref|WP_023075320.1|  hypothetical protein                             60.5    4e-08    
ref|WP_015129160.1|  hypothetical protein                             60.5    4e-08    
gb|KJB55233.1|  hypothetical protein B456_009G069700                  60.5    4e-08    
ref|WP_011610330.1|  hypothetical protein                             60.5    5e-08    
ref|WP_006515827.1|  Protein of unknown function (DUF1997)            59.7    6e-08    
ref|WP_038655484.1|  hypothetical protein                             59.3    7e-08    
ref|WP_019479894.1|  hypothetical protein                             59.3    8e-08    
gb|EAU72775.1|  hypothetical protein RS9916_39606                     59.7    8e-08    
gb|AIQ98100.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  59.3    8e-08    
ref|WP_038023808.1|  hypothetical protein                             59.3    9e-08    
ref|WP_007100679.1|  hypothetical protein                             59.3    9e-08    
ref|WP_036923472.1|  hypothetical protein                             59.3    9e-08    
ref|WP_016872462.1|  hypothetical protein                             59.7    1e-07    
ref|WP_009633773.1|  Protein of unknown function (DUF1997)            59.3    1e-07    
gb|KGG03075.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  58.9    1e-07    
ref|WP_036002512.1|  hypothetical protein                             59.3    1e-07    
ref|WP_032517835.1|  hypothetical protein                             58.9    1e-07    
ref|WP_028083388.1|  hypothetical protein                             59.3    1e-07    
ref|WP_017746074.1|  hypothetical protein                             59.3    1e-07    
ref|WP_028091355.1|  hypothetical protein                             59.3    1e-07    
ref|WP_027401435.1|  hypothetical protein                             58.9    2e-07    
ref|WP_019475406.1|  hypothetical protein                             58.5    2e-07    
ref|WP_011618348.1|  hypothetical protein                             58.9    2e-07    
ref|WP_013190152.1|  hypothetical protein                             58.5    2e-07    
ref|WP_036899620.1|  hypothetical protein                             58.2    2e-07    
ref|WP_032513802.1|  hypothetical protein                             57.8    3e-07    
ref|WP_011125809.1|  hypothetical protein                             57.8    3e-07    
ref|WP_025937621.1|  hypothetical protein                             57.8    3e-07    
ref|WP_017652911.1|  hypothetical protein                             58.2    3e-07    
ref|WP_036892520.1|  MULTISPECIES: hypothetical protein               57.8    3e-07    
ref|WP_011377137.1|  hypothetical protein                             57.8    3e-07    
ref|WP_024124759.1|  protein of unknown function DUF1997              58.2    3e-07    
ref|WP_038014885.1|  hypothetical protein                             57.8    3e-07    
gb|EHA59267.1|  Protein of unknown function DUF1997                   57.8    4e-07    
ref|WP_025915113.1|  hypothetical protein                             57.4    4e-07    
ref|WP_032525037.1|  hypothetical protein                             57.0    5e-07    
gb|KGF98638.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  56.6    5e-07    
ref|WP_006103274.1|  hypothetical protein                             57.4    5e-07    
ref|WP_036901051.1|  hypothetical protein                             57.0    5e-07    
ref|WP_015187932.1|  Protein of unknown function DUF1997              57.4    6e-07    
ref|WP_017320521.1|  hypothetical protein                             57.0    7e-07    
gb|ESA35392.1|  hypothetical protein N836_11855                       56.6    8e-07    
ref|WP_025930900.1|  hypothetical protein                             56.6    9e-07    
ref|WP_015197211.1|  hypothetical protein                             56.6    1e-06    
ref|WP_036919773.1|  MULTISPECIES: hypothetical protein               56.2    1e-06    
gb|KGG14733.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  56.6    1e-06    
ref|WP_025923570.1|  hypothetical protein                             56.2    1e-06    
ref|WP_012629760.1|  hypothetical protein                             56.6    1e-06    
ref|WP_008310469.1|  Protein of unknown function (DUF1997)            56.6    1e-06    
ref|WP_012597469.1|  hypothetical protein                             56.2    1e-06    
ref|WP_017323017.1|  hypothetical protein                             56.6    1e-06    
ref|WP_019493942.1|  hypothetical protein                             56.6    1e-06    
ref|WP_006528850.1|  Protein of unknown function (DUF1997)            56.6    1e-06    
gb|KGF91311.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  55.1    2e-06    
ref|XP_007511587.1|  predicted protein                                57.0    2e-06    
ref|WP_036530426.1|  hypothetical protein                             55.8    2e-06    
ref|WP_017288048.1|  hypothetical protein                             55.8    2e-06    
ref|WP_025956184.1|  MULTISPECIES: hypothetical protein               55.5    2e-06    
ref|WP_034417779.1|  hypothetical protein                             55.5    2e-06    
ref|XP_001417332.1|  predicted protein                                56.6    2e-06    
ref|WP_025943413.1|  hypothetical protein                             55.5    2e-06    
ref|WP_011863614.1|  hypothetical protein                             55.1    3e-06    
ref|WP_025927037.1|  MULTISPECIES: hypothetical protein               55.1    3e-06    
ref|WP_015109456.1|  hypothetical protein                             55.1    3e-06    
ref|WP_013322227.1|  hypothetical protein                             55.1    3e-06    
ref|WP_006042269.1|  hypothetical protein                             55.1    4e-06    
ref|WP_025934007.1|  hypothetical protein                             54.7    4e-06    
ref|WP_032516035.1|  hypothetical protein                             54.7    4e-06    
ref|WP_007306803.1|  hypothetical protein                             55.1    5e-06    
ref|WP_011057548.1|  hypothetical protein                             54.7    6e-06    
ref|WP_011819117.1|  hypothetical protein                             54.3    6e-06    
ref|WP_042851044.1|  hypothetical protein                             54.3    6e-06    
ref|WP_018396032.1|  hypothetical protein                             54.7    6e-06    
ref|WP_019508357.1|  hypothetical protein                             54.7    6e-06    
ref|WP_015225018.1|  hypothetical protein                             54.3    7e-06    
ref|WP_025929525.1|  hypothetical protein                             53.9    7e-06    
ref|WP_025944897.1|  hypothetical protein                             53.9    7e-06    
ref|WP_025962646.1|  hypothetical protein                             53.9    8e-06    
ref|WP_025882416.1|  MULTISPECIES: hypothetical protein               53.9    8e-06    
ref|WP_025928865.1|  MULTISPECIES: hypothetical protein               53.9    8e-06    
ref|WP_036053741.1|  hypothetical protein                             53.9    8e-06    
ref|WP_032520101.1|  hypothetical protein                             53.9    8e-06    
ref|WP_016950606.1|  hypothetical protein                             54.3    9e-06    
ref|WP_043368804.1|  hypothetical protein                             53.5    1e-05    
ref|WP_025895024.1|  MULTISPECIES: hypothetical protein               53.5    1e-05    
ref|WP_019499638.1|  hypothetical protein                             53.9    1e-05    
ref|WP_025972561.1|  hypothetical protein                             53.5    1e-05    
tpg|DAA39592.1|  TPA: hypothetical protein ZEAMMB73_670171            53.9    1e-05    
ref|WP_025913869.1|  hypothetical protein                             53.1    2e-05    
gb|EJK48002.1|  hypothetical protein THAOC_33240                      53.9    2e-05    
gb|KGG24281.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  53.1    2e-05    
ref|WP_025963935.1|  hypothetical protein                             52.8    2e-05    
ref|WP_012410242.1|  hypothetical protein                             53.1    2e-05    
ref|WP_026795816.1|  MULTISPECIES: hypothetical protein               53.1    2e-05    
ref|WP_033829840.1|  hypothetical protein                             52.8    2e-05    
ref|WP_036915946.1|  MULTISPECIES: hypothetical protein               52.8    2e-05    
ref|WP_012008400.1|  hypothetical protein                             52.4    3e-05    
ref|XP_003078948.1|  putative eukaryotic translati (ISS)              54.3    3e-05    
emb|CEF97694.1|  unnamed product                                      53.9    3e-05    
gb|KGG08781.1|  Nucleoside-diphosphate-sugar pyrophosphorylase in...  51.6    3e-05    
ref|WP_041431721.1|  hypothetical protein                             52.0    4e-05    
gb|AFZ51403.1|  Protein of unknown function (DUF1997)                 52.8    4e-05    
ref|WP_015145987.1|  hypothetical protein                             52.4    5e-05    
gb|AFY62456.1|  Protein of unknown function (DUF1997)                 52.0    5e-05    
ref|WP_012307204.1|  MULTISPECIES: hypothetical protein               52.0    5e-05    
gb|ABM79103.1|  conserved hypothetical protein                        51.6    9e-05    
ref|WP_041374926.1|  hypothetical protein                             51.2    9e-05    
ref|WP_042153762.1|  hypothetical protein                             51.2    1e-04    
ref|WP_026785577.1|  MULTISPECIES: hypothetical protein               51.2    1e-04    
gb|KDO67123.1|  hypothetical protein CISIN_1g026171mg                 50.4    1e-04    
ref|WP_015783464.1|  hypothetical protein                             50.8    1e-04    
ref|WP_004268487.1|  hypothetical protein                             50.8    2e-04    
ref|WP_007311901.1|  hypothetical protein                             50.4    2e-04    
ref|WP_002768721.1|  hypothetical protein                             50.4    2e-04    
ref|WP_008204908.1|  hypothetical protein                             50.4    2e-04    
gb|ADE77171.1|  unknown                                               50.8    2e-04    
ref|XP_006450054.1|  hypothetical protein CICLE_v10009318mg           49.3    3e-04    
ref|WP_041235505.1|  hypothetical protein                             50.1    3e-04    
gb|KIJ81480.1|  hypothetical protein SD80_27050                       50.1    3e-04    
ref|WP_040929903.1|  hypothetical protein                             50.1    3e-04    
ref|WP_011133131.1|  hypothetical protein                             49.7    3e-04    
gb|KJB55227.1|  hypothetical protein B456_009G069700                  50.1    3e-04    
ref|WP_006511458.1|  Protein of unknown function (DUF1997)            49.3    5e-04    
emb|CAE21962.1|  conserved hypothetical protein                       49.3    6e-04    
ref|WP_036487640.1|  hypothetical protein                             48.9    6e-04    
ref|WP_012594416.1|  hypothetical protein                             49.3    6e-04    
ref|WP_041385205.1|  hypothetical protein                             48.9    6e-04    
ref|WP_002798924.1|  hypothetical protein                             48.9    7e-04    
gb|EWM21006.1|  Protein of unknown function DUF1997                   50.1    7e-04    
ref|WP_002761962.1|  hypothetical protein                             48.9    7e-04    
ref|WP_012265857.1|  hypothetical protein                             48.9    7e-04    
ref|WP_035830935.1|  hypothetical protein                             48.1    8e-04    
ref|WP_002782837.1|  hypothetical protein                             48.5    8e-04    
ref|WP_002793930.1|  hypothetical protein                             48.5    8e-04    
ref|WP_002733111.1|  hypothetical protein                             48.5    9e-04    
tpg|DAA38234.1|  TPA: hypothetical protein ZEAMMB73_927474            49.7    0.001    



>ref|XP_009764361.1| PREDICTED: uncharacterized protein LOC104216095 [Nicotiana sylvestris]
Length=247

 Score =   376 bits (965),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            S D  + SLRI+AD+APK RFIARRKES+SV+QLQRPLMEYMSLPASQYSVLDAERIERV
Sbjct  41   SDDYSKRSLRITADSAPKARFIARRKESLSVKQLQRPLMEYMSLPASQYSVLDAERIERV  100

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            DD+TFRCYVYRFKFFAFEVCPVLLVRVE QPDGC I LLSCKLEGSPIVVAQNDKFDASM
Sbjct  101  DDSTFRCYVYRFKFFAFEVCPVLLVRVEVQPDGCCIKLLSCKLEGSPIVVAQNDKFDASM  160

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VN+ISYD  RRDS VQ+LTSDAVIEVNIE+PFAFRA+PVQAIESTGAQVL+QIL IMLPR
Sbjct  161  VNKISYDSGRRDSPVQQLTSDAVIEVNIEIPFAFRAIPVQAIESTGAQVLDQILRIMLPR  220

Query  137  FMAQLVKDYQAWATGDTSRQPLGTGQI  57
            FMAQL KDYQAWA+GDTSRQPLGTGQI
Sbjct  221  FMAQLAKDYQAWASGDTSRQPLGTGQI  247



>ref|XP_009607482.1| PREDICTED: uncharacterized protein LOC104101695 [Nicotiana tomentosiformis]
Length=247

 Score =   375 bits (963),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            LRI+AD+APK RFIARRKES+SV+QLQRPLMEYMSLPASQYSVLDAERIERVDD+TFRCY
Sbjct  49   LRITADSAPKARFIARRKESLSVKQLQRPLMEYMSLPASQYSVLDAERIERVDDSTFRCY  108

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQNDKFDASMVN+ISYD 
Sbjct  109  VYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNDKFDASMVNKISYDS  168

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             RRDS VQ+LTSDAVIEVNIE+PFAFRA+PVQAIESTGAQVL+QIL IMLPRFMAQL KD
Sbjct  169  GRRDSPVQQLTSDAVIEVNIEIPFAFRAIPVQAIESTGAQVLDQILRIMLPRFMAQLAKD  228

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTGQI
Sbjct  229  YQAWASGDTSRQPLGTGQI  247



>ref|XP_006345847.1| PREDICTED: uncharacterized protein LOC102602810 [Solanum tuberosum]
Length=238

 Score =   371 bits (953),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 195/208 (94%), Gaps = 1/208 (0%)
 Frame = -1

Query  677  SYDSPR-GSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIER  501
            S DS +  +LRI+AD+APK RFI RRKES+SV+QLQRPLMEYMSLPASQYSVLDAERIER
Sbjct  31   SVDSSKCTTLRITADSAPKARFIGRRKESLSVKQLQRPLMEYMSLPASQYSVLDAERIER  90

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            VDD+TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQNDKFDAS
Sbjct  91   VDDSTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNDKFDAS  150

Query  320  MVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLP  141
            MVN+ISYD  +RDS +Q+LTSDAVIEVNIE+PFAFRA+PVQAIESTG+QVL+QIL IMLP
Sbjct  151  MVNKISYDSKQRDSPLQQLTSDAVIEVNIEIPFAFRAIPVQAIESTGSQVLDQILRIMLP  210

Query  140  RFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            RFMAQLVKDYQAWA+GD SRQPLGTGQI
Sbjct  211  RFMAQLVKDYQAWASGDASRQPLGTGQI  238



>ref|XP_004239713.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
 ref|XP_010321338.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
 ref|XP_010321339.1| PREDICTED: uncharacterized protein LOC101266725 [Solanum lycopersicum]
Length=238

 Score =   369 bits (947),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 1/208 (0%)
 Frame = -1

Query  677  SYDSPR-GSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIER  501
            S DS +  +LRI+AD+APK RFI RRKES+SV+QLQRPLMEYMSLPASQYSVLDAERIER
Sbjct  31   SVDSSKCTTLRITADSAPKARFIGRRKESLSVKQLQRPLMEYMSLPASQYSVLDAERIER  90

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            VDD+TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQNDKFDAS
Sbjct  91   VDDSTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNDKFDAS  150

Query  320  MVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLP  141
            MVN+ISYD   RDS +Q+LTSDA+IEVNIE+P AFRA+PVQAIESTG+QVL+QIL IMLP
Sbjct  151  MVNKISYDSKLRDSPLQQLTSDAIIEVNIEIPVAFRAIPVQAIESTGSQVLDQILRIMLP  210

Query  140  RFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            RFMAQLVKDYQAWA+GDTSRQPLGTGQI
Sbjct  211  RFMAQLVKDYQAWASGDTSRQPLGTGQI  238



>ref|XP_011101526.1| PREDICTED: uncharacterized protein LOC105179587 [Sesamum indicum]
Length=244

 Score =   360 bits (924),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            +LRISAD+APK RF+ARR ESVSVRQLQRPL EYMSLPASQYSVLDAERIERVDDNTFRC
Sbjct  45   TLRISADSAPKARFVARRTESVSVRQLQRPLTEYMSLPASQYSVLDAERIERVDDNTFRC  104

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQNDKFDASM N+IS D
Sbjct  105  YVYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNDKFDASMENKISCD  164

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
              +RDS VQ+LTSDAVIEV+IE+PFAFRA+P Q IESTG+QVL QIL  MLPRFM+QLVK
Sbjct  165  STKRDSPVQRLTSDAVIEVSIEIPFAFRAIPAQVIESTGSQVLEQILKAMLPRFMSQLVK  224

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DYQAWA+GDTSRQPLGTG+I
Sbjct  225  DYQAWASGDTSRQPLGTGEI  244



>gb|EYU32449.1| hypothetical protein MIMGU_mgv1a012632mg [Erythranthe guttata]
Length=245

 Score =   354 bits (909),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYV  471
            RISAD++PK RF+ARR ESVSVRQLQRPL+EYMSLPASQYSVLDAERIER+DD+TFRCYV
Sbjct  48   RISADSSPKARFVARRTESVSVRQLQRPLIEYMSLPASQYSVLDAERIERIDDSTFRCYV  107

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            YRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASM N+IS D  
Sbjct  108  YRFKFFAFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMENKISCDST  167

Query  290  RRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
            R DS VQKLTSDAVIEVNIE+PFAFRA+P QAIESTG+QVL QIL  MLPRFM+QL+KDY
Sbjct  168  RGDSSVQKLTSDAVIEVNIEIPFAFRAIPTQAIESTGSQVLEQILKAMLPRFMSQLMKDY  227

Query  110  QAWATGDTSRQPLGTGQI  57
            +AWA+GDTSRQPLGTG+I
Sbjct  228  EAWASGDTSRQPLGTGEI  245



>ref|XP_011031598.1| PREDICTED: uncharacterized protein LOC105130684 isoform X1 [Populus 
euphratica]
Length=243

 Score =   352 bits (904),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            SLR SAD+ PK +F+ARRKESVSVRQL RPLMEYMSLPASQYSVLDAERIERVDDNTFRC
Sbjct  44   SLRASADSTPKAKFVARRKESVSVRQLGRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  103

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVY FKFFAFE+CPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQN+KFDASMVN+IS D
Sbjct  104  YVYSFKFFAFEICPVLLVRVEEQPDGCCIRLLSCKLEGSPIVVAQNEKFDASMVNQISCD  163

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             N+ +S +Q+LTSDAVIEV+I++PFAFRA+P +AIESTGAQ+L QILG +LPRFMAQLVK
Sbjct  164  SNQSNSTIQQLTSDAVIEVSIDIPFAFRAIPTEAIESTGAQILQQILGQILPRFMAQLVK  223

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DY AWA+GD SRQPLGTG+I
Sbjct  224  DYHAWASGDASRQPLGTGEI  243



>ref|XP_006379512.1| hypothetical protein POPTR_0008s03030g [Populus trichocarpa]
 gb|ERP57309.1| hypothetical protein POPTR_0008s03030g [Populus trichocarpa]
Length=243

 Score =   351 bits (901),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            SLR+SAD+ PK +F+ARRKESVSVRQL RPLMEYMSLPASQYSVLDAERIERVDDNTFRC
Sbjct  44   SLRVSADSTPKAKFVARRKESVSVRQLGRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  103

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVY FKFFAFE+CPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQN+KFDA MVN+IS D
Sbjct  104  YVYSFKFFAFEICPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNEKFDAYMVNQISCD  163

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             N+ +S +Q+LTSDAVIEV+I++PFAFRA+P +AIESTGAQ+L QILG +LPRFMAQLVK
Sbjct  164  SNQSNSTIQQLTSDAVIEVSIDIPFAFRAIPAEAIESTGAQILKQILGQILPRFMAQLVK  223

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DY AWA+GD SRQPLGTG+I
Sbjct  224  DYHAWASGDASRQPLGTGEI  243



>ref|XP_006436548.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
 ref|XP_006436549.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
 ref|XP_006485300.1| PREDICTED: uncharacterized protein LOC102621133 isoform X3 [Citrus 
sinensis]
 ref|XP_006485301.1| PREDICTED: uncharacterized protein LOC102621133 isoform X4 [Citrus 
sinensis]
 ref|XP_006485302.1| PREDICTED: uncharacterized protein LOC102621133 isoform X5 [Citrus 
sinensis]
 gb|ESR49788.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
 gb|ESR49789.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
Length=243

 Score =   350 bits (898),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+A RKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVASRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASM+NRI
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMINRI  160

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+AIES+G QVL+QIL +MLPRFM+Q
Sbjct  161  SCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESSGTQVLDQILKLMLPRFMSQ  220

Query  125  LVKDYQAWATGDTSRQPLGTGQI  57
            LVKDYQAWATGDTSRQPLGTG+I
Sbjct  221  LVKDYQAWATGDTSRQPLGTGEI  243



>ref|XP_008456550.1| PREDICTED: uncharacterized protein LOC103496471 isoform X1 [Cucumis 
melo]
Length=242

 Score =   347 bits (891),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            DS R SL IS ++ PK RF+ARR ESV+VRQL+RPL EYMSLPASQYSVLDAERIER+DD
Sbjct  38   DSTRPSLPISTNSNPKARFVARRSESVTVRQLERPLNEYMSLPASQYSVLDAERIERIDD  97

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
             TFRCYVYRFKFFAFEVCPVL+VRVE QP+GC I LLSCKLEGSPIVVAQNDKFDA MVN
Sbjct  98   CTFRCYVYRFKFFAFEVCPVLVVRVELQPNGCCIKLLSCKLEGSPIVVAQNDKFDAYMVN  157

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +ISYD NR +S +QKLTSD VIEVNIE+PFAFRA+PVQAIES G QVL QIL +MLPRF+
Sbjct  158  QISYDVNRGNSPLQKLTSDTVIEVNIEIPFAFRAIPVQAIESAGTQVLEQILKLMLPRFI  217

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
            AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  218  AQLVKDYQAWASGDTSRQPLGTGEI  242



>ref|XP_004159242.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590-like [Cucumis 
sativus]
Length=242

 Score =   347 bits (889),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            DS R SL IS ++ PK RFIARR ESV+VRQL RPL EYMSLPASQYSVLDAERIER+DD
Sbjct  38   DSTRPSLPISTNSNPKARFIARRSESVTVRQLARPLNEYMSLPASQYSVLDAERIERIDD  97

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
             TFRC+VYRFKFFAFEVCPVL+V+VE QP+GC I LLSCKLEGSPIVVAQNDKFDASMVN
Sbjct  98   CTFRCHVYRFKFFAFEVCPVLVVKVELQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMVN  157

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +ISYD NR +S +QKLTSD VIEVNIE+PFAFRA+PVQAIES G QVL QIL +MLPRF 
Sbjct  158  QISYDVNRGNSLLQKLTSDTVIEVNIEIPFAFRAIPVQAIESAGTQVLEQILKLMLPRFT  217

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
            AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  218  AQLVKDYQAWASGDTSRQPLGTGEI  242



>ref|XP_011024313.1| PREDICTED: uncharacterized protein LOC105125526 [Populus euphratica]
Length=233

 Score =   346 bits (888),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/205 (82%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            + P+ +LR SAD+APK +FIARR+ESVSVRQL RPL+EYMSLPASQYSVLDAERIERVDD
Sbjct  29   EYPKCTLRASADSAPKAKFIARRRESVSVRQLGRPLVEYMSLPASQYSVLDAERIERVDD  88

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NTFRCYVYRFKFFAFEVCPVLLVRVEEQP GC I LLSCKLEGSPIVVAQN+KFDASMVN
Sbjct  89   NTFRCYVYRFKFFAFEVCPVLLVRVEEQPTGCCIKLLSCKLEGSPIVVAQNEKFDASMVN  148

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +IS   N  +S +Q+LTSDAVIEV+IEVPFA RA+P +AIESTGAQ+L QILG+MLPRFM
Sbjct  149  QISCSSNSSNSTMQRLTSDAVIEVSIEVPFAIRAIPAEAIESTGAQILQQILGLMLPRFM  208

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
            AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  209  AQLVKDYQAWASGDTSRQPLGTGEI  233



>emb|CDO99821.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   346 bits (887),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -1

Query  671  DSPRGSLRISAD-AAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVD  495
            DS + S+RISAD AAPK RF+ARR ESVSVRQL+RPL EYMSLPASQYSVLDAERIERVD
Sbjct  33   DSSKSSVRISADSAAPKARFVARRTESVSVRQLKRPLGEYMSLPASQYSVLDAERIERVD  92

Query  494  DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMV  315
            D+TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQN+KFDASM 
Sbjct  93   DSTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIVVAQNNKFDASME  152

Query  314  NRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
            N+I YD ++ +  VQ+LTSDAVIEV+IE+PF F+ALP  AIESTG QVL Q+L IMLPRF
Sbjct  153  NKIKYDTSKSEVPVQQLTSDAVIEVSIEIPFPFQALPKAAIESTGTQVLGQVLRIMLPRF  212

Query  134  MAQLVKDYQAWATGDTSRQPLGTGQI  57
            MAQLVKDY AWA+GDTSRQPLGTG+I
Sbjct  213  MAQLVKDYHAWASGDTSRQPLGTGKI  238



>ref|XP_002315341.2| hypothetical protein POPTR_0010s23740g [Populus trichocarpa]
 gb|EEF01512.2| hypothetical protein POPTR_0010s23740g [Populus trichocarpa]
Length=356

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            P+ +LR SAD+APK +FIARR+ESVSVRQL RPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  154  PKCTLRASADSAPKAKFIARRRESVSVRQLGRPLVEYMSLPASQYSVLDAERIERVDDNT  213

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQN+KFDASMVN+I
Sbjct  214  FRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNEKFDASMVNQI  273

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S   N  +S +Q+LTSDAVIEV+IEVPFA RA+P +AIESTGAQ+L QILG+MLPRFMAQ
Sbjct  274  SCSSNSSNSTMQRLTSDAVIEVSIEVPFAIRAIPAEAIESTGAQILQQILGLMLPRFMAQ  333

Query  125  LVKDYQAWATGDTSRQPLGTGQI  57
            LVKDYQAWA+GDTSRQPLGTG+I
Sbjct  334  LVKDYQAWASGDTSRQPLGTGEI  356



>ref|XP_002270872.1| PREDICTED: uncharacterized protein LOC100249596 [Vitis vinifera]
 emb|CBI31380.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   345 bits (885),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/205 (80%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            +S + S RISAD APK RF+ARR+ESVSV+QL+RPL+EYMSLPASQYSVLDAERIERVDD
Sbjct  35   ESSKPSFRISADLAPKARFVARRRESVSVKQLERPLVEYMSLPASQYSVLDAERIERVDD  94

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NTFRCYVYRF+FFAFEVCPVL+V+VEEQP+GC I LLSCKLEGSP+VVAQN+KF ASMVN
Sbjct  95   NTFRCYVYRFRFFAFEVCPVLMVKVEEQPNGCCIRLLSCKLEGSPVVVAQNEKFHASMVN  154

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +IS D N+ +S VQ+LTSD VIEV I++PF FRA+PV+AIESTGAQVL QIL IMLPRFM
Sbjct  155  KISCDSNQSNSLVQQLTSDTVIEVIIDIPFPFRAIPVEAIESTGAQVLEQILRIMLPRFM  214

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
            AQLVKDYQ+WA+GD SRQPLGTG+I
Sbjct  215  AQLVKDYQSWASGDASRQPLGTGEI  239



>ref|XP_004138686.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590-like [Cucumis 
sativus]
Length=242

 Score =   345 bits (884),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            DS R SL IS ++ PK RFIARR ESV+VRQL RPL EYMSLPASQYSVLDAERIER+DD
Sbjct  38   DSTRPSLPISTNSNPKARFIARRSESVTVRQLARPLNEYMSLPASQYSVLDAERIERIDD  97

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
             TFRC+VYRFKFFAFEVCPVL+V+VE QP+GC I LLSCKLEGSPIVVAQNDKFDASMVN
Sbjct  98   CTFRCHVYRFKFFAFEVCPVLVVKVELQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMVN  157

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +ISYD NR +S  QKLTSD VIEVNIE+PFAFRA+PVQAIES G QVL QIL +MLPRF 
Sbjct  158  QISYDVNRGNSLWQKLTSDTVIEVNIEIPFAFRAIPVQAIESAGTQVLEQILKLMLPRFT  217

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
            AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  218  AQLVKDYQAWASGDTSRQPLGTGEI  242



>ref|XP_010694519.1| PREDICTED: uncharacterized protein LOC104907303 [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   344 bits (883),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
             RIS+D APK RF+ARRKE++SV+QLQRPL+EYMSLPASQYSVLDAERIERVD NTFRCY
Sbjct  50   FRISSDLAPKARFVARRKETLSVQQLQRPLLEYMSLPASQYSVLDAERIERVDKNTFRCY  109

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VYRFKFF+FEVCPVLLVRVEEQPDGC I LLSCKLEGSP VVAQNDKF+ASMVN +S D 
Sbjct  110  VYRFKFFSFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPTVVAQNDKFEASMVNLLSCDS  169

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             + +SG+Q+LTSDAVIEV+I+VPF  RALPVQ IES+GA+VL+QIL IMLPRFM QLVKD
Sbjct  170  KQSNSGIQQLTSDAVIEVSIDVPFPLRALPVQMIESSGARVLDQILVIMLPRFMEQLVKD  229

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTGQI
Sbjct  230  YQAWASGDTSRQPLGTGQI  248



>ref|XP_006398904.1| hypothetical protein EUTSA_v10014494mg [Eutrema salsugineum]
 gb|ESQ40357.1| hypothetical protein EUTSA_v10014494mg [Eutrema salsugineum]
Length=250

 Score =   342 bits (878),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ AAPK RF+AR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  52   IRVSSSAAPKARFVARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  111

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S DG
Sbjct  112  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDG  171

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KD
Sbjct  172  TQEGSSEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILRLMLPRFLSQLSKD  231

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  232  YQAWASGDTSRQPLGTGEI  250



>gb|KJB75124.1| hypothetical protein B456_012G025500 [Gossypium raimondii]
Length=236

 Score =   342 bits (876),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  644  SADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  465
            + D+ PK RF+ARRKES+SVRQL RPL+EYMSLPASQYSVLDAERIERVDDNTFRCYVYR
Sbjct  41   ATDSPPKARFVARRKESISVRQLNRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  100

Query  464  FKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRR  285
            FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASMVNRIS +  R 
Sbjct  101  FKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMVNRISCNTIRN  160

Query  284  DSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQA  105
            DS VQ+LTSDAVIEVNIEVPFAFR +P+  IES+G QVL QIL +MLPRFMAQLVKDYQA
Sbjct  161  DSLVQELTSDAVIEVNIEVPFAFRPIPLGMIESSGTQVLEQILRLMLPRFMAQLVKDYQA  220

Query  104  WATGDTSRQPLGTGQI  57
            WA+GDTSRQPLGTG+I
Sbjct  221  WASGDTSRQPLGTGEI  236



>ref|XP_010067191.1| PREDICTED: uncharacterized protein LOC104454136 [Eucalyptus grandis]
Length=271

 Score =   341 bits (875),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            LRI+A + PK RF+ARRKESVSVRQL RPL EYMSLPASQYSVLDAERIERVDD TFRCY
Sbjct  73   LRIAAASNPKARFVARRKESVSVRQLDRPLSEYMSLPASQYSVLDAERIERVDDKTFRCY  132

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VYRFKFFAFEVCPVLLVRVEEQPDGC I LLSCKLEGSPI+ AQNDKFDASMVNRIS + 
Sbjct  133  VYRFKFFAFEVCPVLLVRVEEQPDGCCIKLLSCKLEGSPIIAAQNDKFDASMVNRISCES  192

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +R S +Q+LTSD  IEV+I++PFAF+A+PVQAIES+G Q+L QIL IMLPRFM QLVKD
Sbjct  193  YQRTSSLQQLTSDTTIEVSIDIPFAFQAIPVQAIESSGTQILEQILRIMLPRFMTQLVKD  252

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  253  YQAWASGDTSRQPLGTGKI  271



>ref|XP_009122596.1| PREDICTED: uncharacterized protein LOC103847290 [Brassica rapa]
Length=253

 Score =   340 bits (872),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYV  471
            R+S+ +APK RF+AR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCYV
Sbjct  56   RVSSSSAPKARFVARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYV  115

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            Y FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S DG 
Sbjct  116  YTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDGT  175

Query  290  RRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
            +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KDY
Sbjct  176  QEGSLEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILRLMLPRFLSQLSKDY  235

Query  110  QAWATGDTSRQPLGTGQI  57
            QAWA+GDTSRQPLGTG+I
Sbjct  236  QAWASGDTSRQPLGTGEI  253



>emb|CDX70224.1| BnaA10g25730D [Brassica napus]
Length=253

 Score =   340 bits (872),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYV  471
            R+S+ +APK RF+AR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCYV
Sbjct  56   RVSSSSAPKARFVARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYV  115

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            Y FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S DG 
Sbjct  116  YTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDGT  175

Query  290  RRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
            +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KDY
Sbjct  176  QEGSLEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILRLMLPRFLSQLSKDY  235

Query  110  QAWATGDTSRQPLGTGQI  57
            QAWA+GDTSRQPLGTG+I
Sbjct  236  QAWASGDTSRQPLGTGEI  253



>ref|XP_010552941.1| PREDICTED: uncharacterized protein LOC104823196 [Tarenaya hassleriana]
Length=258

 Score =   340 bits (872),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            LR+S+ +APK RFIARRKE+VSVRQLQRPL+EYMSLPASQYSVLDAERIERVD+NTFRCY
Sbjct  60   LRVSSRSAPKARFIARRKEAVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDENTFRCY  119

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF+FEVCPVLLVRVEEQ +GC I LLSCKLEGSPIVVAQNDKFDASMVNR+S D 
Sbjct  120  VYTFKFFSFEVCPVLLVRVEEQTNGCCIKLLSCKLEGSPIVVAQNDKFDASMVNRVSCDV  179

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
               +S VQ++TSDAVIEV+IE+PFAFR +PV AIESTG QVL+QIL +MLPRF+AQLVKD
Sbjct  180  TGNNSSVQQITSDAVIEVSIEIPFAFRVIPVGAIESTGTQVLDQILKLMLPRFLAQLVKD  239

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GD SRQPLGTG+I
Sbjct  240  YQAWASGDISRQPLGTGEI  258



>gb|KGN63024.1| hypothetical protein Csa_2G384440 [Cucumis sativus]
Length=247

 Score =   338 bits (868),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 182/210 (87%), Gaps = 5/210 (2%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLM-----EYMSLPASQYSVLDAERI  507
            DS R SL IS ++ PK RFIARR ESV+VRQL RPL      EYMSLPASQYSVLDAERI
Sbjct  38   DSTRPSLPISTNSNPKARFIARRSESVTVRQLARPLSNVRSDEYMSLPASQYSVLDAERI  97

Query  506  ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
            ER+DD TFRC+VYRFKFFAFEVCPVL+V+VE QP+GC I LLSCKLEGSPIVVAQNDKFD
Sbjct  98   ERIDDCTFRCHVYRFKFFAFEVCPVLVVKVELQPNGCCIKLLSCKLEGSPIVVAQNDKFD  157

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIM  147
            ASMVN+ISYD NR +S  QKLTSD VIEVNIE+PFAFRA+PVQAIES G QVL QIL +M
Sbjct  158  ASMVNQISYDVNRGNSLWQKLTSDTVIEVNIEIPFAFRAIPVQAIESAGTQVLEQILKLM  217

Query  146  LPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            LPRF AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  218  LPRFTAQLVKDYQAWASGDTSRQPLGTGEI  247



>ref|XP_008232054.1| PREDICTED: uncharacterized protein LOC103331217 isoform X1 [Prunus 
mume]
Length=242

 Score =   338 bits (867),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            ++ SP+ SL ISAD  PK RF+ARR ESVSV QLQRPL EYMSLPASQYSVLDAERIERV
Sbjct  36   AFASPKPSLHISADLTPKARFVARRTESVSVPQLQRPLSEYMSLPASQYSVLDAERIERV  95

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            D+NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKLEGSPI VAQNDKFDA M
Sbjct  96   DENTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIAVAQNDKFDAFM  155

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VN+IS   N+ +S +Q+L S+ VIEV+IE+PFAFRA+P QAIES+G QVL QIL IMLPR
Sbjct  156  VNQISCTNNQSNSSLQQLRSETVIEVSIEIPFAFRAIPAQAIESSGTQVLEQILRIMLPR  215

Query  137  FMAQLVKDYQAWATGDTSRQPLGTGQI  57
            FM+QLV+DY+AWA+GD SRQPLGTG+I
Sbjct  216  FMSQLVRDYRAWASGDRSRQPLGTGEI  242



>ref|NP_196064.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY34156.1| At5g04440 [Arabidopsis thaliana]
 gb|ABD19663.1| At5g04440 [Arabidopsis thaliana]
 gb|AED90745.1| uncharacterized protein AT5G04440 [Arabidopsis thaliana]
Length=255

 Score =   337 bits (864),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  57   IRVSSSSTPKARFIARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  116

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  117  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  176

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KD
Sbjct  177  TQEGSSEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILKLMLPRFLSQLSKD  236

Query  113  YQAWATGDTSRQPLGTGQI  57
            Y AWA+GDTSRQPLGTG+I
Sbjct  237  YHAWASGDTSRQPLGTGEI  255



>ref|XP_010423577.1| PREDICTED: uncharacterized protein LOC104708675 [Camelina sativa]
Length=253

 Score =   337 bits (863),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  55   IRVSSSSVPKARFIARQKQSISVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  114

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  115  VYNFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  174

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  +  Q++TSDAVIEVNIE+PFAFR  PV A+E+TG QVL+QIL +MLPRF++QL KD
Sbjct  175  TQEGTSEQQITSDAVIEVNIEIPFAFRVFPVGAVEATGTQVLDQILRLMLPRFLSQLSKD  234

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  235  YQAWASGDTSRQPLGTGEI  253



>ref|XP_010452341.1| PREDICTED: uncharacterized protein LOC104734455 [Camelina sativa]
Length=253

 Score =   336 bits (862),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  55   IRVSSSSVPKARFIARQKQSISVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  114

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  115  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  174

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  +  Q++TSDAVIEVNIE+PFAFR  PV A+E+TG QVL+QIL +MLPRF++QL KD
Sbjct  175  TQEGTSEQQITSDAVIEVNIEIPFAFRVFPVGAVEATGTQVLDQILRLMLPRFLSQLSKD  234

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  235  YQAWASGDTSRQPLGTGEI  253



>emb|CDY44856.1| BnaC09g50560D [Brassica napus]
Length=249

 Score =   336 bits (862),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYV  471
            R+S+ + PK RF+AR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERI RVDDNTFRCYV
Sbjct  52   RVSSSSDPKARFVARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIVRVDDNTFRCYV  111

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            Y FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S DG 
Sbjct  112  YTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDGT  171

Query  290  RRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
            +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KDY
Sbjct  172  QEGSSEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILRLMLPRFLSQLSKDY  231

Query  110  QAWATGDTSRQPLGTGQI  57
            QAWA+GDTSRQPLGTG+I
Sbjct  232  QAWASGDTSRQPLGTGEI  249



>ref|XP_007218206.1| hypothetical protein PRUPE_ppa010633mg [Prunus persica]
 gb|EMJ19405.1| hypothetical protein PRUPE_ppa010633mg [Prunus persica]
Length=242

 Score =   335 bits (859),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            ++  P+ SL ISAD  PK RF+ARR ESVSV QLQRPL EYMSLPASQYSVLDAERIERV
Sbjct  36   AFAPPKPSLHISADLTPKARFVARRTESVSVPQLQRPLSEYMSLPASQYSVLDAERIERV  95

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            D+NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKL+GSPI VAQNDKFDA M
Sbjct  96   DENTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIKLLSCKLDGSPIAVAQNDKFDAFM  155

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VN+IS   N+ +S +Q+L SD VIEV+IE+PFAFRA+P QAIES+G QVL QIL IMLPR
Sbjct  156  VNQISCTNNQSNSSLQQLRSDTVIEVSIEIPFAFRAIPAQAIESSGTQVLEQILRIMLPR  215

Query  137  FMAQLVKDYQAWATGDTSRQPLGTGQI  57
            FM+QLV+DY+AWA+GD SRQPLGTG+I
Sbjct  216  FMSQLVRDYRAWASGDRSRQPLGTGEI  242



>ref|XP_003518995.1| PREDICTED: uncharacterized protein LOC100789119 isoform X1 [Glycine 
max]
 gb|KHN28481.1| Hypothetical protein glysoja_048359 [Glycine soja]
Length=228

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  SPR SLR SA  + K RF+ARRKESVSVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  22   ALKSPRLSLRASATPSQKARFVARRKESVSVRQLQRPLIEYMRLPASQYSVLDAERIERV  81

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF FEVCPVLLV+VEEQPDGC I LLSCKLEGSP+V AQNDKFDA M
Sbjct  82   NENTFRCYVYRFKFFNFEVCPVLLVKVEEQPDGCCIKLLSCKLEGSPMVAAQNDKFDALM  141

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  142  VNRISCDSNANRSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  201

Query  137  FMAQLVKDYQAWATGDTSRQPLGTGQI  57
            FM+QL KDYQAWA+GDTSRQPLGTG+I
Sbjct  202  FMSQLEKDYQAWASGDTSRQPLGTGEI  228



>ref|XP_010490956.1| PREDICTED: uncharacterized protein LOC104768633 [Camelina sativa]
Length=255

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  57   IRVSSSSVPKARFIARQKQSISVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  116

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  117  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  176

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  +  Q++TSDAVIEVNIE+PFAFR  PV A+E+TG QVL+QIL +MLPRF++QL KD
Sbjct  177  TQEGTSEQQITSDAVIEVNIEIPFAFRVFPVGAVEATGTQVLDQILRLMLPRFLSQLSKD  236

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  237  YQAWASGDTSRQPLGTGEI  255



>ref|XP_002871094.1| hypothetical protein ARALYDRAFT_487226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47353.1| hypothetical protein ARALYDRAFT_487226 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+EYMSLPASQYSVLDAERI RVDDNTFRCY
Sbjct  54   IRVSSSSTPKARFIARQKQSISVRQLQRPLIEYMSLPASQYSVLDAERIVRVDDNTFRCY  113

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  114  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  173

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  +  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++QL KD
Sbjct  174  TQEGTSEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILKLMLPRFLSQLSKD  233

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  234  YQAWASGDTSRQPLGTGEI  252



>ref|XP_006288505.1| hypothetical protein CARUB_v10001769mg [Capsella rubella]
 gb|EOA21403.1| hypothetical protein CARUB_v10001769mg [Capsella rubella]
Length=257

 Score =   334 bits (857),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+S+SVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  59   VRVSSSSTPKARFIARQKQSISVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  118

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  119  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  178

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
             +  +  Q++TSDAVIEVNIE+PFAFR  P  AIE+TG QVL+QIL +MLPRF++QL KD
Sbjct  179  TQEGTTDQQITSDAVIEVNIEIPFAFRVFPAGAIEATGTQVLDQILRLMLPRFLSQLSKD  238

Query  113  YQAWATGDTSRQPLGTGQI  57
            YQAWA+GDTSRQPLGTG+I
Sbjct  239  YQAWASGDTSRQPLGTGEI  257



>ref|XP_007145503.1| hypothetical protein PHAVU_007G244000g [Phaseolus vulgaris]
 gb|ESW17497.1| hypothetical protein PHAVU_007G244000g [Phaseolus vulgaris]
Length=229

 Score =   331 bits (848),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -1

Query  668  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDN  489
            S R SLR SA    K RF+ RRKESVSVRQLQRPL+EYM LPASQYSVLDAERIER++DN
Sbjct  26   SSRPSLRASATPTQKARFVGRRKESVSVRQLQRPLIEYMRLPASQYSVLDAERIERINDN  85

Query  488  TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNR  309
            TFRCYVYRF+FFAFEVCPVLLV+VEEQPDGC I LLSCKLEGSP+V AQNDKFDA MVNR
Sbjct  86   TFRCYVYRFRFFAFEVCPVLLVKVEEQPDGCCIKLLSCKLEGSPMVAAQNDKFDALMVNR  145

Query  308  ISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            IS D N   S +Q+LTSD +IEV+I++PF F A+P QAIES G QVL QIL IMLPRFM+
Sbjct  146  ISCDSNADKSLMQQLTSDTLIEVSIDIPFPFLAIPKQAIESAGTQVLEQILRIMLPRFMS  205

Query  128  QLVKDYQAWATGDTSRQPLGTGQI  57
            QLVKDYQAWATGDTSRQPLGTG+I
Sbjct  206  QLVKDYQAWATGDTSRQPLGTGEI  229



>gb|KDP45068.1| hypothetical protein JCGZ_01568 [Jatropha curcas]
Length=241

 Score =   330 bits (846),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            S +SP+ S RIS  +  K RFIARRKESVS++QL RPL+EYMSLPASQYSVLDAERIERV
Sbjct  35   SNESPKPSRRISVSSMQKARFIARRKESVSIQQLGRPLIEYMSLPASQYSVLDAERIERV  94

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQP GC I LLSCKLEGSP+VVAQN+KFDASM
Sbjct  95   DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPSGCCIKLLSCKLEGSPMVVAQNEKFDASM  154

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VN IS   ++ +S +Q+LTSDAVIEV+IEVPFAF A+PV AIESTG ++L QILG+MLPR
Sbjct  155  VNYISCGSSQSNSSMQQLTSDAVIEVSIEVPFAFGAIPVPAIESTGTRILEQILGLMLPR  214

Query  137  FMAQLVKDYQAWATGDTSRQPLGTGQI  57
            FMAQLVKDY+AWA+GDTSRQPLGTG+I
Sbjct  215  FMAQLVKDYEAWASGDTSRQPLGTGEI  241



>ref|XP_007010072.1| Uncharacterized protein TCM_043378 [Theobroma cacao]
 gb|EOY18882.1| Uncharacterized protein TCM_043378 [Theobroma cacao]
Length=333

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  653  LRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            +R SA ++A K RF+ARRKES+SVRQL+RPL+EYM LPASQYSVLDAERIER+DDNTFRC
Sbjct  134  VRASAWNSASKARFVARRKESLSVRQLKRPLIEYMRLPASQYSVLDAERIERIDDNTFRC  193

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVYRFKFF FEVCPVLLVRVEEQP+GC I LLSCKL+GSPIVVAQNDKFDA MVN+IS D
Sbjct  194  YVYRFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLDGSPIVVAQNDKFDACMVNQISCD  253

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             NR  S VQ+LTSDAVIEV+IEVPFAFR +P+  IESTG QVL QIL +MLPRFMAQLVK
Sbjct  254  TNRSGSLVQELTSDAVIEVSIEVPFAFRPIPLGMIESTGTQVLEQILRLMLPRFMAQLVK  313

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DYQAWA+GD SRQPLGTG+I
Sbjct  314  DYQAWASGDASRQPLGTGEI  333



>ref|XP_009361429.1| PREDICTED: uncharacterized protein LOC103951706 isoform X1 [Pyrus 
x bretschneideri]
Length=235

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            S+R+SAD++PK RF+ARR ESVSV QLQRPL EYMSLPASQYSVLDAERIERVD NTFRC
Sbjct  36   SVRVSADSSPKARFVARRTESVSVPQLQRPLSEYMSLPASQYSVLDAERIERVDANTFRC  95

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVYRFKFFAFEVCPVLLV+VEEQP+GC I LLSCKL+GSPI VAQN KFDA MVN+IS  
Sbjct  96   YVYRFKFFAFEVCPVLLVKVEEQPNGCCIKLLSCKLDGSPIAVAQNAKFDAFMVNQISCA  155

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             N+ +S  Q+L SD VIEV+IE+PFAFRA+PVQAIES+G QVL Q+L IMLPRFM+QLV+
Sbjct  156  SNQTNSSRQELKSDTVIEVSIEIPFAFRAIPVQAIESSGTQVLEQVLRIMLPRFMSQLVR  215

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DY+AWA+GD SRQPLGTG+I
Sbjct  216  DYRAWASGDRSRQPLGTGEI  235



>gb|KJB75126.1| hypothetical protein B456_012G025500 [Gossypium raimondii]
Length=260

 Score =   328 bits (840),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 178/220 (81%), Gaps = 24/220 (11%)
 Frame = -1

Query  644  SADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  465
            + D+ PK RF+ARRKES+SVRQL RPL+EYMSLPASQYSVLDAERIERVDDNTFRCYVYR
Sbjct  41   ATDSPPKARFVARRKESISVRQLNRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  100

Query  464  FKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRR  285
            FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASMVNRIS +  R 
Sbjct  101  FKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMVNRISCNTIRN  160

Query  284  DSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA--------  129
            DS VQ+LTSDAVIEVNIEVPFAFR +P+  IES+G QVL QIL +MLPRFMA        
Sbjct  161  DSLVQELTSDAVIEVNIEVPFAFRPIPLGMIESSGTQVLEQILRLMLPRFMAQLQQVLLL  220

Query  128  ----------------QLVKDYQAWATGDTSRQPLGTGQI  57
                            QLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  221  LELICFCNWKYENMKHQLVKDYQAWASGDTSRQPLGTGEI  260



>ref|XP_010907449.1| PREDICTED: uncharacterized protein LOC105034116 isoform X1 [Elaeis 
guineensis]
Length=230

 Score =   327 bits (837),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 181/202 (90%), Gaps = 1/202 (0%)
 Frame = -1

Query  659  GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTF  483
            GS+R SA  +APK RFIA+R +S SV+QLQRPL+EYMSLPASQYSVLDAERIERVDDNTF
Sbjct  29   GSIRASAVSSAPKARFIAKRSDSTSVQQLQRPLLEYMSLPASQYSVLDAERIERVDDNTF  88

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRIS  303
            RCYVYR KFFAFE+CPVL+VRV+E+P+GC I LLSCKLEGSP+V AQN+KF ASMVNR+S
Sbjct  89   RCYVYRIKFFAFEICPVLVVRVDEEPNGCCIRLLSCKLEGSPLVEAQNEKFSASMVNRVS  148

Query  302  YDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
             +G  ++SG+Q+LT+D  IEV IE+PFAFRA+PV+AIESTG QVL Q+L IMLPRF+ QL
Sbjct  149  CNGGMQNSGMQQLTTDTTIEVFIEIPFAFRAIPVEAIESTGTQVLEQLLRIMLPRFLRQL  208

Query  122  VKDYQAWATGDTSRQPLGTGQI  57
            VKDYQAWA+GDTSRQPLGTG++
Sbjct  209  VKDYQAWASGDTSRQPLGTGEL  230



>ref|XP_008375629.1| PREDICTED: uncharacterized protein LOC103438867 [Malus domestica]
Length=234

 Score =   326 bits (835),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            S+R+SAD+ PK RF+ARR ESVSV  LQRPL EYMSLPASQYSVLDAERIERVD NTFRC
Sbjct  36   SVRVSADSTPKARFVARRTESVSVPXLQRPLSEYMSLPASQYSVLDAERIERVDANTFRC  95

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVYRFKFFAFEVCPVLLV+VEEQP+GCSI LLSCKL+GSPI VAQNDKFDA MVN+IS  
Sbjct  96   YVYRFKFFAFEVCPVLLVKVEEQPNGCSIKLLSCKLDGSPIAVAQNDKFDAFMVNQISC-  154

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             ++ +S +Q+L SD VIEV+I++PFAFRA+PVQAIES+G QVL QIL IMLPRFM+QLV+
Sbjct  155  ASKTNSSLQELKSDTVIEVSIDIPFAFRAIPVQAIESSGTQVLEQILRIMLPRFMSQLVR  214

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DY+AWA+GD SRQPLGTG+I
Sbjct  215  DYRAWASGDRSRQPLGTGEI  234



>gb|KFK24892.1| hypothetical protein AALP_AA8G038300 [Arabis alpina]
Length=244

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RFIARRK+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCYVY FKFF 
Sbjct  54   PKARFIARRKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYVYTFKFFN  113

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            FEVCPVLLVRVEE+ +GC I LLSCKLEGSP+VVAQNDKFDASMVN++S D  +  S  Q
Sbjct  114  FEVCPVLLVRVEEELNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNQVSCDSIQEGSLEQ  173

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            ++TSDAVIEVNIE+PFAFR  PV AIESTG QVL+QIL +MLPRF++QL KDYQAWA+GD
Sbjct  174  QITSDAVIEVNIEIPFAFRVFPVGAIESTGTQVLDQILKLMLPRFLSQLSKDYQAWASGD  233

Query  89   TSRQPLGTGQI  57
            TSRQPLGTG+I
Sbjct  234  TSRQPLGTGKI  244



>ref|XP_010243183.1| PREDICTED: uncharacterized protein LOC104587326 [Nelumbo nucifera]
Length=243

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 174/203 (86%), Gaps = 3/203 (1%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            S+ I AD+ PK RF+ARR ESVSV+QL+RPL EYMSLPASQYSVLDAERIERVDDNTFRC
Sbjct  41   SVSILADSTPKARFVARRSESVSVQQLERPLREYMSLPASQYSVLDAERIERVDDNTFRC  100

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD---ASMVNRI  306
            YVYR KFF+FEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQN+KF    ASMVN+I
Sbjct  101  YVYRIKFFSFEVCPVLLVRVEEQPNGCCIRLLSCKLEGSPIVVAQNEKFHGNAASMVNQI  160

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S    + DS VQKLTSD VIEV I++PF F+ +PV  IESTG QVL QIL IMLPRFM Q
Sbjct  161  SCGSEQSDSAVQKLTSDTVIEVTIDIPFPFQPIPVGVIESTGTQVLEQILRIMLPRFMTQ  220

Query  125  LVKDYQAWATGDTSRQPLGTGQI  57
            LVKDYQAWA+GDTSRQPLGTG+I
Sbjct  221  LVKDYQAWASGDTSRQPLGTGKI  243



>ref|XP_008794252.1| PREDICTED: uncharacterized protein LOC103710353 [Phoenix dactylifera]
Length=230

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 181/206 (88%), Gaps = 2/206 (1%)
 Frame = -1

Query  668  SPR-GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVD  495
            SPR G +  SA  +APK RF+A+R ES SV+QLQRPL+EYMSLPASQYSVLDAERIERVD
Sbjct  25   SPRPGPMFASAVSSAPKARFVAKRSESTSVQQLQRPLVEYMSLPASQYSVLDAERIERVD  84

Query  494  DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMV  315
            DNTFRCYVYR KFFAFEVCPVL+VRV+E+P+GC I LLSCKLEGSP+V AQN+KF ASMV
Sbjct  85   DNTFRCYVYRIKFFAFEVCPVLVVRVDEEPNGCCIRLLSCKLEGSPLVEAQNEKFSASMV  144

Query  314  NRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
            NR+S +G  R+SG+Q +T+D  IEV+IE+PFAFRA+PV+ IESTG QVL Q+L IMLPRF
Sbjct  145  NRVSCNGGMRNSGMQGITTDTTIEVSIEIPFAFRAIPVEVIESTGTQVLEQLLRIMLPRF  204

Query  134  MAQLVKDYQAWATGDTSRQPLGTGQI  57
            + QLVKDYQAWA+GDTSR+PLGTG++
Sbjct  205  LRQLVKDYQAWASGDTSRRPLGTGEL  230



>ref|XP_010090431.1| hypothetical protein L484_007993 [Morus notabilis]
 gb|EXB39446.1| hypothetical protein L484_007993 [Morus notabilis]
Length=256

 Score =   322 bits (824),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  638  DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFK  459
            ++ P+ RF ARRKESV VRQLQRPL EYMSLPASQYSVLDAERIERVDDNTFRCYVYR K
Sbjct  63   NSNPRARFSARRKESVLVRQLQRPLNEYMSLPASQYSVLDAERIERVDDNTFRCYVYRIK  122

Query  458  FFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDS  279
            FF+FEVCPVLLVRVEE+P GC I LLSCKLEGSPIVVAQNDKFDA M N+IS + N  D 
Sbjct  123  FFSFEVCPVLLVRVEEEPKGCCIKLLSCKLEGSPIVVAQNDKFDAFMENKISCNSNEGDL  182

Query  278  GVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
              Q+LTS+A+IEV+IEVPF+F  +PVQAIESTG+QVL Q+L IMLPRFMAQLVKDYQAWA
Sbjct  183  SEQQLTSEAIIEVSIEVPFSFLPIPVQAIESTGSQVLEQVLKIMLPRFMAQLVKDYQAWA  242

Query  98   TGDTSRQPLGTGQI  57
            +GDTSRQPLGTG+I
Sbjct  243  SGDTSRQPLGTGEI  256



>ref|XP_004513748.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590-like [Cicer 
arietinum]
Length=221

 Score =   318 bits (815),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 177/210 (84%), Gaps = 3/210 (1%)
 Frame = -1

Query  677  SYDSP-RGSLRISADAAP--KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERI  507
            SY  P R  LR SA   P  K RF+ARRKESVSV+QLQRPL+EYM LPASQYSVLDAERI
Sbjct  12   SYFQPKRLLLRASASTPPTQKARFVARRKESVSVQQLQRPLIEYMKLPASQYSVLDAERI  71

Query  506  ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
            ERV ++TFRCYVY  KFF+FEVCPVLLV+VEEQP GC I LLSCKLEGSP+V AQNDKFD
Sbjct  72   ERVSEDTFRCYVYTIKFFSFEVCPVLLVKVEEQPHGCCIKLLSCKLEGSPMVAAQNDKFD  131

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIM  147
            A MVNRIS + +  +S VQ+L SD +IEV+IE+PFAF+A+P QAIES G QVL QIL IM
Sbjct  132  AIMVNRISCESDSNESLVQQLKSDTIIEVSIEIPFAFKAIPKQAIESAGTQVLEQILKIM  191

Query  146  LPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            LPRFM+QLVKDYQAWA+G+TSRQPLG+G+I
Sbjct  192  LPRFMSQLVKDYQAWASGNTSRQPLGSGEI  221



>ref|XP_010267293.1| PREDICTED: uncharacterized protein LOC104604582 isoform X1 [Nelumbo 
nucifera]
Length=242

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            + P+ S+ I AD+ P+ RF+ARR E+VSV+ L+RPL +YMSLPASQYSVLDAERIERVDD
Sbjct  38   NDPKPSVGIYADSTPRARFVARRSETVSVQLLERPLRDYMSLPASQYSVLDAERIERVDD  97

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKLEGS +VVAQN+KF ASMVN
Sbjct  98   NTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIRLLSCKLEGSAVVVAQNEKFHASMVN  157

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +IS    + +  VQ+LTSD  IEV+I++PF FR++PV  IES G QV+ QIL IMLPRFM
Sbjct  158  QISCGNEQDNLSVQELTSDTTIEVSIDIPFPFRSIPVNVIESAGTQVIEQILRIMLPRFM  217

Query  131  AQLVKDYQAWATGDTSRQPLGTGQI  57
             QLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  218  RQLVKDYQAWASGDTSRQPLGTGEI  242



>ref|XP_006588986.1| PREDICTED: uncharacterized protein LOC100797206 isoform X3 [Glycine 
max]
 ref|XP_003535909.2| PREDICTED: uncharacterized protein LOC100797206 isoform X1 [Glycine 
max]
Length=253

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQLVKDYQAWATGDTSRQPLGTG  63
            F++QL KDY+AWA+GDTSRQPL TG
Sbjct  205  FVSQLEKDYRAWASGDTSRQPLETG  229



>ref|XP_006588989.1| PREDICTED: uncharacterized protein LOC100797206 isoform X6 [Glycine 
max]
 ref|XP_006588990.1| PREDICTED: uncharacterized protein LOC100797206 isoform X7 [Glycine 
max]
Length=232

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMA-QLVKDYQAWATGDTSRQPLGTGQI  57
            F++ QL KDY+AWA+GDTSRQPL TG+I
Sbjct  205  FVSQQLEKDYRAWASGDTSRQPLETGEI  232



>ref|XP_009397623.1| PREDICTED: uncharacterized protein LOC103982426 [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 172/202 (85%), Gaps = 1/202 (0%)
 Frame = -1

Query  659  GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTF  483
             S R SA  +APK RF+ARR ES +V+QLQRPL EYMSLPASQYSVLDAERIER+DDNTF
Sbjct  29   ASFRASAVSSAPKARFVARRTESTTVQQLQRPLAEYMSLPASQYSVLDAERIERIDDNTF  88

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRIS  303
            RCYVYR KFFAFEVCPVL+VRV+E+P+GC I LLSCKLEGSP+V AQN+KF ASMVNR+S
Sbjct  89   RCYVYRIKFFAFEVCPVLVVRVDEEPNGCCIRLLSCKLEGSPLVEAQNEKFSASMVNRVS  148

Query  302  YDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
             +    +S  Q+L +D VIEV I++PFAFRA+PV+  ESTG QVL Q+L +MLPRF+AQL
Sbjct  149  CNDGLHNSTFQQLATDTVIEVTIDIPFAFRAIPVEVFESTGTQVLEQLLRLMLPRFLAQL  208

Query  122  VKDYQAWATGDTSRQPLGTGQI  57
            VKDYQ+WA+GD SRQPLGTGQI
Sbjct  209  VKDYQSWASGDNSRQPLGTGQI  230



>ref|XP_004308612.1| PREDICTED: uncharacterized protein LOC101308329 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=228

 Score =   312 bits (800),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 177/204 (87%), Gaps = 1/204 (0%)
 Frame = -1

Query  665  PRGSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDN  489
            P   LR+SA    PK RF+ARR ESV V QLQRPL EYMSLPASQYSVLDAERIERVDDN
Sbjct  25   PNPRLRVSAVSTPPKARFVARRTESVPVPQLQRPLSEYMSLPASQYSVLDAERIERVDDN  84

Query  488  TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNR  309
            TFRCYVYRFKFFAFEVCPVLLV+VEEQP+GC I LLSCKL+GSPIVVAQNDKFDA MVN+
Sbjct  85   TFRCYVYRFKFFAFEVCPVLLVKVEEQPNGCCIKLLSCKLDGSPIVVAQNDKFDAYMVNQ  144

Query  308  ISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            IS   N   S +Q+L+SD VIEV+IE+PFAFRA+PVQAIES+G QVL QIL IMLPRF+A
Sbjct  145  ISCGSNDSSSSLQQLSSDTVIEVSIEIPFAFRAIPVQAIESSGTQVLEQILKIMLPRFLA  204

Query  128  QLVKDYQAWATGDTSRQPLGTGQI  57
            QLVKDYQAWA+GD SRQPLGTG+I
Sbjct  205  QLVKDYQAWASGDRSRQPLGTGEI  228



>gb|AFK45801.1| unknown [Medicago truncatula]
Length=226

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  653  LRISADAAP----KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            L + A A P    K RF+ARRKESVSV+QLQRPL+EYM LPASQYSVLDAERIERV ++T
Sbjct  24   LPLLASATPPSTHKARFVARRKESVSVQQLQRPLIEYMRLPASQYSVLDAERIERVSEDT  83

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVY  KFF FEVCPVLLV+VE+QP+GC I LLSCKL+GSP+V AQNDKFDA MVNRI
Sbjct  84   FRCYVYTIKFFTFEVCPVLLVKVEQQPNGCCIKLLSCKLQGSPMVAAQNDKFDAIMVNRI  143

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S + +   S VQ+LTSD +IEV+IE+PFAF+A+P QAIES G QVL QIL IMLPRFM+Q
Sbjct  144  SCESDSDKSLVQQLTSDTIIEVSIEIPFAFKAIPKQAIESAGTQVLEQILKIMLPRFMSQ  203

Query  125  LVKDYQAWATGDTSRQPLGTGQI  57
            LVKDYQAWA+G+ SRQPLGTG+I
Sbjct  204  LVKDYQAWASGNASRQPLGTGEI  226



>gb|AES60498.2| RAP annotation release 2, galactose-binding-like domain protein 
[Medicago truncatula]
Length=226

 Score =   312 bits (799),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 172/203 (85%), Gaps = 4/203 (2%)
 Frame = -1

Query  653  LRISADAAP----KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            L + A A P    K RF+ARRKESVSV+QLQRPL+EYM LPASQYSVLDAERIERV ++T
Sbjct  24   LPLLASATPPSTHKARFVARRKESVSVQQLQRPLIEYMRLPASQYSVLDAERIERVSEDT  83

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVY  KFF FEVCPVLLV+VE+QP+GC I LLSCKL+GSP+V AQNDKFDA MVNRI
Sbjct  84   FRCYVYTIKFFTFEVCPVLLVKVEQQPNGCCIKLLSCKLQGSPMVAAQNDKFDAIMVNRI  143

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S + +   S VQ+LTSD +IEV+IE+PFAF+A+P QAIES G QVL QIL IMLPRFM+Q
Sbjct  144  SCESDSDKSLVQQLTSDTIIEVSIEIPFAFKAIPKQAIESAGTQVLEQILKIMLPRFMSQ  203

Query  125  LVKDYQAWATGDTSRQPLGTGQI  57
            LVKDYQAWA+G+ SRQPLGTG+I
Sbjct  204  LVKDYQAWASGNASRQPLGTGEI  226



>gb|EPS69171.1| hypothetical protein M569_05597, partial [Genlisea aurea]
Length=237

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 169/199 (85%), Gaps = 2/199 (1%)
 Frame = -1

Query  647  ISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVY  468
            ISAD+APK RF+ARR ESVSVRQLQRPL EYMSLPASQYSVLDAERIERVDD TFRC+VY
Sbjct  39   ISADSAPKARFVARRTESVSVRQLQRPLNEYMSLPASQYSVLDAERIERVDDCTFRCFVY  98

Query  467  RFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY-DGN  291
            RFKFFAFEVCPVL VRVEEQP+GC I LLSCKLEGSPIVVAQNDKF+ASM NRIS  D  
Sbjct  99   RFKFFAFEVCPVLSVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFEASMENRISCNDEA  158

Query  290  RRDSGVQKLTSDAVIE-VNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
               S  Q LTSDA IE V I++P AFR +P + IESTG+QVL  +L  MLPRFM+QLVKD
Sbjct  159  NGSSTTQTLTSDATIEVVTIDIPPAFRVIPPRVIESTGSQVLGGVLKAMLPRFMSQLVKD  218

Query  113  YQAWATGDTSRQPLGTGQI  57
            Y+AWATGDTSR+P GTGQI
Sbjct  219  YEAWATGDTSREPRGTGQI  237



>ref|XP_008812325.1| PREDICTED: uncharacterized protein LOC103723244 [Phoenix dactylifera]
Length=230

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 171/202 (85%), Gaps = 1/202 (0%)
 Frame = -1

Query  659  GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTF  483
            G  R SA  +APK RF+A R ES SV+QL+RPL+EYMSLPASQYSVLDAERIERVD+NTF
Sbjct  29   GPFRASAVSSAPKARFVANRIESTSVQQLRRPLVEYMSLPASQYSVLDAERIERVDENTF  88

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRIS  303
            RCYVYR KFF+FEVCPVL+VRVEE+P GC I LLSCKLEGSP+V AQN+KF ASM NRIS
Sbjct  89   RCYVYRIKFFSFEVCPVLVVRVEEEPSGCCIRLLSCKLEGSPLVEAQNEKFSASMANRIS  148

Query  302  YDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
             +   ++S +Q+LTSD  IEV IE+PFAFR +PV+ IESTG QVL Q+L IMLPRF+ QL
Sbjct  149  CNSYTQNSEMQQLTSDTTIEVTIEIPFAFRVIPVEVIESTGTQVLEQLLRIMLPRFLKQL  208

Query  122  VKDYQAWATGDTSRQPLGTGQI  57
            VKDYQAWA+GD SRQPLGTG++
Sbjct  209  VKDYQAWASGDISRQPLGTGEL  230



>ref|XP_003590247.1| (RAP Annotation release2) Galactose-binding like domain containing 
protein [Medicago truncatula]
Length=227

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 172/204 (84%), Gaps = 5/204 (2%)
 Frame = -1

Query  653  LRISADAAP----KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            L + A A P    K RF+ARRKESVSV+QLQRPL+EYM LPASQYSVLDAERIERV ++T
Sbjct  24   LPLLASATPPSTHKARFVARRKESVSVQQLQRPLIEYMRLPASQYSVLDAERIERVSEDT  83

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVY  KFF FEVCPVLLV+VE+QP+GC I LLSCKL+GSP+V AQNDKFDA MVNRI
Sbjct  84   FRCYVYTIKFFTFEVCPVLLVKVEQQPNGCCIKLLSCKLQGSPMVAAQNDKFDAIMVNRI  143

Query  305  SYDGNRRDSGVQKLTSDAVIE-VNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            S + +   S VQ+LTSD +IE V+IE+PFAF+A+P QAIES G QVL QIL IMLPRFM+
Sbjct  144  SCESDSDKSLVQQLTSDTIIEVVSIEIPFAFKAIPKQAIESAGTQVLEQILKIMLPRFMS  203

Query  128  QLVKDYQAWATGDTSRQPLGTGQI  57
            QLVKDYQAWA+G+ SRQPLGTG+I
Sbjct  204  QLVKDYQAWASGNASRQPLGTGEI  227



>ref|XP_006436550.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
 gb|ESR49790.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
Length=166

 Score =   305 bits (780),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSPIVVAQNDKFDASM+NRIS D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+A
Sbjct  61   KLEGSPIVVAQNDKFDASMINRISCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IES+G QVL+QIL +MLPRFM+QLVKDYQAWATGDTSRQPLGTG+I
Sbjct  121  IESSGTQVLDQILKLMLPRFMSQLVKDYQAWATGDTSRQPLGTGEI  166



>ref|XP_004985720.1| PREDICTED: uncharacterized protein LOC101766783 isoform X2 [Setaria 
italica]
Length=233

 Score =   306 bits (784),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ESVSV+QL RPL EYMSLPASQYSVLDAERIERVDD+TFRCYVYRF+FFA
Sbjct  43   PKARFVARRSESVSVQQLARPLAEYMSLPASQYSVLDAERIERVDDSTFRCYVYRFRFFA  102

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+P+GC I LLSCKLEGSP+V AQNDKF ASMVNR+      + S +Q
Sbjct  103  LEVCPVLLVRVDEEPNGCCIRLLSCKLEGSPLVEAQNDKFSASMVNRVFCSSTLQGSTLQ  162

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +LTSD  IEV I++PF FRA+PV AIES+G QVL Q+LG+MLPRF+ QLVKDYQAWA+GD
Sbjct  163  QLTSDTTIEVTIDIPFPFRAIPVTAIESSGRQVLEQLLGVMLPRFLNQLVKDYQAWASGD  222

Query  89   TSRQPLGTGQI  57
            +SR+PLGTG+I
Sbjct  223  SSRKPLGTGEI  233



>ref|XP_010918716.1| PREDICTED: uncharacterized protein LOC105043023 [Elaeis guineensis]
Length=230

 Score =   306 bits (783),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 171/202 (85%), Gaps = 1/202 (0%)
 Frame = -1

Query  659  GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTF  483
            G  R SA  +A K RF+A+R E+ SV+QLQRPL+EYMSLPASQYSVLDAERIERVD+NTF
Sbjct  29   GPFRTSAISSALKARFVAKRTEATSVQQLQRPLVEYMSLPASQYSVLDAERIERVDENTF  88

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRIS  303
            +CYVYR KFFAFEVCPVL+VRVEE+P GC I LLSCKLEGSP+V AQN+KF ASMVNRIS
Sbjct  89   KCYVYRIKFFAFEVCPVLVVRVEEEPYGCCIRLLSCKLEGSPLVEAQNEKFSASMVNRIS  148

Query  302  YDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
             +    +  +Q+LT+D  IEV IE+PFAF+ +PV+ IESTG QVL Q+L IMLPRF+ QL
Sbjct  149  CNNYMGNLEMQQLTTDTAIEVTIEIPFAFQVMPVEVIESTGTQVLEQLLRIMLPRFLKQL  208

Query  122  VKDYQAWATGDTSRQPLGTGQI  57
            VKDYQAWA+GDTSRQPLGTG++
Sbjct  209  VKDYQAWASGDTSRQPLGTGEL  230



>tpg|DAA43360.1| TPA: hypothetical protein ZEAMMB73_635178 [Zea mays]
Length=231

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ESV V+QL RPL EYMSLPASQYSVLDAERIERVDD+TFRCYVYRF+FFA
Sbjct  41   PKARFVARRSESVPVQQLVRPLAEYMSLPASQYSVLDAERIERVDDSTFRCYVYRFRFFA  100

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+PDGC I LLSCKLEGSP+V AQNDKF ASM NR+      +DS +Q
Sbjct  101  LEVCPVLLVRVDEEPDGCCIRLLSCKLEGSPLVEAQNDKFSASMANRVFCSSKSQDSTLQ  160

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +LTSD  IEV I++PF FRA+PV+AIES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD
Sbjct  161  QLTSDTTIEVAIDIPFPFRAIPVEAIESSGRQVLEQLLRVMLPRFLKQLVKDYQAWASGD  220

Query  89   TSRQPLGTGQI  57
             SR+PLGTG+I
Sbjct  221  ASRKPLGTGEI  231



>ref|NP_001143018.1| uncharacterized protein LOC100275482 [Zea mays]
 gb|ACG28337.1| hypothetical protein [Zea mays]
Length=233

 Score =   303 bits (775),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ESV V+QL RPL EYMSLPASQYSVLDAERIERVDD+TFRCYVYRF+FFA
Sbjct  43   PKARFVARRSESVPVQQLVRPLAEYMSLPASQYSVLDAERIERVDDSTFRCYVYRFRFFA  102

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+P+GC I+LLSCKLEGSP+V AQNDKF ASM NR+      +DS +Q
Sbjct  103  LEVCPVLLVRVDEEPNGCCIHLLSCKLEGSPLVEAQNDKFSASMANRVFCSSKSQDSTLQ  162

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +LTSD  IEV I++PF FRA+PV+AIES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD
Sbjct  163  QLTSDTTIEVAIDIPFPFRAIPVEAIESSGRQVLEQLLRVMLPRFLKQLVKDYQAWASGD  222

Query  89   TSRQPLGTGQI  57
             SR+PLGTG+I
Sbjct  223  ASRKPLGTGEI  233



>gb|KDO45175.1| hypothetical protein CISIN_1g026771mg [Citrus sinensis]
Length=233

 Score =   303 bits (775),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 163/184 (89%), Gaps = 1/184 (1%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+ARRKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVARRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASM+NRI
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMINRI  160

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N  +S VQ+LTSDA IEV+IEVPFAFRA PV+AIESTG QVL+QIL +MLPRFM+Q
Sbjct  161  SCDSNSSNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESTGTQVLDQILKLMLPRFMSQ  220

Query  125  LVKD  114
            + + 
Sbjct  221  VSRS  224



>ref|XP_006436547.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
 gb|ESR49787.1| hypothetical protein CICLE_v10032582mg [Citrus clementina]
Length=233

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+A RKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVASRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASM+NRI
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMINRI  160

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+AIES+G QVL+QIL +MLPRFM+Q
Sbjct  161  SCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESSGTQVLDQILKLMLPRFMSQ  220

Query  125  L  123
            +
Sbjct  221  V  221



>dbj|BAK01502.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ES SV+QL RPL EYM LPASQYSVLDAERIERVD++TFRCYVYRF+FFA
Sbjct  50   PKARFVARRSESTSVQQLARPLAEYMGLPASQYSVLDAERIERVDESTFRCYVYRFRFFA  109

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+P+GC I LLSCKLEGSP+V AQNDKF ASMVNR+  + N  DS +Q
Sbjct  110  LEVCPVLLVRVDEEPNGCCIRLLSCKLEGSPLVEAQNDKFSASMVNRVFCNNNSDDSTLQ  169

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +LTSDA IEV I++PF F+ALPV+AIES+G QVL Q+L +MLPRF+ QL KDYQAWA+GD
Sbjct  170  QLTSDATIEVAIDIPFPFQALPVEAIESSGRQVLEQLLRVMLPRFLKQLDKDYQAWASGD  229

Query  89   TSRQPLGTGQI  57
            +SR+PLGTG+I
Sbjct  230  SSRKPLGTGEI  240



>ref|XP_006843095.1| hypothetical protein AMTR_s00140p00045980 [Amborella trichopoda]
 gb|ERN04770.1| hypothetical protein AMTR_s00140p00045980 [Amborella trichopoda]
Length=255

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            P+ RF A R ++V VRQL+RPL +YMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA
Sbjct  65   PRARFSASRTQTVKVRQLRRPLADYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  124

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            FEVCPVLLVRVEE+P GC I LLSCKLEGSP VVAQN+KF ASMVN+IS   +  +S V+
Sbjct  125  FEVCPVLLVRVEEEPKGCCIRLLSCKLEGSPFVVAQNEKFSASMVNKISCSTSNGNSSVE  184

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +L S+  IEV IE+PFAFRA+P + IESTG +VL Q+LGIMLPRFMAQL KDY+AWA+GD
Sbjct  185  QLKSETTIEVVIEIPFAFRAIPEELIESTGNRVLEQLLGIMLPRFMAQLEKDYKAWASGD  244

Query  89   TSRQPLGTGQI  57
             SRQPLGTG++
Sbjct  245  ASRQPLGTGEM  255



>ref|NP_001048959.1| Os03g0146500 [Oryza sativa Japonica Group]
 gb|AAK98734.1|AC090485_13 Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93964.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10873.1| Os03g0146500 [Oryza sativa Japonica Group]
 dbj|BAG96418.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96516.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58321.1| hypothetical protein OsJ_09402 [Oryza sativa Japonica Group]
Length=230

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAF  447
            K RF+ARR ES  V+QL RPL EYMSLPASQYSVLDAERIERVD++TFRCYVYRF+FFA 
Sbjct  41   KARFVARRSESTFVQQLARPLAEYMSLPASQYSVLDAERIERVDESTFRCYVYRFRFFAL  100

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EVCPVLLVRV+E+P+GC I+LLSCKLEGSP+V AQNDKF ASMVN++  + +  DS  Q+
Sbjct  101  EVCPVLLVRVDEEPNGCCISLLSCKLEGSPLVEAQNDKFSASMVNKVFCNSSMSDSTSQQ  160

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDT  87
            LTSD  IEV I++PF FRALPV+AIES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD+
Sbjct  161  LTSDTTIEVTIDIPFPFRALPVEAIESSGKQVLEQLLRVMLPRFLKQLVKDYQAWASGDS  220

Query  86   SRQPLGTGQI  57
            SR+PLGTG+I
Sbjct  221  SRKPLGTGEI  230



>ref|XP_006649399.1| PREDICTED: uncharacterized protein LOC102703943 [Oryza brachyantha]
Length=230

 Score =   300 bits (767),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAF  447
            K RF+ARR ES SV+QL RPL EYMSLPASQYSVLDAERIERVD++TFRCYVYRF+FFA 
Sbjct  41   KARFVARRSESTSVQQLARPLAEYMSLPASQYSVLDAERIERVDESTFRCYVYRFRFFAL  100

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EVCPVLLVRV+E+P+GC I+LLSCKLEGSP+V AQNDKF ASMVNR+  + +  DS  Q+
Sbjct  101  EVCPVLLVRVDEEPNGCCISLLSCKLEGSPLVEAQNDKFSASMVNRVFCNSSMNDSTFQQ  160

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDT  87
            LTSD  IEV I++PF F++LPV+AIES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD+
Sbjct  161  LTSDTTIEVTIDIPFPFQSLPVEAIESSGRQVLGQLLRVMLPRFLKQLVKDYQAWASGDS  220

Query  86   SRQPLGTGQI  57
            SR+PLGTG+I
Sbjct  221  SRKPLGTGEI  230



>gb|EEC74517.1| hypothetical protein OsI_10013 [Oryza sativa Indica Group]
Length=230

 Score =   300 bits (767),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAF  447
            K RF+ARR ES  V+QL RPL EYMSLPASQYSVLDAERIERVD++TFRCYVYRF+FFA 
Sbjct  41   KARFVARRSESTFVQQLARPLAEYMSLPASQYSVLDAERIERVDESTFRCYVYRFRFFAL  100

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EVCPVLLVRV+E+P+GC I+LLSCKLEGSP+V AQNDKF ASMVN++  + +  DS  Q+
Sbjct  101  EVCPVLLVRVDEEPNGCCISLLSCKLEGSPLVEAQNDKFSASMVNKVFCNSSMSDSTSQQ  160

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDT  87
            LTSD  IEV I++PF FRALPV+AIES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD+
Sbjct  161  LTSDTTIEVTIDIPFPFRALPVEAIESSGRQVLEQLLRVMLPRFLKQLVKDYQAWASGDS  220

Query  86   SRQPLGTGQI  57
            SR+PLGTG+I
Sbjct  221  SRKPLGTGEI  230



>ref|XP_006485298.1| PREDICTED: uncharacterized protein LOC102621133 isoform X1 [Citrus 
sinensis]
Length=287

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+A RKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVASRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFDASM+NRI
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDASMINRI  160

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+AIES+G QVL+QIL +MLPRFM+Q
Sbjct  161  SCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESSGTQVLDQILKLMLPRFMSQ  220



>ref|XP_011031600.1| PREDICTED: uncharacterized protein LOC105130684 isoform X3 [Populus 
euphratica]
Length=166

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVDDNTFRCYVY FKFFAFE+CPVLLVRVEEQPDGC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDDNTFRCYVYSFKFFAFEICPVLLVRVEEQPDGCCIRLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSPIVVAQN+KFDASMVN+IS D N+ +S +Q+LTSDAVIEV+I++PFAFRA+P +A
Sbjct  61   KLEGSPIVVAQNEKFDASMVNQISCDSNQSNSTIQQLTSDAVIEVSIDIPFAFRAIPTEA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IESTGAQ+L QILG +LPRFMAQLVKDY AWA+GD SRQPLGTG+I
Sbjct  121  IESTGAQILQQILGQILPRFMAQLVKDYHAWASGDASRQPLGTGEI  166



>ref|XP_008456551.1| PREDICTED: uncharacterized protein LOC103496471 isoform X2 [Cucumis 
melo]
Length=166

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIER+DD TFRCYVYRFKFFAFEVCPVL+VRVE QP+GC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERIDDCTFRCYVYRFKFFAFEVCPVLVVRVELQPNGCCIKLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSPIVVAQNDKFDA MVN+ISYD NR +S +QKLTSD VIEVNIE+PFAFRA+PVQA
Sbjct  61   KLEGSPIVVAQNDKFDAYMVNQISYDVNRGNSPLQKLTSDTVIEVNIEIPFAFRAIPVQA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IES G QVL QIL +MLPRF+AQLVKDYQAWA+GDTSRQPLGTG+I
Sbjct  121  IESAGTQVLEQILKLMLPRFIAQLVKDYQAWASGDTSRQPLGTGEI  166



>ref|XP_003558814.1| PREDICTED: uncharacterized protein LOC100828535 [Brachypodium 
distachyon]
Length=232

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ES SV+QL RPL EYM LPASQYSVLDAERIERVDD+TFRCYVYRF+FFA
Sbjct  44   PKARFVARRSESTSVQQLARPLAEYMGLPASQYSVLDAERIERVDDSTFRCYVYRFRFFA  103

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+P+GC I LLSCKLEGSP+V AQNDKF ASM NR+ +  N  D G Q
Sbjct  104  LEVCPVLLVRVDEEPNGCCIRLLSCKLEGSPLVEAQNDKFSASMANRV-FCNNSSD-GSQ  161

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
            +LTSDA IEV I++PF FRA+PV+AIES+G QVL Q+L +MLPRF+ QL KDYQAWA+GD
Sbjct  162  QLTSDATIEVTIDIPFPFRAIPVEAIESSGRQVLEQLLRVMLPRFLKQLDKDYQAWASGD  221

Query  89   TSRQPLGTGQI  57
            +SR+PLGTG+I
Sbjct  222  SSRKPLGTGEI  232



>emb|CAB85550.1| putative protein [Arabidopsis thaliana]
Length=285

 Score =   295 bits (754),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCY  474
            +R+S+ + PK RFIAR+K+SVSVRQLQRPL+EYMSLPASQYSVLDAERIERVDDNTFRCY
Sbjct  57   IRVSSSSTPKARFIARQKQSVSVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNTFRCY  116

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            VY FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSP+VVAQNDKFDASMVNR+S D 
Sbjct  117  VYTFKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPVVVAQNDKFDASMVNRVSCDS  176

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             +  S  Q++TSDAVIEVNIE+PFAFR  PV AIE+TG QVL+QIL +MLPRF++Q+ +
Sbjct  177  TQEGSSEQQITSDAVIEVNIEIPFAFRVFPVGAIEATGTQVLDQILKLMLPRFLSQVCR  235



>ref|XP_004985719.1| PREDICTED: uncharacterized protein LOC101766783 isoform X1 [Setaria 
italica]
Length=257

 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 166/215 (77%), Gaps = 24/215 (11%)
 Frame = -1

Query  629  PKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFA  450
            PK RF+ARR ESVSV+QL RPL EYMSLPASQYSVLDAERIERVDD+TFRCYVYRF+FFA
Sbjct  43   PKARFVARRSESVSVQQLARPLAEYMSLPASQYSVLDAERIERVDDSTFRCYVYRFRFFA  102

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             EVCPVLLVRV+E+P+GC I LLSCKLEGSP+V AQNDKF ASMVNR+      + S +Q
Sbjct  103  LEVCPVLLVRVDEEPNGCCIRLLSCKLEGSPLVEAQNDKFSASMVNRVFCSSTLQGSTLQ  162

Query  269  KLTSDAVIE------------------------VNIEVPFAFRALPVQAIESTGAQVLNQ  162
            +LTSD  IE                        V I++PF FRA+PV AIES+G QVL Q
Sbjct  163  QLTSDTTIEVLYSQIPTESLLSYTQSAYYDNLQVTIDIPFPFRAIPVTAIESSGRQVLEQ  222

Query  161  ILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            +LG+MLPRF+ QLVKDYQAWA+GD+SR+PLGTG+I
Sbjct  223  LLGVMLPRFLNQLVKDYQAWASGDSSRKPLGTGEI  257



>ref|XP_002532619.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29750.1| conserved hypothetical protein [Ricinus communis]
Length=245

 Score =   292 bits (747),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 165/189 (87%), Gaps = 2/189 (1%)
 Frame = -1

Query  668  SPRGS-LRI-SADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVD  495
            SPR   LRI SA+A PK RFIARRKESV VRQL RPL+EYMSLPASQYSVLDAERIER+D
Sbjct  40   SPRKPFLRIVSANATPKARFIARRKESVWVRQLGRPLIEYMSLPASQYSVLDAERIERID  99

Query  494  DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMV  315
            DNTFRCYVYRF FFAFEVCPVLLV+VEEQP+GC I LLSCKLEGSP+VVAQN+KFDASMV
Sbjct  100  DNTFRCYVYRFNFFAFEVCPVLLVKVEEQPNGCCIKLLSCKLEGSPMVVAQNEKFDASMV  159

Query  314  NRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
            N IS D ++ +S  Q+LTSDAVIEV+I+VPFAF A+PVQA+ESTG+++L QIL +MLPRF
Sbjct  160  NYISCDSSQNNSSEQQLTSDAVIEVSIDVPFAFSAIPVQALESTGSRILEQILALMLPRF  219

Query  134  MAQLVKDYQ  108
            MAQ  +  Q
Sbjct  220  MAQFRRVLQ  228



>ref|XP_002981218.1| hypothetical protein SELMODRAFT_178693 [Selaginella moellendorffii]
 gb|EFJ17919.1| hypothetical protein SELMODRAFT_178693 [Selaginella moellendorffii]
Length=257

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -1

Query  641  ADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRF  462
            A + P+ R + R  ES  + +  RPL EYMSLPASQYSVLDA+RIERVDDNTF+CYV++ 
Sbjct  63   ARSEPRARLVGRASESYLLEETHRPLAEYMSLPASQYSVLDAQRIERVDDNTFKCYVHKL  122

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            KFFAFEVCPVL+V VEEQPDGC I LLSC LEGSPIVVAQN KF ASM NR+S+  + R 
Sbjct  123  KFFAFEVCPVLVVTVEEQPDGCIIKLLSCTLEGSPIVVAQNQKFSASMENRVSWKNSGRS  182

Query  281  SGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               +KL SDA IEV IEVPFAFRA+PVQAIESTG QVL Q+L +MLPRF++QL KDY+AW
Sbjct  183  PKSRKLISDATIEVTIEVPFAFRAIPVQAIESTGNQVLGQVLRVMLPRFLSQLEKDYRAW  242

Query  101  ATGDTSRQPLGTGQI  57
            A+GD+SR+PLGTGQ+
Sbjct  243  ASGDSSRRPLGTGQL  257



>ref|XP_002982688.1| hypothetical protein SELMODRAFT_58026, partial [Selaginella moellendorffii]
 gb|EFJ16441.1| hypothetical protein SELMODRAFT_58026, partial [Selaginella moellendorffii]
Length=193

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -1

Query  635  AAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKF  456
            + P+ R + R  ES  + +  RPL EYMSLPASQYSVLDA+RIERVDDNTF+CYV++ KF
Sbjct  1    SEPRARLVGRASESYLLEETHRPLAEYMSLPASQYSVLDAQRIERVDDNTFKCYVHKLKF  60

Query  455  FAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSG  276
            FAFEVCPVL+V VEEQPDGC I LLSC LEGSPIVVAQN KF ASM NR+S+  + R   
Sbjct  61   FAFEVCPVLVVTVEEQPDGCIIKLLSCTLEGSPIVVAQNQKFSASMENRVSWKNSGRSPK  120

Query  275  VQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
             +KL SDA IEV IEVPFAFRA+PVQAIESTG QVL Q+L +MLPRF++QL KDY+AWA+
Sbjct  121  SRKLISDATIEVTIEVPFAFRAIPVQAIESTGNQVLGQVLRVMLPRFLSQLEKDYRAWAS  180

Query  95   GDTSRQPLGTGQI  57
            GD SR+PLGTGQ+
Sbjct  181  GDRSRRPLGTGQL  193



>ref|XP_008232055.1| PREDICTED: uncharacterized protein LOC103331217 isoform X2 [Prunus 
mume]
Length=173

 Score =   287 bits (734),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLL  381
            EYMSLPASQYSVLDAERIERVD+NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LL
Sbjct  6    EYMSLPASQYSVLDAERIERVDENTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIKLL  65

Query  380  SCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPV  201
            SCKLEGSPI VAQNDKFDA MVN+IS   N+ +S +Q+L S+ VIEV+IE+PFAFRA+P 
Sbjct  66   SCKLEGSPIAVAQNDKFDAFMVNQISCTNNQSNSSLQQLRSETVIEVSIEIPFAFRAIPA  125

Query  200  QAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            QAIES+G QVL QIL IMLPRFM+QLV+DY+AWA+GD SRQPLGTG+I
Sbjct  126  QAIESSGTQVLEQILRIMLPRFMSQLVRDYRAWASGDRSRQPLGTGEI  173



>ref|XP_008232056.1| PREDICTED: uncharacterized protein LOC103331217 isoform X3 [Prunus 
mume]
Length=166

 Score =   282 bits (722),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVD+NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDENTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIKLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSPI VAQNDKFDA MVN+IS   N+ +S +Q+L S+ VIEV+IE+PFAFRA+P QA
Sbjct  61   KLEGSPIAVAQNDKFDAFMVNQISCTNNQSNSSLQQLRSETVIEVSIEIPFAFRAIPAQA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IES+G QVL QIL IMLPRFM+QLV+DY+AWA+GD SRQPLGTG+I
Sbjct  121  IESSGTQVLEQILRIMLPRFMSQLVRDYRAWASGDRSRQPLGTGEI  166



>ref|XP_006588985.1| PREDICTED: uncharacterized protein LOC100797206 isoform X2 [Glycine 
max]
Length=266

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQLVKDYQAW  102
            F++Q+    Q  
Sbjct  205  FVSQISNSVQCH  216



>ref|XP_006588992.1| PREDICTED: uncharacterized protein LOC100797206 isoform X9 [Glycine 
max]
Length=209

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQ  126
            F++Q
Sbjct  205  FVSQ  208



>ref|XP_009361430.1| PREDICTED: uncharacterized protein LOC103951706 isoform X2 [Pyrus 
x bretschneideri]
Length=166

 Score =   276 bits (707),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVD NTFRCYVYRFKFFAFEVCPVLLV+VEEQP+GC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDANTFRCYVYRFKFFAFEVCPVLLVKVEEQPNGCCIKLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KL+GSPI VAQN KFDA MVN+IS   N+ +S  Q+L SD VIEV+IE+PFAFRA+PVQA
Sbjct  61   KLDGSPIAVAQNAKFDAFMVNQISCASNQTNSSRQELKSDTVIEVSIEIPFAFRAIPVQA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IES+G QVL Q+L IMLPRFM+QLV+DY+AWA+GD SRQPLGTG+I
Sbjct  121  IESSGTQVLEQVLRIMLPRFMSQLVRDYRAWASGDRSRQPLGTGEI  166



>ref|XP_006588987.1| PREDICTED: uncharacterized protein LOC100797206 isoform X4 [Glycine 
max]
Length=235

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 162/206 (79%), Gaps = 3/206 (1%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQ---LVKDYQAWATGDTSRQPLG  69
            F++Q   L+ +  +    D  +  +G
Sbjct  205  FVSQAELLIDEIISLHLADLCKIAMG  230



>ref|XP_006588991.1| PREDICTED: uncharacterized protein LOC100797206 isoform X8 [Glycine 
max]
Length=222

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQ  126
            F++Q
Sbjct  205  FVSQ  208



>ref|XP_006588988.1| PREDICTED: uncharacterized protein LOC100797206 isoform X5 [Glycine 
max]
Length=234

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQL  123
            F++Q+
Sbjct  205  FVSQV  209



>gb|KHN02048.1| hypothetical protein glysoja_046281 [Glycine soja]
Length=238

 Score =   277 bits (708),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  677  SYDSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERV  498
            +  S R SLR SA  + K RF+ARRKES+SVRQLQRPL+EYM LPASQYSVLDAERIERV
Sbjct  25   ALKSQRLSLRASATPSQKARFVARRKESLSVRQLQRPLIEYMRLPASQYSVLDAERIERV  84

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            ++NTFRCYVYRFKFF  EVCPVLLV+VEEQPDGC I LLSCKLEGS +V AQNDKFDA M
Sbjct  85   NENTFRCYVYRFKFFNLEVCPVLLVKVEEQPDGCCIKLLSCKLEGSAMVAAQNDKFDALM  144

Query  317  VNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPR  138
            VNRIS D N   S +Q+LTSD +IEV+IE+PF F+A+P QAIES G QVL QIL IMLPR
Sbjct  145  VNRISCDSNANKSLMQQLTSDTIIEVSIEIPFPFQAIPKQAIESAGTQVLEQILRIMLPR  204

Query  137  FMAQ  126
            F++Q
Sbjct  205  FVSQ  208



>ref|XP_011031599.1| PREDICTED: uncharacterized protein LOC105130684 isoform X2 [Populus 
euphratica]
Length=204

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 148/200 (74%), Gaps = 39/200 (20%)
 Frame = -1

Query  656  SLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  477
            SLR SAD+ PK +F+ARRKESVSVRQL RPLMEYMSLPASQYSVLDAERIERVDDNTFRC
Sbjct  44   SLRASADSTPKAKFVARRKESVSVRQLGRPLMEYMSLPASQYSVLDAERIERVDDNTFRC  103

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            YVY FKFFAFE+CPVLLVRVEEQPDGC I LLSCKLEGSPIVVAQN+KFDASMVN+IS D
Sbjct  104  YVYSFKFFAFEICPVLLVRVEEQPDGCCIRLLSCKLEGSPIVVAQNEKFDASMVNQISCD  163

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
             N+ +S +Q+LTSDAVIE                                       LVK
Sbjct  164  SNQSNSTIQQLTSDAVIE---------------------------------------LVK  184

Query  116  DYQAWATGDTSRQPLGTGQI  57
            DY AWA+GD SRQPLGTG+I
Sbjct  185  DYHAWASGDASRQPLGTGEI  204



>ref|XP_011469393.1| PREDICTED: uncharacterized protein LOC101308329 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=219

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 1/187 (1%)
 Frame = -1

Query  665  PRGSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDN  489
            P   LR+SA    PK RF+ARR ESV V QLQRPL EYMSLPASQYSVLDAERIERVDDN
Sbjct  25   PNPRLRVSAVSTPPKARFVARRTESVPVPQLQRPLSEYMSLPASQYSVLDAERIERVDDN  84

Query  488  TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNR  309
            TFRCYVYRFKFFAFEVCPVLLV+VEEQP+GC I LLSCKL+GSPIVVAQNDKFDA MVN+
Sbjct  85   TFRCYVYRFKFFAFEVCPVLLVKVEEQPNGCCIKLLSCKLDGSPIVVAQNDKFDAYMVNQ  144

Query  308  ISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            IS   N   S +Q+L+SD VIEV+IE+PFAFRA+PVQAIES+G QVL QIL IMLPRF+A
Sbjct  145  ISCGSNDSSSSLQQLSSDTVIEVSIEIPFAFRAIPVQAIESSGTQVLEQILKIMLPRFLA  204

Query  128  QLVKDYQ  108
            Q++  ++
Sbjct  205  QVIYPFK  211



>dbj|BAG96419.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96517.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87118.1| unnamed protein product [Oryza sativa Japonica Group]
Length=166

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVD++TFRCYVYRF+FFA EVCPVLLVRV+E+P+GC I+LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDESTFRCYVYRFRFFALEVCPVLLVRVDEEPNGCCISLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSP+V AQNDKF ASMVN++  + +  DS  Q+LTSD  IEV I++PF FRALPV+A
Sbjct  61   KLEGSPLVEAQNDKFSASMVNKVFCNSSMSDSTSQQLTSDTTIEVTIDIPFPFRALPVEA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            IES+G QVL Q+L +MLPRF+ QLVKDYQAWA+GD+SR+PLGTG+I
Sbjct  121  IESSGKQVLEQLLRVMLPRFLKQLVKDYQAWASGDSSRKPLGTGEI  166



>ref|XP_010267294.1| PREDICTED: uncharacterized protein LOC104604582 isoform X2 [Nelumbo 
nucifera]
Length=223

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            + P+ S+ I AD+ P+ RF+ARR E+VSV+ L+RPL +YMSLPASQYSVLDAERIERVDD
Sbjct  38   NDPKPSVGIYADSTPRARFVARRSETVSVQLLERPLRDYMSLPASQYSVLDAERIERVDD  97

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NTFRCYVYRFKFFAFEVCPVLLVRVEEQP+GC I LLSCKLEGS +VVAQN+KF ASMVN
Sbjct  98   NTFRCYVYRFKFFAFEVCPVLLVRVEEQPNGCCIRLLSCKLEGSAVVVAQNEKFHASMVN  157

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFM  132
            +IS    + +  VQ+LTSD  IEV+I++PF FR++PV  IES G QV+ QIL IMLPRFM
Sbjct  158  QISCGNEQDNLSVQELTSDTTIEVSIDIPFPFRSIPVNVIESAGTQVIEQILRIMLPRFM  217

Query  131  AQL  123
             Q+
Sbjct  218  RQI  220



>ref|XP_011469392.1| PREDICTED: uncharacterized protein LOC101308329 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=224

 Score =   268 bits (685),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = -1

Query  665  PRGSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDN  489
            P   LR+SA    PK RF+ARR ESV V QLQRPL EYMSLPASQYSVLDAERIERVDDN
Sbjct  25   PNPRLRVSAVSTPPKARFVARRTESVPVPQLQRPLSEYMSLPASQYSVLDAERIERVDDN  84

Query  488  TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNR  309
            TFRCYVYRFKFFAFEVCPVLLV+VEEQP+GC I LLSCKL+GSPIVVAQNDKFDA MVN+
Sbjct  85   TFRCYVYRFKFFAFEVCPVLLVKVEEQPNGCCIKLLSCKLDGSPIVVAQNDKFDAYMVNQ  144

Query  308  ISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            IS   N   S +Q+L+SD VIEV+IE+PFAFRA+PVQAIES+G QVL QIL IMLPRF+A
Sbjct  145  ISCGSNDSSSSLQQLSSDTVIEVSIEIPFAFRAIPVQAIESSGTQVLEQILKIMLPRFLA  204

Query  128  QLVKDYQA  105
            Q    YQ 
Sbjct  205  QKRYRYQG  212



>ref|XP_001760515.1| predicted protein [Physcomitrella patens]
 gb|EDQ74590.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = -1

Query  635  AAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKF  456
            + P+ +F+A+R E+  + ++Q+PL EYM+LPASQYSVLDAERIERVDD  F+CY +RFKF
Sbjct  54   SGPRAKFLAQRVETYELEEVQKPLAEYMALPASQYSVLDAERIERVDDTMFKCYAHRFKF  113

Query  455  FAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSG  276
            F FEV PVLLV+V+ QPDGC I L+SC LEGSPIVVAQN+KF ASMVNR+S+  + +   
Sbjct  114  FNFEVGPVLLVKVDTQPDGCCIRLISCTLEGSPIVVAQNEKFSASMVNRVSWSVSEKSPT  173

Query  275  VQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
             +KL SD  +EV +E+   FRA+PV  IE +G +V++Q+L +MLPRF++QL KDY AWA+
Sbjct  174  ARKLISDTTLEVTVEIIKPFRAIPVSVIEGSGNKVMSQLLKVMLPRFLSQLGKDYYAWAS  233

Query  95   GDTSRQPLGTGQI  57
            GDTSR+P+GTG++
Sbjct  234  GDTSRKPVGTGEL  246



>ref|XP_006575157.1| PREDICTED: uncharacterized protein LOC100789119 isoform X2 [Glycine 
max]
Length=189

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 145/204 (71%), Gaps = 39/204 (19%)
 Frame = -1

Query  668  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDN  489
            SPR SLR SA  + K RF+ARRKESVSVRQLQRPL+EYM LPASQYSVLDAERIERV++N
Sbjct  25   SPRLSLRASATPSQKARFVARRKESVSVRQLQRPLIEYMRLPASQYSVLDAERIERVNEN  84

Query  488  TFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNR  309
            TFRCYVYRFKFF FEVCPVLLV+VEEQPDGC I LLSCKLEGSP+V AQNDKFDA MVNR
Sbjct  85   TFRCYVYRFKFFNFEVCPVLLVKVEEQPDGCCIKLLSCKLEGSPMVAAQNDKFDALMVNR  144

Query  308  ISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMA  129
            IS D N   S +Q+LTSD +IE                                      
Sbjct  145  ISCDSNANRSLMQQLTSDTIIE--------------------------------------  166

Query  128  QLVKDYQAWATGDTSRQPLGTGQI  57
             L KDYQAWA+GDTSRQPLGTG+I
Sbjct  167  -LEKDYQAWASGDTSRQPLGTGEI  189



>ref|XP_006485303.1| PREDICTED: uncharacterized protein LOC102621133 isoform X6 [Citrus 
sinensis]
Length=210

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSC
Sbjct  1    MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSC  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            KLEGSPIVVAQNDKFDASM+NRIS D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+A
Sbjct  61   KLEGSPIVVAQNDKFDASMINRISCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEA  120

Query  194  IESTGAQVLNQILGIMLPRFMAQ  126
            IES+G QVL+QIL +MLPRFM+Q
Sbjct  121  IESSGTQVLDQILKLMLPRFMSQ  143



>ref|XP_006485299.1| PREDICTED: uncharacterized protein LOC102621133 isoform X2 [Citrus 
sinensis]
Length=270

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 18/180 (10%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+A RKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVASRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLS                 +SM+NRI
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLS-----------------SSMINRI  143

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N R+S VQ+LTSDA IEV+IEVPFAFRA PV+AIES+G QVL+QIL +MLPRFM+Q
Sbjct  144  SCDSNSRNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESSGTQVLDQILKLMLPRFMSQ  203



>ref|XP_010907451.1| PREDICTED: uncharacterized protein LOC105034116 isoform X2 [Elaeis 
guineensis]
Length=191

 Score =   250 bits (638),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 147/202 (73%), Gaps = 40/202 (20%)
 Frame = -1

Query  659  GSLRISA-DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTF  483
            GS+R SA  +APK RFIA+R +S SV+QLQRPL+EYMSLPASQYSVLDAERIERVDDNTF
Sbjct  29   GSIRASAVSSAPKARFIAKRSDSTSVQQLQRPLLEYMSLPASQYSVLDAERIERVDDNTF  88

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRIS  303
            RCYVYR KFFAFE+CPVL+VRV+E+P+GC I LLSCKLEGSP+V AQN+KF ASMVNR+S
Sbjct  89   RCYVYRIKFFAFEICPVLVVRVDEEPNGCCIRLLSCKLEGSPLVEAQNEKFSASMVNRVS  148

Query  302  YDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
             +G  ++SG+Q+LT+D  IE                                       L
Sbjct  149  CNGGMQNSGMQQLTTDTTIE---------------------------------------L  169

Query  122  VKDYQAWATGDTSRQPLGTGQI  57
            VKDYQAWA+GDTSRQPLGTG++
Sbjct  170  VKDYQAWASGDTSRQPLGTGEL  191



>emb|CDY58441.1| BnaC03g71250D [Brassica napus]
Length=206

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 146/210 (70%), Gaps = 38/210 (18%)
 Frame = -1

Query  677  SYDSPRGS-LRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQ--YSVLDAERI  507
            S D P    +R+ + + PK RFI+R+K+SVSVRQLQRPL+EYMSLPAS+  YSVLDAERI
Sbjct  32   SLDEPSSPPIRVPSSSTPKARFISRQKQSVSVRQLQRPLIEYMSLPASRDPYSVLDAERI  91

Query  506  ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
            +R                              QP+GC I LLSCK     + + +NDKFD
Sbjct  92   KR------------------------------QPNGCCIKLLSCK-----VYLHKNDKFD  116

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIM  147
            ASMVNR+S D  +  S  Q++TSDAVIEVNIEVPFAFR  PV AIE+TG QVL+QIL +M
Sbjct  117  ASMVNRVSCDSTQEGSSEQRITSDAVIEVNIEVPFAFRVFPVGAIEATGTQVLDQILRLM  176

Query  146  LPRFMAQLVKDYQAWATGDTSRQPLGTGQI  57
            LPRF++QL KDYQAWA+GDTSRQPLGTG+I
Sbjct  177  LPRFLSQLSKDYQAWASGDTSRQPLGTGEI  206



>ref|XP_003590248.1| (RAP Annotation release2) Galactose-binding like domain containing 
protein [Medicago truncatula]
 gb|AES60499.1| RAP annotation release 2, galactose-binding-like domain protein 
[Medicago truncatula]
Length=168

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 117/142 (82%), Gaps = 4/142 (3%)
 Frame = -1

Query  653  LRISADAAP----KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            L + A A P    K RF+ARRKESVSV+QLQRPL+EYM LPASQYSVLDAERIERV ++T
Sbjct  24   LPLLASATPPSTHKARFVARRKESVSVQQLQRPLIEYMRLPASQYSVLDAERIERVSEDT  83

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            FRCYVY  KFF FEVCPVLLV+VE+QP+GC I LLSCKL+GSP+V AQNDKFDA MVNRI
Sbjct  84   FRCYVYTIKFFTFEVCPVLLVKVEQQPNGCCIKLLSCKLQGSPMVAAQNDKFDAIMVNRI  143

Query  305  SYDGNRRDSGVQKLTSDAVIEV  240
            S + +   S VQ+LTSD +IEV
Sbjct  144  SCESDSDKSLVQQLTSDTIIEV  165



>gb|KJB75125.1| hypothetical protein B456_012G025500 [Gossypium raimondii]
Length=180

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  644  SADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  465
            + D+ PK RF+ARRKES+SVRQL RPL+EYMSLPASQYSVLDAERIERVDDNTFRCYVYR
Sbjct  41   ATDSPPKARFVARRKESISVRQLNRPLIEYMSLPASQYSVLDAERIERVDDNTFRCYVYR  100

Query  464  FKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            FKFF FEVCPVLLVRVEEQP+GC I LLSCKLEGSPIVVAQNDKFD +
Sbjct  101  FKFFNFEVCPVLLVRVEEQPNGCCIKLLSCKLEGSPIVVAQNDKFDGA  148



>gb|KIZ06268.1| hypothetical protein MNEG_1694 [Monoraphidium neglectum]
Length=280

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 126/187 (67%), Gaps = 3/187 (2%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQ-RPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFE  444
            RF A ++    V++LQ R L EYM+LPASQYSVLDA +IERVD++TFRCYV +  F  F 
Sbjct  94   RFRATKQAVQVVQELQSRSLAEYMALPASQYSVLDARKIERVDESTFRCYVGQLSFLGFS  153

Query  443  VCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKL  264
            V PV+ V V  +P GC+I LLSC+L+GS +V   N+KF A M N + ++    D G +++
Sbjct  154  VEPVITVSVSVEPRGCTIRLLSCRLQGSRLVEEVNNKFSAQMTNAVVWEPT-EDPGAKQI  212

Query  263  TSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTS  84
            +S   + V++EVP  +  LP  A+E+ G+ V+   L  M+P F+ QL +DY  WA+GDTS
Sbjct  213  SSSTTLSVDVEVP-GWLVLPTSAVEAAGSGVMAATLNAMVPSFLRQLERDYALWASGDTS  271

Query  83   RQPLGTG  63
            R+PLG G
Sbjct  272  RRPLGEG  278



>emb|CAN67223.1| hypothetical protein VITISV_029052 [Vitis vinifera]
Length=178

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            +S + S RISAD APK RF+ARR+ESVSV+QL+RPL+EYMSLPASQYSVLDAERIERVDD
Sbjct  35   ESSKPSFRISADLAPKARFVARRRESVSVKQLERPLVEYMSLPASQYSVLDAERIERVDD  94

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKL  369
            NTFRCYVYRF+FFAFEVCPVL+V+VEEQP+GC I LLSCK+
Sbjct  95   NTFRCYVYRFRFFAFEVCPVLMVKVEEQPNGCCIRLLSCKV  135



>gb|KDO45176.1| hypothetical protein CISIN_1g026771mg [Citrus sinensis]
Length=140

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+ARRKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDDNT
Sbjct  41   KSPFRVSAATSPAKARFVARRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDDNT  100

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKL  369
            FRCYVYRFKFFAFE+CPVLLVRVEEQP+GC I LLSCKL
Sbjct  101  FRCYVYRFKFFAFEICPVLLVRVEEQPNGCCIKLLSCKL  139



>ref|XP_011015662.1| PREDICTED: uncharacterized protein LOC105119235, partial [Populus 
euphratica]
Length=125

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDD  492
            + P+ +LR SAD+APK +FIARR+ESVSVRQL RPL+EYMSLPASQYSVLDAERIERVDD
Sbjct  29   EYPKCTLRASADSAPKAKFIARRRESVSVRQLGRPLVEYMSLPASQYSVLDAERIERVDD  88

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLL  381
            NTFRCYVYRFKFFAFEVCPVLLVRVEEQP GC I LL
Sbjct  89   NTFRCYVYRFKFFAFEVCPVLLVRVEEQPTGCCIKLL  125



>ref|XP_005650144.1| hypothetical protein COCSUDRAFT_28145 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25600.1| hypothetical protein COCSUDRAFT_28145 [Coccomyxa subellipsoidea 
C-169]
Length=269

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 124/186 (67%), Gaps = 10/186 (5%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPV  432
            A++  ++++R+  RPL       ASQYSVLDA+RIER+DD TFRCYV   K F F + PV
Sbjct  93   AQKSAALALREGPRPL-------ASQYSVLDAKRIERIDDATFRCYVGGLKLFNFSIDPV  145

Query  431  LLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY-DGNRRDSGVQKLTSD  255
            L V V     G ++ LLS KLEGSP VVA NDKF A+M N + +  G   D  + +L SD
Sbjct  146  LTVSVTVTERGPTVKLLSTKLEGSPAVVAANDKFTATMKNDVRWSSGPAPD--LLELGSD  203

Query  254  AVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQP  75
              I+V +EVP  FR +PV AIE TG  V+ ++L  M+PRF+ QL  DY+ WA+GD SR+P
Sbjct  204  TSIQVALEVPGWFRMVPVSAIERTGCSVMQRVLDKMVPRFLNQLQADYELWASGDGSRKP  263

Query  74   LGTGQI  57
            +GTGQ+
Sbjct  264  IGTGQL  269



>ref|XP_001696559.1| hypothetical protein CHLREDRAFT_142225 [Chlamydomonas reinhardtii]
 gb|EDP08536.1| predicted protein [Chlamydomonas reinhardtii]
Length=272

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 117/192 (61%), Gaps = 21/192 (11%)
 Frame = -1

Query  581  QLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPD  402
            + QRPL EYM+LPASQYSVLDA RIERVDD TF+CYV   KFF++ V PV+ V V  +  
Sbjct  79   EAQRPLSEYMALPASQYSVLDARRIERVDDTTFKCYVGELKFFSWSVEPVITVSVTVEEG  138

Query  401  GCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY---------------------DGNRR  285
            GC+I LL CKL+GS  V   N+KF A+M N + Y                      G + 
Sbjct  139  GCTIRLLGCKLQGSSFVEDINNKFSATMTNVVRYRDYVPEPSSDSESESDGEEGETGKQP  198

Query  284  DSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQA  105
             +  +++ SD  I+V +EVP     LPV +I S G+ V+  +L +M+PRF+AQL  DY  
Sbjct  199  AAARKEIVSDTTIQVCLEVPAWSSFLPVDSISSAGSGVMQNVLNVMVPRFLAQLRTDYVL  258

Query  104  WATGDTSRQPLG  69
            WA GD SR+P+G
Sbjct  259  WAAGDESRKPVG  270



>ref|XP_002945783.1| hypothetical protein VOLCADRAFT_102752 [Volvox carteri f. nagariensis]
 gb|EFJ52778.1| hypothetical protein VOLCADRAFT_102752 [Volvox carteri f. nagariensis]
Length=225

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 120/208 (58%), Gaps = 37/208 (18%)
 Frame = -1

Query  581  QLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPD  402
            + QRPL EYM+LPASQYSVLDA RIERVDD+TFRCYV   +FF++ V PV+ V V  +P 
Sbjct  16   EAQRPLAEYMALPASQYSVLDARRIERVDDSTFRCYVGELRFFSWSVEPVITVSVTVEPG  75

Query  401  GCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGV-----------------  273
            GC+I LL CKL+GS  V   NDKF A+M N + Y   +  +G                  
Sbjct  76   GCTIRLLDCKLQGSRFVEDINDKFSATMTNVVRYRDYQPPAGEEEEEVETDQGHGAWQQQ  135

Query  272  --------------------QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILG  153
                                +++ SD  I+V +EVP     LPV  IE  G+ V+  +L 
Sbjct  136  QEEEAAAALPSRSATGGPSRKEILSDTTIQVCVEVPPWSGFLPVATIEGVGSNVMQNVLK  195

Query  152  IMLPRFMAQLVKDYQAWATGDTSRQPLG  69
            +M+PRF+AQL  DY+ WA+GD SR+P+G
Sbjct  196  VMVPRFLAQLRTDYELWASGDESRRPVG  223



>ref|XP_005844487.1| hypothetical protein CHLNCDRAFT_138831 [Chlorella variabilis]
 gb|EFN52385.1| hypothetical protein CHLNCDRAFT_138831 [Chlorella variabilis]
Length=232

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYV  471
            R++A         A ++  + V++  RPL EYM LPASQYSVLDA+RIER+D++TFRCYV
Sbjct  19   RLAAGGKRVAVLQAAKRAFLDVKEQGRPLAEYMVLPASQYSVLDAKRIERLDEDTFRCYV  78

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
               K F+ EV PV+ V V  Q  G ++ LLS KL+GS  V A N++FDA+M N + +   
Sbjct  79   GGLKLFSLEVEPVITVSVTVQERGPTVRLLSTKLKGSKAVEAANERFDATMTNVVRW--Q  136

Query  290  RRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
                G ++L SD  I+V ++VP  F  LP   IE TG  V+ ++L   +PRF+ QL  DY
Sbjct  137  EAPGGGKQLASDTFIQVQLQVPAWF-VLPTSTIERTGGAVMARVLESAVPRFLQQLSADY  195

Query  110  QAWATGDTSRQPLGTGQI  57
             AWA GD +RQP+  G +
Sbjct  196  AAWAAGDDTRQPVSEGGL  213



>gb|KDO45174.1| hypothetical protein CISIN_1g026771mg [Citrus sinensis]
Length=182

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 112/184 (61%), Gaps = 52/184 (28%)
 Frame = -1

Query  662  RGSLRISADAAP-KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNT  486
            +   R+SA  +P K RF+ARRKESV VRQLQRPL+EYMSLPASQYSVLDAERIERVDD  
Sbjct  41   KSPFRVSAATSPAKARFVARRKESVRVRQLQRPLIEYMSLPASQYSVLDAERIERVDD--  98

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
                                                             + F +SM+NRI
Sbjct  99   -------------------------------------------------NTFRSSMINRI  109

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQ  126
            S D N  +S VQ+LTSDA IEV+IEVPFAFRA PV+AIESTG QVL+QIL +MLPRFM+Q
Sbjct  110  SCDSNSSNSEVQQLTSDAFIEVSIEVPFAFRAFPVEAIESTGTQVLDQILKLMLPRFMSQ  169

Query  125  LVKD  114
            + + 
Sbjct  170  VSRS  173



>ref|XP_011399169.1| hypothetical protein F751_4766 [Auxenochlorella protothecoides]
 gb|KFM26273.1| hypothetical protein F751_4766 [Auxenochlorella protothecoides]
Length=166

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            M+LPASQYSVLDAE +ER+DD+TF C+V    FF+FEV PVL V V   P G +++LL  
Sbjct  1    MALPASQYSVLDAETVERLDDDTFLCHVAGLTFFSFEVHPVLTVSVSVGPTGPTVDLLKT  60

Query  374  KLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQA  195
            +L GS  V A N++F A M NR+S+     + G + L SD  + V +E+P  F  LP  A
Sbjct  61   ELRGSRTVRAANERFTARMRNRVSWKPG-EEEGARVLVSDVDLTVTLELPGWF-PLPRGA  118

Query  194  IESTGAQVLNQILG----IMLPRFMAQLVKDYQAWATG  93
            +++TG    N +LG    + LPRF+ QL KDYQ WA G
Sbjct  119  VQATGEWCGNAVLGRVLDVALPRFLKQLEKDYQLWAEG  156



>ref|XP_002508023.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69281.1| predicted protein [Micromonas sp. RCC299]
Length=295

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 109/173 (63%), Gaps = 8/173 (5%)
 Frame = -1

Query  572  RPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPD--G  399
            R L EYMSLPASQYS LD ER+ERV D+TF C +  F F  F + PVL  RV+ +PD  G
Sbjct  115  RSLREYMSLPASQYSTLDGERVERVGDDTFVCTLGAFDFLGFRLQPVLTARVDVRPDGQG  174

Query  398  CSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRR---DSGVQKLTSDAVIEVNIEV  228
            C I ++S ++ GS +V + N  F+   VNR+ +  N R    +G  ++ S+  + V + V
Sbjct  175  CVIRVVSAEIHGSGVVESVNGMFEIDSVNRVGW--NERCNPGTGQCEIASETKVTVYLLV  232

Query  227  PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLG  69
            P  F    V+A E TG  V++Q++  ++PRF++QLV DY+AWA GD SR+  G
Sbjct  233  PKWF-PFTVKATERTGNFVVSQVVNQVVPRFLSQLVTDYEAWAAGDESREAKG  284



>ref|XP_007515807.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14686.1| predicted protein [Bathycoccus prasinos]
Length=444

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 113/196 (58%), Gaps = 8/196 (4%)
 Frame = -1

Query  617  FIARRKESVSVRQLQRP---LMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAF  447
            F A++  +V V ++  P   L EYMSLPA+ YS LD E ++R+DD TF C +    F  F
Sbjct  228  FSAKKSGTVHVLEVSDPSRGLREYMSLPATSYSTLDGETVKRIDDCTFECTLGTLSFLGF  287

Query  446  EVCPVLLVRVEEQPDGCS--INLLSCKLEGSPIVVAQNDKFDASMVNRISY-DGNRRDSG  276
            ++ P +  +V+ +P+G    I++    + GS IV   N++F  S VN +S+ D    +  
Sbjct  288  KITPTVTAKVDVRPNGAGPMISVEEATISGSKIVEDANEQFQLSSVNDVSWFDSATEEFP  347

Query  275  VQK-LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
             QK + SD  + V + VP  F    V++ E TG  V+NQ++G ++PRF+ QL  DY+ W+
Sbjct  348  NQKTIQSDTTVSVYLIVPRWF-PFTVKSTERTGRFVVNQVVGQVVPRFLKQLKADYEVWS  406

Query  98   TGDTSRQPLGTGQI*D  51
             GD SR+ +  G + D
Sbjct  407  LGDDSRKAVCEGGLFD  422



>ref|XP_010278459.1| PREDICTED: uncharacterized protein LOC104612648 isoform X3 [Nelumbo 
nucifera]
Length=272

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 104/201 (52%), Gaps = 18/201 (9%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQR-------PLMEYMSLPASQYSVLDA---  516
            P+  +  S     K    ARRKESV +            P+  +++ P+   ++L+    
Sbjct  68   PKAEVSGSNSNVKKANLFARRKESVKLPNYDDGCGGNLYPISAFLNHPSGVETILNKDAL  127

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            + ++ +D NT+RC + + +   FEV PVL +RV    + C + +LSCK EGS  +  QND
Sbjct  128  QSLQSLDSNTYRCTLQKIQLLNFEVAPVLDLRVTTTNEDCIVEMLSCKFEGSEAMECQND  187

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLN  165
             F ASMVN + +D +  +     L  D  + + +E+   PF    LPV A+E+ G  ++ 
Sbjct  188  HFSASMVNHMKWDASTSEPS---LDVDVKLSITLEIYTRPFTL--LPVSAVENPGNLIMQ  242

Query  164  QILGIMLPRFMAQLVKDYQAW  102
            +++  ++   + +L++DY  W
Sbjct  243  RLVDKLVSLLVERLLQDYDKW  263



>ref|XP_010278460.1| PREDICTED: uncharacterized protein LOC104612648 isoform X4 [Nelumbo 
nucifera]
Length=266

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 106/201 (53%), Gaps = 24/201 (12%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQR-------PLMEYMSLPASQYSVLDA---  516
            P+  +  S     K    ARRKESV +            P+  +++ P+   ++L+    
Sbjct  68   PKAEVSGSNSNVKKANLFARRKESVKLPNYDDGCGGNLYPISAFLNHPSGVETILNKDAL  127

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            + ++ +D NT+RC + + +   FEV PVL +RV    + C + +LSCK EGS  +  QND
Sbjct  128  QSLQSLDSNTYRCTLQKIQLLNFEVAPVLDLRVTTTNEDCIVEMLSCKFEGSEAMECQND  187

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLN  165
             F ASMVN + +D +         TS+  ++V++++   PF    LPV A+E+ G  ++ 
Sbjct  188  HFSASMVNHMKWDAS---------TSEPSLDVDVKIYTRPFTL--LPVSAVENPGNLIMQ  236

Query  164  QILGIMLPRFMAQLVKDYQAW  102
            +++  ++   + +L++DY  W
Sbjct  237  RLVDKLVSLLVERLLQDYDKW  257



>ref|XP_010278461.1| PREDICTED: uncharacterized protein LOC104612648 isoform X5 [Nelumbo 
nucifera]
Length=232

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 103/207 (50%), Gaps = 22/207 (11%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQR-------PLMEYMSLPASQYSVLDA---  516
            P+  +  S     K    ARRKESV +            P+  +++ P+   ++L+    
Sbjct  20   PKAEVSGSNSNVKKANLFARRKESVKLPNYDDGCGGNLYPISAFLNHPSGVETILNKDAL  79

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            + ++ +D NT+RC + + +   FEV PVL +RV    + C + +LSCK EGS  +  QND
Sbjct  80   QSLQSLDSNTYRCTLQKIQLLNFEVAPVLDLRVTTTNEDCIVEMLSCKFEGSEAMECQND  139

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---------FRALPVQAIEST  183
             F ASMVN + +D +  +     L  D  + + +E  F          F  LPV A+E+ 
Sbjct  140  HFSASMVNHMKWDASTSEPS---LDVDVKLSITLEFCFVYHLQIYTRPFTLLPVSAVENP  196

Query  182  GAQVLNQILGIMLPRFMAQLVKDYQAW  102
            G  ++ +++  ++   + +L++DY  W
Sbjct  197  GNLIMQRLVDKLVSLLVERLLQDYDKW  223



>ref|XP_010278457.1| PREDICTED: uncharacterized protein LOC104612648 isoform X2 [Nelumbo 
nucifera]
Length=279

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 103/207 (50%), Gaps = 22/207 (11%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQR-------PLMEYMSLPASQYSVLDA---  516
            P+  +  S     K    ARRKESV +            P+  +++ P+   ++L+    
Sbjct  67   PKAEVSGSNSNVKKANLFARRKESVKLPNYDDGCGGNLYPISAFLNHPSGVETILNKDAL  126

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            + ++ +D NT+RC + + +   FEV PVL +RV    + C + +LSCK EGS  +  QND
Sbjct  127  QSLQSLDSNTYRCTLQKIQLLNFEVAPVLDLRVTTTNEDCIVEMLSCKFEGSEAMECQND  186

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---------FRALPVQAIEST  183
             F ASMVN + +D +  +     L  D  + + +E  F          F  LPV A+E+ 
Sbjct  187  HFSASMVNHMKWDASTSEPS---LDVDVKLSITLEFCFVYHLQIYTRPFTLLPVSAVENP  243

Query  182  GAQVLNQILGIMLPRFMAQLVKDYQAW  102
            G  ++ +++  ++   + +L++DY  W
Sbjct  244  GNLIMQRLVDKLVSLLVERLLQDYDKW  270



>ref|XP_010278456.1| PREDICTED: uncharacterized protein LOC104612648 isoform X1 [Nelumbo 
nucifera]
Length=280

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 103/207 (50%), Gaps = 22/207 (11%)
 Frame = -1

Query  665  PRGSLRISADAAPKVRFIARRKESVSVRQLQR-------PLMEYMSLPASQYSVLDA---  516
            P+  +  S     K    ARRKESV +            P+  +++ P+   ++L+    
Sbjct  68   PKAEVSGSNSNVKKANLFARRKESVKLPNYDDGCGGNLYPISAFLNHPSGVETILNKDAL  127

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            + ++ +D NT+RC + + +   FEV PVL +RV    + C + +LSCK EGS  +  QND
Sbjct  128  QSLQSLDSNTYRCTLQKIQLLNFEVAPVLDLRVTTTNEDCIVEMLSCKFEGSEAMECQND  187

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---------FRALPVQAIEST  183
             F ASMVN + +D +  +     L  D  + + +E  F          F  LPV A+E+ 
Sbjct  188  HFSASMVNHMKWDASTSEPS---LDVDVKLSITLEFCFVYHLQIYTRPFTLLPVSAVENP  244

Query  182  GAQVLNQILGIMLPRFMAQLVKDYQAW  102
            G  ++ +++  ++   + +L++DY  W
Sbjct  245  GNLIMQRLVDKLVSLLVERLLQDYDKW  271



>emb|CDY11292.1| BnaA03g01280D [Brassica napus]
Length=159

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -1

Query  320  MVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLP  141
            MVNR+S D  +  S  Q++TSDAVIEV+IEVPFAFR  PV AIE+TG +VL+QIL +MLP
Sbjct  1    MVNRVSCDSTQEGSSEQRITSDAVIEVSIEVPFAFRVFPVGAIEATGTRVLDQILRLMLP  60

Query  140  RFMAQLVKDYQA  105
            RF++QL KDYQA
Sbjct  61   RFLSQLSKDYQA  72



>ref|XP_007011489.1| Uncharacterized protein TCM_036761 [Theobroma cacao]
 gb|EOY29108.1| Uncharacterized protein TCM_036761 [Theobroma cacao]
Length=259

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 90/163 (55%), Gaps = 19/163 (12%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
             ++S P+   ++L+   ++    +D N +RC + +  FF FE  PVL +RV    + C++
Sbjct  98   HFLSHPSGIQAILNTSALQNFQYLDTNAYRCTLPKLAFFNFEATPVLDLRVIPTKEDCTV  157

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             L SCK +GS +V  QND F ASM+N I++D +          S+  +EVN+++  +   
Sbjct  158  ELFSCKFKGSKVVERQNDYFSASMINHITWDTD---------ISEPFLEVNVKLNLSLEI  208

Query  218  ----FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
                F +LP+ A+E  G  ++  ++  ++P  + QLV+DY  W
Sbjct  209  YTRPFTSLPISAVERPGNLMMQALVDGLVPSLLQQLVQDYNNW  251



>ref|XP_006851017.1| hypothetical protein AMTR_s00025p00222570 [Amborella trichopoda]
 gb|ERN12598.1| hypothetical protein AMTR_s00025p00222570 [Amborella trichopoda]
Length=291

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 96/185 (52%), Gaps = 13/185 (7%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQ------LQRPLMEYMSLPASQYSVLDAERI---ERVDDNTFRCY  474
            K    A+RKE V +        +  P   +++ P    S+L+   +   E +D NT+RC 
Sbjct  71   KANLYAKRKERVKLPNYVDDYGISYPFSSFLAHPLGMESILNTRALQCFELLDSNTYRCT  130

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            + +     FEV P+L +RV    D C + LLSCK EGS  +  Q+ +F A M N I++D 
Sbjct  131  LQKISLLKFEVTPILDLRVTTTTDDCVVELLSCKFEGSEAIERQSQRFSAFMRNHITWDT  190

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFA-FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
            N  ++    L  D  + + +EV  A F  LP+ A+E+ G  ++  ++  ++P  + QL++
Sbjct  191  NCIEAF---LDMDVKLNITLEVFMAPFTRLPITAVETPGNLLMQALVDKLVPLLIQQLLQ  247

Query  116  DYQAW  102
            DY  W
Sbjct  248  DYHQW  252



>ref|XP_003080940.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL55108.1| Protein of unknown function DUF1997 [Ostreococcus tauri]
Length=284

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 107/199 (54%), Gaps = 18/199 (9%)
 Frame = -1

Query  593  VSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLL--VR  420
            V  R   R + EYM+LPAS+YS LD E +ERV ++TFR  +    F  F + P L   VR
Sbjct  80   VRERDDGRAVREYMALPASEYSTLDGESVERVSEDTFRVELSELSFLGFTLRPTLTARVR  139

Query  419  VEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD------------SG  276
            V E   GC + +   +L GS IV + ++ F+   VN +++    ++            SG
Sbjct  140  VREDGSGCEVRVEEMELSGSGIVESASEAFEIVSVNNVTWSDVPKEALNAEELEVLEASG  199

Query  275  --VQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               +   S+  + V + +P  F    +++ E TG  V++Q++G ++PRF+ QL +DY+ W
Sbjct  200  GEFKDFHSETRVSVYLIIPGWF-PFTIKSTERTGRFVVSQVVGQVVPRFLDQLAEDYRMW  258

Query  101  ATGDTSRQPLGTGQI*DCK  45
            ++GD SR   G G   +CK
Sbjct  259  SSGDDSRTATGGGMF-ECK  276



>ref|XP_010929424.1| PREDICTED: uncharacterized protein LOC105050903 isoform X1 [Elaeis 
guineensis]
Length=259

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 100/178 (56%), Gaps = 13/178 (7%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +   + P+   ++++ P+   ++L+   +     +D +T+RC + + +F  F
Sbjct  79   ARRKERIKLPDFEGPITFSDFLNHPSGVEALLNTRALHSFQPLDSHTYRCTLQKIQFLKF  138

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EV PVL +RV    +GC++ +L C+ EGS  V  QN  F A M N I+++   R+     
Sbjct  139  EVAPVLDLRVTPTREGCTVEMLDCRFEGSETVQQQNHAFSAFMRNHITWE---RNDSEPC  195

Query  266  LTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            L  D  ++V++EV   PF+   LP+ A+E  G  ++  +L  ++P  + QL+ DY+ W
Sbjct  196  LDVDVHLKVSLEVYTKPFSL--LPLSAVEKPGNLLMQGLLDRLVPLLVEQLLNDYRTW  251



>ref|XP_010525838.1| PREDICTED: uncharacterized protein LOC104803576 isoform X2 [Tarenaya 
hassleriana]
Length=247

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 107/207 (52%), Gaps = 27/207 (13%)
 Frame = -1

Query  650  RISADAAPKVRFI---ARRKESVSVRQLQR-----PL------------MEYMSLPASQY  531
            RI    A K R I   + +K ++S  + QR     PL             E+++ P+   
Sbjct  32   RIQMGNAQKTRLIPVSSSKKANLSASKKQRIKLPIPLEDDVNEGKKLAFGEFLNHPSGME  91

Query  530  SVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGS  360
            +VL+   ++    + DNT+RC + + +  +FE  PV+ +RV      C++ LLSCKLEGS
Sbjct  92   AVLNVNALQSYHSLGDNTYRCRLPKIQLLSFEAAPVVDLRVTPMNQTCTVELLSCKLEGS  151

Query  359  PIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIEST  183
             I+ +Q+D F A M+N +++     D     L  D  +++ +E+    F  LPV A+E  
Sbjct  152  EILNSQSDSFSAVMINHMTWGIGDPDP---FLEVDVKLDLTLEISTMPFTMLPVSAVELP  208

Query  182  GAQVLNQILGIMLPRFMAQLVKDYQAW  102
            G  V+  ++  ++P  + QL+KDY+ W
Sbjct  209  GNLVMQTLIDSLVPLLLQQLMKDYEEW  235



>ref|XP_009132210.1| PREDICTED: uncharacterized protein LOC103856828 [Brassica rapa]
Length=273

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -1

Query  320  MVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLP  141
            MVNR+S D     S  Q++TSDAVIEVNIEV FAFR  PV AIE+TG QVL+QIL +MLP
Sbjct  1    MVNRVSCDSTLEGSSEQRITSDAVIEVNIEVSFAFRVFPVGAIEATGTQVLDQILRLMLP  60

Query  140  RFMAQLVKDYQA  105
            RF++QL KDYQA
Sbjct  61   RFLSQLSKDYQA  72



>ref|XP_006601096.1| PREDICTED: uncharacterized protein LOC100813897 isoform X2 [Glycine 
max]
 ref|XP_006601097.1| PREDICTED: uncharacterized protein LOC100813897 isoform X3 [Glycine 
max]
Length=211

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  6    KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  65

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  66   SFESLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  125

Query  332  FDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQ  162
            F A M N++++ G   +S    L  D  + + +E+   PF    +P  A+E  G  ++  
Sbjct  126  FSAFMRNQMTWGGAGAESF---LEVDVKLNLTLEIYTQPFTM--MPTSAVEGPGNIMMQA  180

Query  161  ILGIMLPRFMAQLVKDYQAW  102
            ++  ++P  + Q+++DY  W
Sbjct  181  LVDKLVPLLLQQMLQDYDEW  200



>dbj|BAJ86576.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=268

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 89/167 (53%), Gaps = 13/167 (8%)
 Frame = -1

Query  575  QRPLMEYMSLPASQYSVLDAER------IERVDDNTFRCYVYRFKFFAFEVCPVLLVRVE  414
            Q  + E++  PA   S+L+         +E   D TFRC ++   F  F+V PVL +RV 
Sbjct  96   QGGIGEFLRHPAGVESLLNTRALQSFAPVESESDGTFRCTLHPMGFLGFQVAPVLDLRVT  155

Query  413  EQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNI  234
               D C++ +LSC+ EGS  +  QN+ F A M NRI++  N  +     L  D  +EV +
Sbjct  156  PTRDDCTVEMLSCRFEGSDSIEQQNELFSAVMTNRITWGDNGDEEPC--LDIDVNLEVTL  213

Query  233  EV---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            EV   PF+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  214  EVYTKPFSL--LPLSAVEKPGNLLMQGLLDRLVPMLGEQLLRDYHSW  258



>ref|XP_003539141.1| PREDICTED: uncharacterized protein LOC100803285 isoform X1 [Glycine 
max]
 ref|XP_006591052.1| PREDICTED: uncharacterized protein LOC100803285 isoform X3 [Glycine 
max]
 ref|XP_006591053.1| PREDICTED: uncharacterized protein LOC100803285 isoform X4 [Glycine 
max]
Length=211

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  6    KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  65

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  66   SFESLDANTYRCELPKLQFLNFEAVPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  125

Query  332  FDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQ  162
            F A M N++++ G   +S    L  D  + + +E+   PF    +P  A+E  G  ++  
Sbjct  126  FSAFMRNQMTWGGAGAESF---LEVDVKLNLTLEIYTQPFTM--MPTSAVEGPGNIMMQA  180

Query  161  ILGIMLPRFMAQLVKDYQAW  102
            ++  ++P  + Q+++DY  W
Sbjct  181  LVDKLVPLLLQQMLQDYDEW  200



>ref|XP_003572385.1| PREDICTED: uncharacterized protein LOC100842768 [Brachypodium 
distachyon]
Length=287

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 85/164 (52%), Gaps = 13/164 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIE--------RVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQP  405
            E++  PA   S+L+   +E            +TFRC + R  F  F+V PVL +RV    
Sbjct  114  EFLRHPAGVESLLNTRALESFAPVESAESGGSTFRCTLQRMGFLGFQVAPVLDLRVAPTC  173

Query  404  DGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-  228
              C++ +LSCK EGS  +  QN+ F A M N I++ GN  D     L  D  +EV +EV 
Sbjct  174  ADCTVEMLSCKFEGSDSIEQQNELFSAFMRNHITWGGNGDDEEEPCLDIDVNLEVTLEVY  233

Query  227  --PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
              PF+   LP+ A+E  G  ++  +L  ++P    QL++DY  W
Sbjct  234  TKPFSL--LPLSAVEKPGNLLMQGLLDRLVPMLGEQLLRDYHTW  275



>ref|XP_010525837.1| PREDICTED: uncharacterized protein LOC104803576 isoform X1 [Tarenaya 
hassleriana]
Length=267

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 107/207 (52%), Gaps = 27/207 (13%)
 Frame = -1

Query  650  RISADAAPKVRFI---ARRKESVSVRQLQR-----PL------------MEYMSLPASQY  531
            RI    A K R I   + +K ++S  + QR     PL             E+++ P+   
Sbjct  52   RIQMGNAQKTRLIPVSSSKKANLSASKKQRIKLPIPLEDDVNEGKKLAFGEFLNHPSGME  111

Query  530  SVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGS  360
            +VL+   ++    + DNT+RC + + +  +FE  PV+ +RV      C++ LLSCKLEGS
Sbjct  112  AVLNVNALQSYHSLGDNTYRCRLPKIQLLSFEAAPVVDLRVTPMNQTCTVELLSCKLEGS  171

Query  359  PIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIEST  183
             I+ +Q+D F A M+N +++     D     L  D  +++ +E+    F  LPV A+E  
Sbjct  172  EILNSQSDSFSAVMINHMTWGIGDPDPF---LEVDVKLDLTLEISTMPFTMLPVSAVELP  228

Query  182  GAQVLNQILGIMLPRFMAQLVKDYQAW  102
            G  V+  ++  ++P  + QL+KDY+ W
Sbjct  229  GNLVMQTLIDSLVPLLLQQLMKDYEEW  255



>gb|ADE77926.1| unknown [Picea sitchensis]
Length=311

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 102/190 (54%), Gaps = 13/190 (7%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQ------RPLMEYMSLPASQYSVLDAERI---ERVDDNTFRCY  474
            K    A+R E +S+   +      +P+ ++ S P+ + S+L+   +   E +  NT+RC 
Sbjct  104  KANLFAKRSERISLPIYKDSVGTPQPISKFFSHPSGKTSMLNTSALQDFECLGPNTYRCT  163

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            + + +F  FEV P+L +RV   P+ C++ +LSC++ GS  + +QN++F A   N I+++ 
Sbjct  164  LLKIEFLNFEVTPILDLRVITTPEDCTVEMLSCRIGGSKTLESQNERFSAKAKNYITWNT  223

Query  293  NRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
               +  V     +  + V +EV    F  LP   +E  G  ++  +L  ++P F+ QL++
Sbjct  224  ECEEQFVH---VNVELNVTLEVYTLPFSLLPSSVVERPGNIIMQTLLDRLVPVFLEQLLE  280

Query  116  DYQAWATGDT  87
            DY+ W   DT
Sbjct  281  DYKNWVQMDT  290



>ref|XP_003549214.1| PREDICTED: uncharacterized protein LOC100813897 isoform X1 [Glycine 
max]
Length=244

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  39   KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  98

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  99   SFESLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  158

Query  332  FDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQ  162
            F A M N++++ G   +S    L  D  + + +E+   PF    +P  A+E  G  ++  
Sbjct  159  FSAFMRNQMTWGGAGAESF---LEVDVKLNLTLEIYTQPFTM--MPTSAVEGPGNIMMQA  213

Query  161  ILGIMLPRFMAQLVKDYQAW  102
            ++  ++P  + Q+++DY  W
Sbjct  214  LVDKLVPLLLQQMLQDYDEW  233



>ref|XP_008812689.1| PREDICTED: uncharacterized protein LOC103723532 isoform X3 [Phoenix 
dactylifera]
Length=261

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 99/178 (56%), Gaps = 9/178 (5%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +     P+   ++++ P+   ++L+   +     +D NT+RC + + +F  F
Sbjct  80   ARRKERIELPHYGGPITFSDFVNHPSGVEALLNTRALHSFRPLDSNTYRCTLQKIQFLKF  139

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EV PVL +RV    +GC++ ++ C+ EGS IV  QN  F A + N I+++   R+     
Sbjct  140  EVAPVLDLRVTPTREGCTVEMVDCRFEGSGIVEQQNHVFSAFVRNHITWE---RNGSEPC  196

Query  266  LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
            L  D  ++V++EV    F  LP+ A+E  G  ++  +L  ++P  + QL+ DY+ W +
Sbjct  197  LDVDVNLKVSLEVYTKPFNLLPLSAVEKPGNLLMQGLLDRLVPLLVEQLLDDYRTWVS  254



>ref|XP_006591051.1| PREDICTED: uncharacterized protein LOC100803285 isoform X2 [Glycine 
max]
Length=244

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 18/200 (9%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  39   KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  98

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  99   SFESLDANTYRCELPKLQFLNFEAVPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  158

Query  332  FDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQ  162
            F A M N++++ G   +S    L  D  + + +E+   PF    +P  A+E  G  ++  
Sbjct  159  FSAFMRNQMTWGGAGAESF---LEVDVKLNLTLEIYTQPFTM--MPTSAVEGPGNIMMQA  213

Query  161  ILGIMLPRFMAQLVKDYQAW  102
            ++  ++P  + Q+++DY  W
Sbjct  214  LVDKLVPLLLQQMLQDYDEW  233



>ref|XP_008812687.1| PREDICTED: uncharacterized protein LOC103723532 isoform X1 [Phoenix 
dactylifera]
Length=293

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 99/178 (56%), Gaps = 9/178 (5%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +     P+   ++++ P+   ++L+   +     +D NT+RC + + +F  F
Sbjct  112  ARRKERIELPHYGGPITFSDFVNHPSGVEALLNTRALHSFRPLDSNTYRCTLQKIQFLKF  171

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EV PVL +RV    +GC++ ++ C+ EGS IV  QN  F A + N I+++   R+     
Sbjct  172  EVAPVLDLRVTPTREGCTVEMVDCRFEGSGIVEQQNHVFSAFVRNHITWE---RNGSEPC  228

Query  266  LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
            L  D  ++V++EV    F  LP+ A+E  G  ++  +L  ++P  + QL+ DY+ W +
Sbjct  229  LDVDVNLKVSLEVYTKPFNLLPLSAVEKPGNLLMQGLLDRLVPLLVEQLLDDYRTWVS  286



>ref|XP_010447620.1| PREDICTED: uncharacterized protein LOC104730187 isoform X1 [Camelina 
sativa]
Length=250

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 95/159 (60%), Gaps = 9/159 (6%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERVD-----DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P+   +V++A+ ++        D+T+RC + + +  ++EV PVL++RV    + C
Sbjct  82   EFLKHPSGMEAVINAKALQSYHLVEDSDDTYRCTLPKVQLMSYEVYPVLILRVTPTQEDC  141

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-A  219
            ++ LLSCKLEGS ++ +Q+++F A+M N ++++    D  ++    D  + V +E+    
Sbjct  142  TVELLSCKLEGSELLESQSERFSANMTNCMTWNMEDPDPFLE---VDVRLNVTLEISTRP  198

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F  LPV A+E+ G  V+  ++  ++P  + QL+KDY  W
Sbjct  199  FTMLPVSAVEAPGNLVMQTLVDTLVPLMLQQLLKDYDEW  237



>ref|XP_011003440.1| PREDICTED: uncharacterized protein LOC105110188 isoform X2 [Populus 
euphratica]
Length=238

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 21/188 (11%)
 Frame = -1

Query  626  KVRFIARRKE--SVSVRQLQRPLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRF  462
            K    A RKE  ++ +      + E++S P    ++L+    +  E +D NT+RC + + 
Sbjct  52   KANLTAARKERMNLPITDGGYRISEFLSHPFGIQAILNTGSLQSFESLDANTYRCILPKV  111

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FE  PVL +RV    + C++ ++SCK +GS +V  QND+F A MVN ++++ N   
Sbjct  112  ELLNFEAAPVLDLRVSPSDEHCTVEMISCKFQGSELVERQNDRFSAFMVNHMTWNTN---  168

Query  281  SGVQKLTSDAVIEVNIEVPFA-------FRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
                   S+  +EV++++          F  LP  A+ES G  V+  +L  ++P  + QL
Sbjct  169  ------ISEPFLEVDVKLNLMLEIYTKPFTLLPTSAVESAGNLVMQALLDRLVPLLIEQL  222

Query  122  VKDYQAWA  99
            + DY  W 
Sbjct  223  LLDYNKWT  230



>emb|CDX72292.1| BnaC07g43140D [Brassica napus]
Length=245

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 110/196 (56%), Gaps = 14/196 (7%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSV---RQLQRPLMEYMSLPASQYSVLDAERIERV--  498
            R ++ IS+  + K    A RK+ +++   R+ +    E++  P+   +V++A+ ++    
Sbjct  45   RATMVISS--SKKANLTASRKQRINLQSNREKELTFSEFLKHPSGMEAVINAKALQSYQL  102

Query  497  ---DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
               DDNT+RC +   +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q++ F 
Sbjct  103  VDDDDNTYRCTLPTIQLMSFEVSPVLVLRVIPTQEDCTVELLSCKLEGSELLENQSEMFS  162

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGI  150
            A M N ++++    +     L  D  ++V +E+    F  LPV A+E+ G  V+  ++  
Sbjct  163  AFMTNCMTWNMEDPEPF---LEVDVSLKVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDT  219

Query  149  MLPRFMAQLVKDYQAW  102
            ++P  + QL+KDY  W
Sbjct  220  LVPLLLQQLLKDYDEW  235



>ref|XP_011003439.1| PREDICTED: uncharacterized protein LOC105110188 isoform X1 [Populus 
euphratica]
Length=259

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 97/188 (52%), Gaps = 21/188 (11%)
 Frame = -1

Query  626  KVRFIARRKE--SVSVRQLQRPLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRF  462
            K    A RKE  ++ +      + E++S P    ++L+    +  E +D NT+RC + + 
Sbjct  73   KANLTAARKERMNLPITDGGYRISEFLSHPFGIQAILNTGSLQSFESLDANTYRCILPKV  132

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FE  PVL +RV    + C++ ++SCK +GS +V  QND+F A MVN ++++ N   
Sbjct  133  ELLNFEAAPVLDLRVSPSDEHCTVEMISCKFQGSELVERQNDRFSAFMVNHMTWNTN---  189

Query  281  SGVQKLTSDAVIEVNIEVPFA-------FRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
                   S+  +EV++++          F  LP  A+ES G  V+  +L  ++P  + QL
Sbjct  190  ------ISEPFLEVDVKLNLMLEIYTKPFTLLPTSAVESAGNLVMQALLDRLVPLLIEQL  243

Query  122  VKDYQAWA  99
            + DY  W 
Sbjct  244  LLDYNKWT  251



>ref|XP_010447621.1| PREDICTED: uncharacterized protein LOC104730187 isoform X2 [Camelina 
sativa]
Length=250

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 95/159 (60%), Gaps = 9/159 (6%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERVD-----DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P+   +V++A+ ++        D+T+RC + + +  ++EV PVL++RV    + C
Sbjct  82   EFLKHPSGMEAVINAKALQSYHLVEDSDDTYRCTLPKVQLMSYEVYPVLILRVTPTQEDC  141

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-A  219
            ++ LLSCK+EGS ++ +Q+++F A+M N ++++    D  ++    D  + V +E+    
Sbjct  142  TVELLSCKVEGSELLESQSERFSANMTNCMTWNMEDPDPFLE---VDVRLNVTLEISTRP  198

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F  LPV A+E+ G  V+  ++  ++P  + QL+KDY  W
Sbjct  199  FTMLPVSAVEAPGNLVMQTLVDTLVPLMLQQLLKDYDEW  237



>ref|XP_009137990.1| PREDICTED: uncharacterized protein LOC103862030 [Brassica rapa]
Length=244

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 106/191 (55%), Gaps = 12/191 (6%)
 Frame = -1

Query  647  ISADAAPKVRFIARRKESVSV---RQLQRPLMEYMSLPASQYSVLDAERIERV-----DD  492
            I   ++ K    A RK+ +++   R+ +    E++  P+   +V++A+ ++       DD
Sbjct  47   IVISSSKKANLTASRKQRINLQSNREKELTFSEFLKHPSGMEAVINAKALQSYQLVDGDD  106

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NT+RC +   +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q++ F A M N
Sbjct  107  NTYRCTLPTIQLMSFEVSPVLVLRVIPTQEDCTVELLSCKLEGSELLENQSEMFSAIMTN  166

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRF  135
             ++++    +     L  D  ++V +E+    F  LPV A+E+ G  V+  ++  ++P  
Sbjct  167  CMTWNMEDPEPF---LEVDVSLKVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDTLVPLL  223

Query  134  MAQLVKDYQAW  102
            + QL+KDY  W
Sbjct  224  LQQLLKDYDEW  234



>ref|XP_009793530.1| PREDICTED: uncharacterized protein LOC104240387 isoform X1 [Nicotiana 
sylvestris]
Length=234

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 105/195 (54%), Gaps = 17/195 (9%)
 Frame = -1

Query  647  ISADAAPKVRFIARRKESVSVRQ--------LQRPLMEYMSLPASQYSVLDA---ERIER  501
            +S   A +    AR+KE + + +        +   + E++S  +   ++L+    +  E 
Sbjct  35   LSDSDAKRANLSARKKERIKLPKHDGIGGDNISFHISEFLSHKSGVEAMLNKRALQSFES  94

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D N +RC + + +   FEV PVL+++V    + C++ +LSCK EGS +V  QND F AS
Sbjct  95   IDSNMYRCTLPQVQLLNFEVAPVLILQVNPTSEDCTVEMLSCKFEGSDLVEQQNDHFSAS  154

Query  320  MVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIM  147
            MVNRI+++      G Q  L  D  + +++E+    F  LP  A+ES G  ++  ++  +
Sbjct  155  MVNRITWE----TVGSQPFLNVDVKLNISLEIYTMPFTMLPTSAVESPGNLMMQALVDRL  210

Query  146  LPRFMAQLVKDYQAW  102
            +P  + QL++DY  W
Sbjct  211  VPLLLQQLLQDYDNW  225



>ref|XP_006284411.1| hypothetical protein CARUB_v10005582mg [Capsella rubella]
 gb|EOA17309.1| hypothetical protein CARUB_v10005582mg [Capsella rubella]
Length=250

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 94/159 (59%), Gaps = 9/159 (6%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERVD-----DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P+   +V++A+ ++        DNT+RC + + +  +FEV PVL++RV    + C
Sbjct  82   EFLKHPSGMEAVINAKALQSYHLVEDSDNTYRCTLPKVQLMSFEVSPVLVLRVTPTQEDC  141

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-A  219
            ++ LLSCKLEGS ++ +Q+++F A+M N ++++    D     L  D  + V +E+    
Sbjct  142  TVELLSCKLEGSELLESQSERFSANMTNCMTWNMEDPDPF---LEVDVRLNVTLEISTRP  198

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F  LPV A+E+ G  V+  ++  ++P  + QL+KDY  W
Sbjct  199  FTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQLLKDYDDW  237



>gb|AIA25853.1| hypothetical protein, partial [Fargesia spathacea]
Length=235

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 87/161 (54%), Gaps = 13/161 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  PA   S+L+   ++       + NTFRC ++R  F  F+V PVL +RV      C
Sbjct  71   EFLRHPAGVESLLNTRALQSFAPVESEPNTFRCTLHRIGFLGFQVAPVLDLRVTPTCTDC  130

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---P  225
            ++ +LSC+ EGS  +  QN+ F A M N I++  N  +     L  D  +EV +EV   P
Sbjct  131  TVEMLSCRFEGSGSIEQQNELFSAFMRNHITWGDNGEEPC---LDIDVNLEVALEVYTKP  187

Query  224  FAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  188  FSL--LPLSAVEKPGNLLMQSLLDRLVPMLGDQLLRDYHSW  226



>ref|XP_002520346.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42132.1| conserved hypothetical protein [Ricinus communis]
Length=224

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 88/157 (56%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P    ++L+    E  E +D NT+RC++ + +   FE  PVL +RV    + C++
Sbjct  66   EFLSHPFGIQAMLNTKTLENFEPIDANTYRCFLPKVQLLNFEAAPVLDLRVTPTEEDCTV  125

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA-FR  213
             +LSCK +GS I+  QN+ F A M+NR+++  N     ++   +D  + V +E+  A F 
Sbjct  126  EMLSCKFQGSEIMERQNEYFSAFMMNRLTWSTNESKPFLE---ADMKLNVTLEIYTAPFT  182

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             LP  A+E  G  ++  ++  ++   + QL++DY  W
Sbjct  183  LLPASAVEGPGNLMMQALVDRLIKLLLKQLMQDYYEW  219



>ref|XP_004246068.1| PREDICTED: uncharacterized protein LOC101245279 isoform X2 [Solanum 
lycopersicum]
Length=235

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 82/140 (59%), Gaps = 6/140 (4%)
 Frame = -1

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            +  E +D NT+RC + + +   FEV PVL ++V    + C++ +LSCK EGS +V  QND
Sbjct  91   QSFESIDSNTYRCTLPQVQLLNFEVAPVLTLKVNPTSENCTVEMLSCKFEGSDLVEQQND  150

Query  335  KFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQ  162
             F ASMVNRI+++      G Q  L  D  + +++E+    F  LP  A+E+ G  ++  
Sbjct  151  HFSASMVNRITWE----TVGSQPFLDVDVKLNISLEIYTMPFTMLPTSAVETPGNLMMQA  206

Query  161  ILGIMLPRFMAQLVKDYQAW  102
            ++  ++P  + QL++DY  W
Sbjct  207  LVDRLVPLLLQQLLQDYDNW  226



>emb|CDY13410.1| BnaA03g51280D [Brassica napus]
Length=244

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 106/191 (55%), Gaps = 12/191 (6%)
 Frame = -1

Query  647  ISADAAPKVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAERIERV-----DD  492
            ++  ++ K    A RK+ + ++   + +    E++  P+   +V++A+ ++       DD
Sbjct  47   MAISSSKKANLTASRKQRIQLQSNGEKELTFSEFLKHPSGMEAVINAKALQSYQLVDDDD  106

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            NT+RC +   +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q++ F A M N
Sbjct  107  NTYRCTLPTIQLMSFEVSPVLVLRVIPTQEDCTVELLSCKLEGSELLENQSEMFSAIMTN  166

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRF  135
             ++++    +     L  D  ++V +E+    F  LPV A+E+ G  V+  ++  ++P  
Sbjct  167  CMTWNMEDPEPF---LEVDVSLKVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDTLVPLL  223

Query  134  MAQLVKDYQAW  102
            + QL+KDY  W
Sbjct  224  LQQLLKDYDEW  234



>ref|XP_007161671.1| hypothetical protein PHAVU_001G088800g [Phaseolus vulgaris]
 gb|ESW33665.1| hypothetical protein PHAVU_001G088800g [Phaseolus vulgaris]
Length=245

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   +VL+ + ++    +D NT+RC + + +F  FE  P+L +RV    + C +
Sbjct  80   EFLSHPSGIAAVLNTKALQSFQSLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSCK EGS +V  QN  F A MVN + + G   +S    L  D  + + +E+   PF 
Sbjct  140  EMLSCKFEGSEVVKEQNRHFSAFMVNHMKWGGAGAES---YLEVDVKLNLTLEIYTQPFT  196

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               +P  A+E  G  ++  ++  ++P  + Q+++DY  W
Sbjct  197  M--MPTSAVEGPGNIMMQALVDKLVPLLLQQMLQDYHEW  233



>gb|AIA25856.1| hypothetical protein, partial [Phyllostachys nidularia]
 gb|AIA25857.1| hypothetical protein, partial [Phyllostachys nidularia]
 gb|AIA25858.1| hypothetical protein, partial [Phyllostachys nidularia]
 gb|AIA25859.1| hypothetical protein, partial [Phyllostachys nidularia]
Length=233

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (55%), Gaps = 15/162 (9%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  PA   S+L+   ++       + N+FRC ++R  F  F+V PVL +RV      C
Sbjct  69   EFLRHPAGVXSLLNTRALQSFAPVESEPNSFRCTLHRIGFLGFQVAPVLDLRVTPTCTDC  128

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV---  228
            ++ +LSC+ EGS ++  QN+ F A M N I++     D G +  L  D  +EV +EV   
Sbjct  129  TVEMLSCRFEGSGLIEQQNELFSAFMRNHITWG----DIGEEPCLDIDVNLEVALEVYTK  184

Query  227  PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            PF+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  185  PFSL--LPLSAVEKPGNLLMQSLLDRLVPMLGKQLLRDYHSW  224



>ref|XP_001419223.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97516.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=195

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 94/185 (51%), Gaps = 18/185 (10%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVL--LVRVEEQPDGCSINLL  381
            MSLPASQYS LD E +ERV D+TF+  +    F    + P L   VRV +   GC + + 
Sbjct  1    MSLPASQYSTLDGESVERVSDDTFKVELSELAFLGLSLRPRLKAKVRVRDDGSGCEVRVE  60

Query  380  SCKLEGSPIVVAQNDKFDASMVNRISYDG--------------NRRDSGVQKLTSDAVIE  243
              +L GS +V   +D F+   VN +++                  R    ++LTS+  + 
Sbjct  61   DMELTGSGVVEYASDAFEIVSVNNVTWCDVESEALSAEERAVVESRGGEYKELTSETSVR  120

Query  242  VNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQPLGTG  63
            V I VP  F    +++ E TG  V+NQ++  ++PRF+ QL +DY  W+ GD SR     G
Sbjct  121  VYIIVPGWF-PFTIKSTERTGRFVVNQVVAQVVPRFLNQLAEDYGTWSRGDDSRTASAKG  179

Query  62   QI*DC  48
               DC
Sbjct  180  MF-DC  183



>emb|CDP09644.1| unnamed protein product [Coffea canephora]
Length=231

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 100/191 (52%), Gaps = 11/191 (6%)
 Frame = -1

Query  650  RISADAAPKVRFIARRKESVSVRQLQR----PLMEYMSLPASQYSVLDA---ERIERVDD  492
            ++S   A K    AR+KE + V    +     + E+++ P+   ++L+    +  + +D 
Sbjct  35   KLSESNARKANLSARKKERILVPSYSKIGAGHISEFLNHPSGVEAILNTRSLQSFQSLDS  94

Query  491  NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVN  312
            N +RC + + +   FEV PVL + V    + C + LLSCK EGS ++  QND+F ASM N
Sbjct  95   NLYRCILPQIQLLNFEVAPVLDLLVRSTEEDCMVELLSCKFEGSELLERQNDRFSASMRN  154

Query  311  RISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
             I+++     S    L  D  + +++E+  + F  LP   +E  G  ++  ++  ++P  
Sbjct  155  HITWETVDSKSF---LDVDVKLNISLEIYTYPFILLPESTVEGPGNLMMQALVDRLVPLH  211

Query  134  MAQLVKDYQAW  102
            + QL++DY  W
Sbjct  212  VQQLLQDYDKW  222



>ref|XP_003058632.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57087.1| predicted protein [Micromonas pusilla CCMP1545]
Length=299

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 95/190 (50%), Gaps = 28/190 (15%)
 Frame = -1

Query  617  FIARRKESVSVRQL--QRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFE  444
            F A++  SV + +    R L +YMSLPASQYS LD E++ER+ D+ F+C +    F  FE
Sbjct  117  FAAKKSGSVEIVEAPGARSLRQYMSLPASQYSTLDGEKVERIGDDVFKCTLGTLDFLGFE  176

Query  443  VCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY-DGNRRDSGVQK  267
            +    LVR                          +D F+   VNR+ + D     +G  +
Sbjct  177  ILGGGLVRT------------------------IDDMFEIDSVNRVGWSDRCNPGTGRCE  212

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDT  87
            + S+  + V + VP  F    V+A E TG  V+  ++  ++PRF++QL  DY+ WA GD 
Sbjct  213  IVSETAVSVYLLVPRWF-PFTVKATERTGNFVVGAVVNQVVPRFLSQLKTDYETWAGGDD  271

Query  86   SRQPLGTGQI  57
            SR  +  G +
Sbjct  272  SRAAVSDGGL  281



>ref|XP_004973914.1| PREDICTED: uncharacterized protein LOC101762357 [Setaria italica]
Length=273

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 13/161 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P    S+L+   +E          TF C + R  F  FE+ PVL +RV      C
Sbjct  109  EFLRHPDGVESLLNTGALESFAPAGSGPGTFTCALRRIGFLGFEIAPVLDLRVAPTSTDC  168

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---P  225
            +I +LSC+ EGS  +  QND F A M NRI++  N ++     L  D  +EV +EV   P
Sbjct  169  TIEMLSCRFEGSESIELQNDLFSAFMSNRITWSDNDKEP---CLDIDVNLEVTLEVYTKP  225

Query  224  FAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  226  FSM--LPLSAVEKPGNLLMQGLLDRLVPMLGEQLLRDYHSW  264



>gb|AIA25860.1| hypothetical protein, partial [Phyllostachys nigra var. henonis]
Length=233

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (55%), Gaps = 15/162 (9%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  PA   S+L+   ++       + N+FRC ++R  F  F+V PVL +RV      C
Sbjct  69   EFLRHPAGVASLLNTRALQSFAPVESEPNSFRCTLHRIGFLGFQVAPVLDLRVTPTCTDC  128

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV---  228
            ++ +LSC+ EGS ++  QN+ F A M N I++     D G +  L  D  +EV +EV   
Sbjct  129  TVEMLSCRFEGSGLIEQQNELFSAFMRNHITWG----DIGEEPCLDIDVNLEVALEVYTK  184

Query  227  PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            PF+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  185  PFSL--LPLSAVEKPGNLLMQSLLDRLVPMLGXQLLRDYHSW  224



>gb|AIA25861.1| hypothetical protein, partial [Phyllostachys edulis]
Length=233

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 89/162 (55%), Gaps = 15/162 (9%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  PA   S+L+   ++       + N+FRC ++R  F  F+V PVL +RV      C
Sbjct  69   EFLRHPAGVASLLNTRALQSFAPVESEPNSFRCTLHRIGFLGFQVAPVLDLRVTPTCTDC  128

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV---  228
            ++ +LSC+ EGS ++  QN+ F A M N I++     D G +  L  D  +EV +EV   
Sbjct  129  TVEMLSCRFEGSGLIEQQNELFSAFMRNHITWG----DIGEEPCLDIDVNLEVALEVYTK  184

Query  227  PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            PF+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  185  PFSL--LPLSAVEKPGNLLMQSLLDRLVPMLGEQLLRDYHSW  224



>ref|XP_010669557.1| PREDICTED: uncharacterized protein LOC104886760 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010669558.1| PREDICTED: uncharacterized protein LOC104886760 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=241

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 100/185 (54%), Gaps = 18/185 (10%)
 Frame = -1

Query  611  ARRKESVSVRQLQRP-------LMEYMSLPASQYSVLDAERIER---VDDNTFRCYVYRF  462
            AR+KE + +   +         + ++++ P    ++L+   +E    +D NT+RC +   
Sbjct  55   ARKKERIKLPSYENARVGETYHISQFLNHPTGVEAMLNVNVLENYVSIDVNTYRCKIPPI  114

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FEV PVL ++V    + C++ LLSCK EGS IV +QN  F A+M N I++D    +
Sbjct  115  QLLNFEVSPVLDLQVSPASECCTVELLSCKFEGSEIVESQNKYFSATMKNLITWDKTGSE  174

Query  281  SGVQKLTSDAVIEVNIEVPF---AFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDY  111
            S +     D  +++NI +      F+ LPV  +E+ G  VL  +L  ++P  + QL++DY
Sbjct  175  SFL-----DVDVKLNIALEIYNQPFKLLPVSTVEAPGNIVLQALLDRVVPLLLQQLLQDY  229

Query  110  QAWAT  96
             AW T
Sbjct  230  DAWVT  234



>ref|XP_010438082.1| PREDICTED: uncharacterized protein LOC104721726 [Camelina sativa]
Length=250

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 106/186 (57%), Gaps = 12/186 (6%)
 Frame = -1

Query  632  APKVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAERIERVD-----DNTFRC  477
            + K    A  K+ ++++   + +    E++  P+   +V++A+ ++        D+T+RC
Sbjct  55   SKKANLSASSKQRINLKINGEKELTFTEFLKHPSGMEAVINAKALQSYHLVEDSDDTYRC  114

Query  476  YVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
             + + +  ++EV PVL++RV    + C++ LLSCKLEGS ++ +Q+++F A+M N ++++
Sbjct  115  TLPKVQLMSYEVYPVLILRVTPTQEDCTVELLSCKLEGSELLESQSERFSANMTNCMTWN  174

Query  296  GNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRFMAQLV  120
                D  ++    D  + V +E+    F  LPV A+E+ G  V+  ++  ++P  + QL+
Sbjct  175  MEDPDPFLE---VDVRLNVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQLL  231

Query  119  KDYQAW  102
            KDY  W
Sbjct  232  KDYDEW  237



>gb|KDP32843.1| hypothetical protein JCGZ_12135 [Jatropha curcas]
Length=227

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 93/162 (57%), Gaps = 10/162 (6%)
 Frame = -1

Query  566  LMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            + E++S P+   ++L++   E  E ++ NT+RC + +F+    E  PV+ +RV      C
Sbjct  62   IAEFLSHPSGIEALLNSKSLESYEWIESNTYRCILPKFQLLNIEAAPVMDLRVIPTEQDC  121

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---P  225
            ++ ++SCK +GS ++ +QN+ F A M NR+++  N  DS    + +D  I+  +E+   P
Sbjct  122  TVEMVSCKFQGSVLMESQNEHFSAFMTNRVTW--NTTDSSEPFVEADVNIDFTVELYSAP  179

Query  224  FAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
            F +  LP+ A+E  G  ++  ++  ++   + Q+++DY  WA
Sbjct  180  FTY--LPISAVEGPGNLMMQALVDRLVNLLLQQIMQDYDKWA  219



>ref|XP_006412632.1| hypothetical protein EUTSA_v10026012mg [Eutrema salsugineum]
 gb|ESQ54085.1| hypothetical protein EUTSA_v10026012mg [Eutrema salsugineum]
Length=210

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 105/187 (56%), Gaps = 12/187 (6%)
 Frame = -1

Query  635  AAPKVRFIARRKESVSVRQ---LQRPLMEYMSLPASQYSVLDAERIERV-----DDNTFR  480
            ++ K    A RK+ + ++     +    +++  P+   +V++A+ ++       +DNT+R
Sbjct  5    SSKKANLSASRKQRIKLQNNGGKKLTFSDFLKHPSGMEAVINAKALQSYHVVDENDNTYR  64

Query  479  CYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY  300
            C + + +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q++ F A M N +++
Sbjct  65   CTLPKVQLMSFEVSPVLVLRVTPTQEDCTVELLSCKLEGSELLENQSENFSAIMTNCMTW  124

Query  299  DGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
            +    +  ++    D  ++V +E+    F  LPV A+E+ G  V+  ++  ++P  + QL
Sbjct  125  NMEDPEPFLE---VDVTLKVILEISTPPFTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQL  181

Query  122  VKDYQAW  102
            +KDY  W
Sbjct  182  LKDYDEW  188



>ref|XP_008812688.1| PREDICTED: uncharacterized protein LOC103723532 isoform X2 [Phoenix 
dactylifera]
Length=285

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 96/178 (54%), Gaps = 17/178 (10%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +     P+   ++++ P+   ++L+   +     +D NT+RC + + +F  F
Sbjct  112  ARRKERIELPHYGGPITFSDFVNHPSGVEALLNTRALHSFRPLDSNTYRCTLQKIQFLKF  171

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            EV PVL +RV    +GC++ ++ C+ EGS IV  QN  F A + N I+++   R+     
Sbjct  172  EVAPVLDLRVTPTREGCTVEMVDCRFEGSGIVEQQNHVFSAFVRNHITWE---RNGSEPC  228

Query  266  LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
            L  D  ++V++EV    F  LP+ A+E  G         +++P  + QL+ DY+ W +
Sbjct  229  LDVDVNLKVSLEVYTKPFNLLPLSAVEKPG--------NLLVPLLVEQLLDDYRTWVS  278



>ref|XP_001757381.1| predicted protein [Physcomitrella patens]
 gb|EDQ77866.1| predicted protein, partial [Physcomitrella patens]
Length=188

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRP------LMEYMSLPASQYSVLDAE---RIERVDDNTFRCY  474
            +     R++ESV +  L  P      L  ++  PA   S+L+ +   R E V ++ +RCY
Sbjct  5    RANLFVRKQESVPLVTLTDPSGVPHHLSSFLQQPAGTKSMLNTKALLRYEYVGNDVYRCY  64

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            + +     FEV P++ + V      C + +  C  +GS  V  QN +F AS+ N +++ G
Sbjct  65   LPKVVLLNFEVAPIVDLFVAASDKDCRVEMRQCMFQGSKAVEDQNKRFSASLKNHLTWHG  124

Query  293  NRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
                 G Q L  D  +EV++EV    F  LP+ A+E  G  ++  +L  ++P F+  L  
Sbjct  125  T--PEGDQVLNLDTELEVSLEVYTVPFTMLPLSAVEVPGKAIMQAMLDRLIPLFLDYLFV  182

Query  116  DYQAW  102
            DY+ W
Sbjct  183  DYKRW  187



>ref|XP_006412631.1| hypothetical protein EUTSA_v10026012mg [Eutrema salsugineum]
 gb|ESQ54084.1| hypothetical protein EUTSA_v10026012mg [Eutrema salsugineum]
Length=261

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 104/187 (56%), Gaps = 12/187 (6%)
 Frame = -1

Query  635  AAPKVRFIARRKESVSVRQ---LQRPLMEYMSLPASQYSVLDAERIERV-----DDNTFR  480
            ++ K    A RK+ + ++     +    +++  P+   +V++A+ ++       +DNT+R
Sbjct  56   SSKKANLSASRKQRIKLQNNGGKKLTFSDFLKHPSGMEAVINAKALQSYHVVDENDNTYR  115

Query  479  CYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISY  300
            C + + +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q++ F A M N +++
Sbjct  116  CTLPKVQLMSFEVSPVLVLRVTPTQEDCTVELLSCKLEGSELLENQSENFSAIMTNCMTW  175

Query  299  DGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
            +    +     L  D  ++V +E+    F  LPV A+E+ G  V+  ++  ++P  + QL
Sbjct  176  N---MEDPEPFLEVDVTLKVILEISTPPFTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQL  232

Query  122  VKDYQAW  102
            +KDY  W
Sbjct  233  LKDYDEW  239



>ref|XP_006659603.1| PREDICTED: uncharacterized protein LOC102719139 [Oryza brachyantha]
Length=271

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 85/160 (53%), Gaps = 11/160 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIERV-----DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  PA   S+L+   ++       + NTFRC +    F  F+V PVL +RV      C
Sbjct  92   EFLRQPAGVESLLNTRALQSFAAVEPEPNTFRCTLRTIGFLGFQVAPVLDLRVTPTCTDC  151

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PF  222
            ++ +LSC+ EGS  V  QN+ F A M N I++    +D G +  L  D  +EV +EV   
Sbjct  152  TVEMLSCRFEGSGSVEQQNELFSAFMSNHITW----KDDGEEPCLDIDVNLEVTLEVYTK  207

Query  221  AFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             F  LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  208  PFTMLPLSAVEKPGNLLMQGLLDRLVPLLGVQLLRDYHSW  247



>ref|XP_009628394.1| PREDICTED: uncharacterized protein LOC104118758 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628395.1| PREDICTED: uncharacterized protein LOC104118758 isoform X1 [Nicotiana 
tomentosiformis]
Length=234

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 101/194 (52%), Gaps = 9/194 (5%)
 Frame = -1

Query  668  SPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDA---ERIERV  498
            S   S R +  A  K R    + + +        + E++S  +   ++L+    +  E +
Sbjct  36   SDSDSKRANLSARKKERIKLPKHDGIGGDNKSFHISEFLSHKSGVEAMLNKRALQSFESI  95

Query  497  DDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASM  318
            D N +RC + + +   FEV PVL+++V    + C++ +LSCK EGS +V  QND F ASM
Sbjct  96   DSNMYRCTLPQVQLLNFEVAPVLILQVNPTSEDCTVKMLSCKFEGSDLVEQQNDHFSASM  155

Query  317  VNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIML  144
            VN I+++      G Q  L  D  + +++E+    F  LP  A+ES G  ++  ++  ++
Sbjct  156  VNCITWE----TVGSQPFLNVDVKLNISLEIYTMPFTMLPTSAVESPGNLMMQALVDRLV  211

Query  143  PRFMAQLVKDYQAW  102
            P  + QL++DY  W
Sbjct  212  PLLLQQLLQDYDNW  225



>tpg|DAA43708.1| TPA: hypothetical protein ZEAMMB73_804080 [Zea mays]
Length=174

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 56/75 (75%), Gaps = 5/75 (7%)
 Frame = -1

Query  554  MSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSC  375
            MSLP +Q  VLDAER   V+D+TFRCYVY   FFA EVCPVLL  ++E+PD   I LLSC
Sbjct  1    MSLPTTQDLVLDAER---VNDSTFRCYVYCLHFFALEVCPVLL--IDEEPDNRCIRLLSC  55

Query  374  KLEGSPIVVAQNDKF  330
            KLEGS ++ A N+KF
Sbjct  56   KLEGSLLMEAHNEKF  70



>ref|XP_002869344.1| hypothetical protein ARALYDRAFT_328609 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45603.1| hypothetical protein ARALYDRAFT_328609 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 109/202 (54%), Gaps = 17/202 (8%)
 Frame = -1

Query  665  PRGSLRIS-----ADAAPKVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAER  510
            PR ++ I        ++ K    A RK+ + ++     +    E++  P+   +V++A+ 
Sbjct  34   PRKTIHIGRRTMVISSSKKANLSASRKQRIKLQINGGKELTFSEFLKHPSGMEAVINAKA  93

Query  509  IERVD-----DNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVA  345
            ++        DNT+RC + + +  +FEV PVL++RV    +  ++ LLSCKLEGS ++  
Sbjct  94   LQSYHLVEDTDNTYRCTLPKVQLMSFEVSPVLVLRVTPTQEDFTVELLSCKLEGSKMLEN  153

Query  344  QNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVL  168
            Q+++F A M N ++++    +  ++   +D  + V +E+    F  LPV A+E+ G  V+
Sbjct  154  QSERFSAIMTNCMTWNMEHPEPFLE---ADVRLNVTLEISTRPFTMLPVSAVEAPGNLVM  210

Query  167  NQILGIMLPRFMAQLVKDYQAW  102
              ++  ++P  + QL+KDY  W
Sbjct  211  QTLIDTLVPLLLQQLLKDYDEW  232



>ref|XP_003545525.2| PREDICTED: uncharacterized protein LOC100793446 isoform X1 [Glycine 
max]
Length=244

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   +VL+    +  + +D NT+RC + + +F  FE  P+L +RV    + C +
Sbjct  80   EFLSQPSGIAAVLNTKAFQSFQSLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSCK EGS +V  QN+ F A M N +++ G   +S ++    D  + + +E+   PF 
Sbjct  140  EMLSCKFEGSEVVKEQNNHFSAFMRNHMTWGGAGAESFLE---VDVNLNLTLEIYTQPFT  196

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               +P  A+E  G  ++  ++  ++P  + Q ++DY  W
Sbjct  197  M--MPTSAVEGPGNIMMQALVDKLVPLLLQQTLQDYDEW  233



>ref|NP_849478.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL84947.1| AT4g31110/F6E21_30 [Arabidopsis thaliana]
 gb|AAM51595.1| AT4g31110/F6E21_30 [Arabidopsis thaliana]
 gb|AEE85858.1| uncharacterized protein AT4G31115 [Arabidopsis thaliana]
Length=250

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 104/184 (57%), Gaps = 12/184 (7%)
 Frame = -1

Query  626  KVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAERIER---VDD--NTFRCYV  471
            K    A RK+ + +    + +    E++  P+   +V++A+ ++    VDD  +T+RC +
Sbjct  57   KANISASRKQRIKLEINGEKELTFSEFLKHPSGMEAVINAKALQSYHLVDDSDDTYRCTL  116

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             + +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q+++F A M N ++++  
Sbjct  117  PKVQLMSFEVYPVLVLRVTPTQEDCTVELLSCKLEGSELLENQSERFSAIMTNCMTWNME  176

Query  290  RRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
              +  ++    D  + V +E+    F  LPV A+E+ G  V+  ++  ++P  + QL+KD
Sbjct  177  HPEPFLE---VDVRLNVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQLLKD  233

Query  113  YQAW  102
            Y  W
Sbjct  234  YDEW  237



>gb|KHN15997.1| hypothetical protein glysoja_043168, partial [Glycine soja]
Length=271

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   +VL+    +  + +D NT+RC + + +F  FE  P+L +RV    + C +
Sbjct  107  EFLSQPSGIAAVLNTKAFQSFQSLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLV  166

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSCK EGS +V  QN+ F A M N +++ G   +S ++    D  + + +E+   PF 
Sbjct  167  EMLSCKFEGSEVVKEQNNHFSAFMRNHMTWGGAGAESFLE---VDVNLNLTLEIYTQPFT  223

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               +P  A+E  G  ++  ++  ++P  + Q ++DY  W
Sbjct  224  M--MPTSAVEGPGNIMMQALVDKLVPLLLQQTLQDYDEW  260



>gb|KEH39792.1| DUF1997 family protein [Medicago truncatula]
Length=229

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 101/201 (50%), Gaps = 19/201 (9%)
 Frame = -1

Query  644  SADA-APKVRFIARRKESVSVRQL---------QRPLMEYMSLPASQYSVLDA---ERIE  504
            S+D+ A K    A +KE V +            +  + E++S P+   +VL+    +  +
Sbjct  10   SSDSNAKKANLFAAKKERVKLPTYDDDDVLGGKEYHISEFLSQPSGIAAVLNTKVLQSFQ  69

Query  503  RVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDA  324
             +D NT+RC + + K   FEV P + +RV    + C + ++SCK EGS IV   ND F A
Sbjct  70   SLDANTYRCELPKLKLLKFEVSPFIDLRVTSTDEDCLVEMISCKFEGSEIVEELNDHFSA  129

Query  323  SMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGI  150
             MVN +++     D+ ++  L  D  + + +E+    F  +P+ A+E  G  ++  ++  
Sbjct  130  FMVNHMTW----SDADIESFLEVDVKLNLTLEIYTRPFTVMPISAVEGPGNIMMQALVDK  185

Query  149  MLPRFMAQLVKDYQAWATGDT  87
            ++P  + Q+V+ Y  W    T
Sbjct  186  LVPLLLQQMVQGYDEWVQKQT  206



>ref|XP_010049780.1| PREDICTED: uncharacterized protein LOC104438357 isoform X2 [Eucalyptus 
grandis]
Length=232

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 103/191 (54%), Gaps = 12/191 (6%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  39   VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  98

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  99   YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  158

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G  V+  ++  ++P  
Sbjct  159  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPGNAVMQALVDRLVPLL  213

Query  134  MAQLVKDYQAW  102
            + QL++DY+ W
Sbjct  214  LGQLLQDYEQW  224



>ref|XP_009417802.1| PREDICTED: uncharacterized protein LOC103998132, partial [Musa 
acuminata subsp. malaccensis]
Length=203

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 88/169 (52%), Gaps = 17/169 (10%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQR------PLMEYMSLPASQYSVLDA---ERIERVDDNTFRCY  474
            K    A+RKE V + +         P+ E++S P    ++L+    +R E +D NT+RC 
Sbjct  39   KANLWAKRKEMVKLPEYSDGSGRVFPVSEFLSHPTGVEALLNTRALQRFEPLDSNTYRCT  98

Query  473  VYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDG  294
            +++ +F  FEV PVL +RV    + C++ +LSC+ EGS  V  QN  F A M N I ++ 
Sbjct  99   LHKIQFLKFEVAPVLDLRVTRTDEDCTVEMLSCRFEGSKAVEKQNQLFSAFMKNYIKWEA  158

Query  293  NRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQIL  156
               +     L  D  + V +EV   PF+   LP+ A+E  G  ++  +L
Sbjct  159  KNSEPC---LIVDVNLRVTLEVYTKPFSL--LPLSAVEKPGNLLMQGLL  202



>ref|NP_001119084.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85859.1| uncharacterized protein AT4G31115 [Arabidopsis thaliana]
Length=274

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 104/184 (57%), Gaps = 12/184 (7%)
 Frame = -1

Query  626  KVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAERIER---VDD--NTFRCYV  471
            K    A RK+ + +    + +    E++  P+   +V++A+ ++    VDD  +T+RC +
Sbjct  81   KANISASRKQRIKLEINGEKELTFSEFLKHPSGMEAVINAKALQSYHLVDDSDDTYRCTL  140

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             + +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q+++F A M N ++++  
Sbjct  141  PKVQLMSFEVYPVLVLRVTPTQEDCTVELLSCKLEGSELLENQSERFSAIMTNCMTWNME  200

Query  290  RRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
              +  ++    D  + V +E+    F  LPV A+E+ G  V+  ++  ++P  + QL+KD
Sbjct  201  HPEPFLE---VDVRLNVTLEISTRPFTMLPVSAVEAPGNLVMQTLVDTLVPLLLQQLLKD  257

Query  113  YQAW  102
            Y  W
Sbjct  258  YDEW  261



>ref|XP_010049779.1| PREDICTED: uncharacterized protein LOC104438357 isoform X1 [Eucalyptus 
grandis]
Length=242

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 103/191 (54%), Gaps = 12/191 (6%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  49   VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  108

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  109  YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  168

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRF  135
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G  V+  ++  ++P  
Sbjct  169  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPGNAVMQALVDRLVPLL  223

Query  134  MAQLVKDYQAW  102
            + QL++DY+ W
Sbjct  224  LGQLLQDYEQW  234



>ref|XP_010432904.1| PREDICTED: uncharacterized protein LOC104717080 [Camelina sativa]
Length=250

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 94/159 (59%), Gaps = 9/159 (6%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAE-----RIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P+   +V++A+     R+    D+T+RC + + +  +FEV PVL++RV    + C
Sbjct  82   EFLKHPSGMEAVINAKALQSYRLVEDSDDTYRCTLPKVQLMSFEVYPVLVLRVTPTQEDC  141

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPF-A  219
            ++ LLSCKLEGS ++ +Q+++F A+M N ++++    D     L  D  + V +E+    
Sbjct  142  TVELLSCKLEGSELLESQSERFSANMTNCMTWNMEDPDPF---LEVDVRLNVTLEISTRP  198

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F  LPV A+E+ G  V+  ++  ++P  + QL++DY  W
Sbjct  199  FTMLPVSAVEAPGNLVIQTLVDTLVPLLLQQLLQDYVEW  237



>emb|CBJ28056.1| conserved unknown protein [Ectocarpus siliculosus]
Length=329

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 99/191 (52%), Gaps = 6/191 (3%)
 Frame = -1

Query  638  DAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFK  459
            D   +V + A ++ +V V +  R L +Y++LP ++YS+LD + I R+ + TFR       
Sbjct  124  DNGDRVVWSASKRSNVEVGEGTRKLKDYLALPPTEYSLLDPKMITRLSEETFRMDGATMS  183

Query  458  FFAFEVCPVLLVRVEEQPDGCSINLL--SCKLEGSPIVVAQNDKFDASMVNRIS---YDG  294
                ++ PVL VRVE QP+    N++    +L+GS  V +    F+ S    +S    +G
Sbjct  184  IVGTKIKPVLFVRVEVQPENSMANIMVERVELDGSEAVRSAGGSFNVSSSTVVSCAKKEG  243

Query  293  NRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
               D+ + +L + + I + + VP     +PV  +   G  V+ +++ I LP+F   L +D
Sbjct  244  TPADANIMELRASSNIAIELLVPNE-NFVPVGVLRRAGNFVMQRVVDIGLPQFTYFLRRD  302

Query  113  YQAWATGDTSR  81
            Y  WA GD  R
Sbjct  303  YARWAEGDDDR  313



>ref|XP_006483665.1| PREDICTED: uncharacterized protein LOC102630564 isoform X2 [Citrus 
sinensis]
Length=231

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 86/156 (55%), Gaps = 15/156 (10%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+   ++    +D NT+RC + + +F  FE  PV+ +RV      C++
Sbjct  80   EFLSHPSGIQAMLNTSALQSFQFLDTNTYRCVLPKVQFLNFEAAPVMDLRVTPTDKDCTV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             LLSCK EGS IV +QND+F A M+N ++++ N  +S ++       +EV +++      
Sbjct  140  QLLSCKFEGSDIVESQNDRFSAFMINHMTWNTNDSESFLE-------VEVKLKLCLEIYT  192

Query  218  --FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVK  117
              F  LP+ A+E  G  +L     I L RF+   +K
Sbjct  193  RPFSLLPISAVERPGNLILLPTKVICLGRFLVSYIK  228



>ref|NP_001062277.1| Os08g0521800 [Oryza sativa Japonica Group]
 dbj|BAC55628.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD10453.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24191.1| Os08g0521800 [Oryza sativa Japonica Group]
 gb|EAZ07674.1| hypothetical protein OsI_29931 [Oryza sativa Indica Group]
 gb|EAZ43373.1| hypothetical protein OsJ_27977 [Oryza sativa Japonica Group]
 dbj|BAG96968.1| unnamed protein product [Oryza sativa Japonica Group]
Length=260

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 89/163 (55%), Gaps = 17/163 (10%)
 Frame = -1

Query  557  YMSLPASQYSVLDAERIER---VDD----NTFRCYVYRFKFFAFEVCPVLLVRVEEQPDG  399
            ++  PA   S+L+   ++    VD+    NTFRC +    F  F+V PVL +RV      
Sbjct  83   FLRQPAGVESLLNTRALQSFAAVDEAPGANTFRCTLQSIGFLGFQVAPVLDLRVAPTCHD  142

Query  398  CSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV--  228
            C++ +LSC+ EGS  V  QN+ F A M N I++    +D G +  L  D  +EV +EV  
Sbjct  143  CTVEMLSCRFEGSGSVEQQNELFSAFMSNHITW----KDDGEEPCLDIDVNLEVTLEVYT  198

Query  227  -PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             PF+   LP+ A+E+ G  ++  +L  ++P    QL++DY +W
Sbjct  199  KPFSM--LPLSAVETPGNLLMQGLLDRLVPLLGEQLLRDYHSW  239



>gb|KEH39793.1| DUF1997 family protein [Medicago truncatula]
Length=261

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 101/201 (50%), Gaps = 19/201 (9%)
 Frame = -1

Query  644  SADA-APKVRFIARRKESVSVRQL---------QRPLMEYMSLPASQYSVLDA---ERIE  504
            S+D+ A K    A +KE V +            +  + E++S P+   +VL+    +  +
Sbjct  42   SSDSNAKKANLFAAKKERVKLPTYDDDDVLGGKEYHISEFLSQPSGIAAVLNTKVLQSFQ  101

Query  503  RVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDA  324
             +D NT+RC + + K   FEV P + +RV    + C + ++SCK EGS IV   ND F A
Sbjct  102  SLDANTYRCELPKLKLLKFEVSPFIDLRVTSTDEDCLVEMISCKFEGSEIVEELNDHFSA  161

Query  323  SMVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGI  150
             MVN +++     D+ ++  L  D  + + +E+    F  +P+ A+E  G  ++  ++  
Sbjct  162  FMVNHMTW----SDADIESFLEVDVKLNLTLEIYTRPFTVMPISAVEGPGNIMMQALVDK  217

Query  149  MLPRFMAQLVKDYQAWATGDT  87
            ++P  + Q+V+ Y  W    T
Sbjct  218  LVPLLLQQMVQGYDEWVQKQT  238



>ref|XP_004498601.1| PREDICTED: uncharacterized protein LOC101493099 isoform X2 [Cicer 
arietinum]
Length=217

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 102/197 (52%), Gaps = 18/197 (9%)
 Frame = -1

Query  644  SADA-APKVRFIARRKESVSVRQLQRPLM--------EYMSLPASQYSVLDAERIER---  501
            S+D+ A K    A +KE + +      ++        E++S P+   +VL+ + ++    
Sbjct  10   SSDSNAKKANMFATKKERIKLPTYDDDVLGGKKCHISEFLSQPSGIAAVLNTKALQSFQS  69

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D NT+RC + + +  +FE  P + +RV    + C + ++SCK EGS +V  QN+ F A 
Sbjct  70   LDANTYRCELPKLRLLSFEASPFIDLRVTSTDEDCLVEMISCKFEGSELVEEQNNHFSAF  129

Query  320  MVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILG  153
            M+N +++     D   +  L  D  + + +E+   PF    +P+ A+E  G  ++  ++ 
Sbjct  130  MINHMTWGDGDGDGDAESFLEVDVKLNLTLEIYTPPFTM--MPISAVERPGNIMMQALVD  187

Query  152  IMLPRFMAQLVKDYQAW  102
             ++P  + Q++KDY  W
Sbjct  188  KLVPLLLQQMLKDYDEW  204



>ref|XP_002445875.1| hypothetical protein SORBIDRAFT_07g027290 [Sorghum bicolor]
 gb|EES15370.1| hypothetical protein SORBIDRAFT_07g027290 [Sorghum bicolor]
Length=264

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 82/161 (51%), Gaps = 13/161 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER-----VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            E++  P +  S+L+   +E          TF C + R     FEV PVL +RV      C
Sbjct  98   EFLRHPDAVESLLNTGALESFAPAGTGPGTFTCGLRRIGLLGFEVAPVLDLRVAPTSTDC  157

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---P  225
            +I +LSC+ EGS  +  QN+ F A M N I++     D+    L  D  +EV +EV   P
Sbjct  158  TIEMLSCRFEGSEALEQQNELFSAFMSNHITWS---EDAEEPCLDIDVTLEVTLEVYTKP  214

Query  224  FAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            F+   LP+ A+E  G  ++  +L  ++P    QL++DY +W
Sbjct  215  FSM--LPLSAVEKPGNLLMQGLLDRLVPMLGEQLLRDYHSW  253



>ref|XP_004498600.1| PREDICTED: uncharacterized protein LOC101493099 isoform X1 [Cicer 
arietinum]
Length=255

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 102/197 (52%), Gaps = 18/197 (9%)
 Frame = -1

Query  644  SADA-APKVRFIARRKESVSVRQLQRPLM--------EYMSLPASQYSVLDAERIER---  501
            S+D+ A K    A +KE + +      ++        E++S P+   +VL+ + ++    
Sbjct  48   SSDSNAKKANMFATKKERIKLPTYDDDVLGGKKCHISEFLSQPSGIAAVLNTKALQSFQS  107

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D NT+RC + + +  +FE  P + +RV    + C + ++SCK EGS +V  QN+ F A 
Sbjct  108  LDANTYRCELPKLRLLSFEASPFIDLRVTSTDEDCLVEMISCKFEGSELVEEQNNHFSAF  167

Query  320  MVNRISYDGNRRDSGVQK-LTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILG  153
            M+N +++     D   +  L  D  + + +E+   PF    +P+ A+E  G  ++  ++ 
Sbjct  168  MINHMTWGDGDGDGDAESFLEVDVKLNLTLEIYTPPFTM--MPISAVERPGNIMMQALVD  225

Query  152  IMLPRFMAQLVKDYQAW  102
             ++P  + Q++KDY  W
Sbjct  226  KLVPLLLQQMLKDYDEW  242



>ref|XP_008663733.1| PREDICTED: uncharacterized protein LOC103642199 isoform X1 [Zea 
mays]
 tpg|DAA48050.1| TPA: hypothetical protein ZEAMMB73_345767 [Zea mays]
Length=311

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 83/160 (52%), Gaps = 11/160 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++  P +  S+L+   +E        TF C + R     FEV PVL +RV      C+I
Sbjct  148  EFLRHPDAVESILNTGALESFAPAGPGTFTCALRRVGLLGFEVAPVLDLRVAPTSTDCTI  207

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSC+ EGS ++  QN+ F A M N I++  +  +     L     +EV +EV   PF+
Sbjct  208  EMLSCRFEGSEVLEQQNELFSAFMSNHITWSDDAEEPC---LDIHVKLEVTLEVYTKPFS  264

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
               LP+ A+E  G  ++  +L  ++P    QL++DY +WA
Sbjct  265  M--LPLSAVEKPGNLLMQGLLDRLVPVLGEQLLRDYHSWA  302



>ref|XP_006483664.1| PREDICTED: uncharacterized protein LOC102630564 isoform X1 [Citrus 
sinensis]
Length=242

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 92/161 (57%), Gaps = 15/161 (9%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+   ++    +D NT+RC + + +F  FE  PV+ +RV      C++
Sbjct  80   EFLSHPSGIQAMLNTSALQSFQFLDTNTYRCVLPKVQFLNFEAAPVMDLRVTPTDKDCTV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             LLSCK EGS IV +QND+F A M+N ++++ N  +S ++       +EV +++      
Sbjct  140  QLLSCKFEGSDIVESQNDRFSAFMINHMTWNTNDSESFLE-------VEVKLKLCLEIYT  192

Query  218  --FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
              F  LP+ A+E  G  ++  ++  ++P  + QL++DY  W
Sbjct  193  RPFSLLPISAVERPGNLMMQALVDRLVPLLLRQLLQDYNKW  233



>ref|XP_006450060.1| hypothetical protein CICLE_v10009318mg [Citrus clementina]
 gb|ESR63300.1| hypothetical protein CICLE_v10009318mg [Citrus clementina]
 gb|KDO67118.1| hypothetical protein CISIN_1g026171mg [Citrus sinensis]
Length=242

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 92/161 (57%), Gaps = 15/161 (9%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+   ++    +D NT+RC + + +F  FE  PV+ +RV      C++
Sbjct  80   EFLSHPSGIQAMLNTSALQSFQFLDTNTYRCVLPKVQFLNFEAAPVMDLRVTPTDKDCTV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             LLSCK EGS IV +QND+F A M+N ++++ N  +S ++       +EV +++      
Sbjct  140  QLLSCKFEGSDIVESQNDRFSAFMINHMTWNTNDSESFLE-------VEVKLKLCLEIYT  192

Query  218  --FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
              F  LP+ A+E  G  ++  ++  ++P  + QL++DY  W
Sbjct  193  RPFSLLPISAVERPGNLMMQALVDRLVPLLLRQLLQDYDKW  233



>ref|XP_010648479.1| PREDICTED: uncharacterized protein LOC100250928 [Vitis vinifera]
 ref|XP_010648480.1| PREDICTED: uncharacterized protein LOC100250928 [Vitis vinifera]
 emb|CBI20827.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 90/163 (55%), Gaps = 19/163 (12%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERI---ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+A+ +   + +  + +RC + R +   FEV PV+ +RV    + C++
Sbjct  70   EFLSDPSGVEAILNAKALKSFQSLGSDLYRCTLPRIQLLNFEVVPVVDLRVTSTSEVCTV  129

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             +LSC  EGS I+  QN  F ASM N+I++D N          S+  +++++E+  A   
Sbjct  130  EMLSCTFEGSEIMERQNKHFSASMRNQITWDTN---------NSEPFLDIDVELNLALEI  180

Query  218  ----FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
                F  LP+ A+E  G  V+  +L  ++P  + QL++DY  W
Sbjct  181  YTKPFTLLPISAVEGPGNLVMQALLDRLVPLLLQQLIRDYDNW  223



>gb|KCW82580.1| hypothetical protein EUGRSUZ_C03977 [Eucalyptus grandis]
Length=165

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  4    VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  63

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  64   YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  123

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTG  180
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G
Sbjct  124  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPG  163



>ref|XP_006450056.1| hypothetical protein CICLE_v10009318mg [Citrus clementina]
 gb|ESR63296.1| hypothetical protein CICLE_v10009318mg [Citrus clementina]
 gb|KDO67119.1| hypothetical protein CISIN_1g026171mg [Citrus sinensis]
Length=235

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 79/139 (57%), Gaps = 15/139 (11%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+   ++    +D NT+RC + + +F  FE  PV+ +RV      C++
Sbjct  80   EFLSHPSGIQAMLNTSALQSFQFLDTNTYRCVLPKVQFLNFEAAPVMDLRVTPTDKDCTV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             LLSCK EGS IV +QND+F A M+N ++++ N  +S ++       +EV +++      
Sbjct  140  QLLSCKFEGSDIVESQNDRFSAFMINHMTWNTNDSESFLE-------VEVKLKLCLEIYT  192

Query  218  --FRALPVQAIESTGAQVL  168
              F  LP+ A+E  G  +L
Sbjct  193  RPFSLLPISAVERPGNLIL  211



>gb|KCW82577.1| hypothetical protein EUGRSUZ_C03977 [Eucalyptus grandis]
Length=200

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  39   VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  98

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  99   YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  158

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTG  180
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G
Sbjct  159  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPG  198



>gb|KCW82578.1| hypothetical protein EUGRSUZ_C03977 [Eucalyptus grandis]
Length=210

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  49   VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  108

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  109  YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  168

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTG  180
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G
Sbjct  169  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPG  208



>gb|KCW82579.1| hypothetical protein EUGRSUZ_C03977 [Eucalyptus grandis]
Length=188

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 87/165 (53%), Gaps = 12/165 (7%)
 Frame = -1

Query  653  LRISADAAPKVRFIARRKESVSVRQL-QRPLMEYMSLPASQYSVLDAERIER---VDDNT  486
            + +S  AA      A RK+ + +    Q P+ +++S P+   ++L+   ++    +  NT
Sbjct  27   VEMSESAAKTANLSASRKQVIQLPNYEQYPISQFLSHPSGIQAILNTRALQSFQFLGANT  86

Query  485  FRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRI  306
            +RC + + +F  FE  PV+ +R+      C + +LSCK +GS IV  QN+ F A M N +
Sbjct  87   YRCTLPKIQFLNFEATPVMDLRMTLTDTDCKVEMLSCKFKGSKIVERQNNHFSAFMTNHM  146

Query  305  SYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTG  180
             +D N  DSG   +  D  + V +E+   PFA   LP+ A+E  G
Sbjct  147  RWDTN--DSG-NTVEVDVKLGVTLEIFTQPFAL--LPLSAVEVPG  186



>ref|XP_011075031.1| PREDICTED: uncharacterized protein LOC105159582 isoform X1 [Sesamum 
indicum]
 ref|XP_011075107.1| PREDICTED: uncharacterized protein LOC105159582 isoform X1 [Sesamum 
indicum]
 ref|XP_011075192.1| PREDICTED: uncharacterized protein LOC105159582 isoform X1 [Sesamum 
indicum]
 ref|XP_011075265.1| PREDICTED: uncharacterized protein LOC105159582 isoform X1 [Sesamum 
indicum]
Length=234

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 87/172 (51%), Gaps = 23/172 (13%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E+ S P+   ++L+   ++    +D N +RC + + +   FEV PVL ++V    + C +
Sbjct  72   EFFSHPSGVEAILNTRALQSYQSLDSNLYRCILPQVRLLNFEVAPVLDLQVTPTSEDCIV  131

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV------  228
             +LSCK EGS +V  QN+ F ASM N I ++          + S   ++V++++      
Sbjct  132  EMLSCKFEGSDLVERQNEHFSASMRNHIRWE---------TIDSQPFLDVDVKLNLVLEI  182

Query  227  ---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSR  81
               PFA   LP  A+E  G  ++  ++  ++P    QL++DY+ W      R
Sbjct  183  YTQPFAL--LPTSAVEVPGNIMMQALVDQLVPLLGQQLLQDYEEWVHQQRKR  232



>gb|EMT31097.1| hypothetical protein F775_01407 [Aegilops tauschii]
Length=130

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 72/125 (58%), Gaps = 11/125 (9%)
 Frame = -1

Query  458  FFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDS  279
            F  F+V PVL +RV    D C++ +LSC+ EGS  +  QN+ F A M NRI++     D+
Sbjct  3    FLGFQVAPVLDLRVTPTRDDCTVEMLSCRFEGSDSIEQQNELFSAVMRNRITWG----DN  58

Query  278  GVQK--LTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKD  114
            G Q+  L  D  +EV +EV   PF+   LP+ A+E  G  ++  +L  ++P    QL++D
Sbjct  59   GDQEPCLDIDVNLEVTLEVYTKPFSL--LPLSAVEKPGNLLMQGLLDRLVPMLGEQLLRD  116

Query  113  YQAWA  99
            Y +W 
Sbjct  117  YHSWV  121



>ref|XP_006483666.1| PREDICTED: uncharacterized protein LOC102630564 isoform X3 [Citrus 
sinensis]
Length=219

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 77/135 (57%), Gaps = 15/135 (11%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   ++L+   ++    +D NT+RC + + +F  FE  PV+ +RV      C++
Sbjct  80   EFLSHPSGIQAMLNTSALQSFQFLDTNTYRCVLPKVQFLNFEAAPVMDLRVTPTDKDCTV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFA---  219
             LLSCK EGS IV +QND+F A M+N ++++ N  +S ++       +EV +++      
Sbjct  140  QLLSCKFEGSDIVESQNDRFSAFMINHMTWNTNDSESFLE-------VEVKLKLCLEIYT  192

Query  218  --FRALPVQAIESTG  180
              F  LP+ A+E  G
Sbjct  193  RPFSLLPISAVERPG  207



>dbj|BAJ86184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=234

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 13/141 (9%)
 Frame = -1

Query  575  QRPLMEYMSLPASQYSVLDAER------IERVDDNTFRCYVYRFKFFAFEVCPVLLVRVE  414
            Q  + E++  PA   S+L+         +E   D TFRC ++   F  F+V PVL +RV 
Sbjct  96   QGGIGEFLRHPAGVESLLNTRALQSFAPVESESDGTFRCTLHPMGFLGFQVAPVLDLRVT  155

Query  413  EQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNI  234
               D C++ +LSC+ EGS  +  QN+ F A M NRI++  N  +     L  D  +EV +
Sbjct  156  PTRDDCTVEMLSCRFEGSDSIEQQNELFSAVMTNRITWGDNGDEEPC--LDIDVNLEVTL  213

Query  233  EV---PFAFRALPVQAIESTG  180
            EV   PF+   LP+ A+E  G
Sbjct  214  EVYTKPFSL--LPLSAVEKPG  232



>ref|XP_008445108.1| PREDICTED: uncharacterized protein LOC103488246 [Cucumis melo]
Length=241

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 88/157 (56%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E+++ P+   ++L+   ++    +D NT+RC + + +   FE  P L +R+    +  ++
Sbjct  75   EFLNHPSGIEAMLNKNALKSFQLLDANTYRCTLPKLQLLNFEAAPTLDLRLIPTDEDFTV  134

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFR  213
             +LSCK EGS +V  QND F A M+N +++D    +S    L  D  + +++E+    F 
Sbjct  135  EMLSCKFEGSELVERQNDHFSAMMINHLTWDTIDSNS---YLEVDVKLNLSLEIYTLPFT  191

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             +P  A+E+ G  +L  +L  ++P  + QLV+DY+ W
Sbjct  192  LMPTAAVENPGNLMLQALLDNLVPLLLRQLVQDYEKW  228



>ref|XP_002306644.2| hypothetical protein POPTR_0005s20200g [Populus trichocarpa]
 gb|EEE93640.2| hypothetical protein POPTR_0005s20200g [Populus trichocarpa]
Length=312

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 97/188 (52%), Gaps = 21/188 (11%)
 Frame = -1

Query  626  KVRFIARRKE--SVSVRQLQRPLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRF  462
            K    A RKE  ++ +      + E++S P    ++L+    +  + +D NT+RC + + 
Sbjct  126  KANLTAARKERMNLPITDGGYRISEFLSHPFGIQAILNTGSLQSFQSLDANTYRCILPKV  185

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FE  PVL +RV    + C++ ++SCK +GS +V  QND+F A MVN ++++ N   
Sbjct  186  ELLNFEAAPVLDLRVSPSDEHCTVEMISCKFQGSELVERQNDRFSAFMVNSMTWNTN---  242

Query  281  SGVQKLTSDAVIEVNIEVPF-------AFRALPVQAIESTGAQVLNQILGIMLPRFMAQL  123
                   S+  +EV++++          F  LP  A+ES G  V+  +L  ++P  + QL
Sbjct  243  ------ISEPFLEVDVKLNLMLEIYTQPFTLLPTSAVESAGNLVMQALLDRLVPLLLEQL  296

Query  122  VKDYQAWA  99
            + DY  W 
Sbjct  297  LLDYNKWT  304



>ref|XP_008219816.1| PREDICTED: uncharacterized protein LOC103319995 [Prunus mume]
 ref|XP_008219817.1| PREDICTED: uncharacterized protein LOC103319995 [Prunus mume]
Length=241

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 76/136 (56%), Gaps = 4/136 (3%)
 Frame = -1

Query  506  ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
            E +D +T+RC + + +   FE  PVL +RV    + C + +LSC+ EGS  V  QN  F 
Sbjct  101  ESLDTDTYRCTLPKLQLLNFEAAPVLDLRVTPTNEDCIVEMLSCRFEGSEAVERQNSHFS  160

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGI  150
            A M N +S+D N  +S ++    D  +++ +E+    F  +PV A+E  G  ++  ++  
Sbjct  161  AFMRNHMSWDTNGSESFLE---VDVKLKLTLEIYTHPFTMMPVSAVERPGNLMMQALVDR  217

Query  149  MLPRFMAQLVKDYQAW  102
            ++P  + QL++DY  W
Sbjct  218  LVPLLLQQLLQDYSKW  233



>ref|WP_006632188.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK89502.1| Protein of unknown function DUF1997 [Microcoleus vaginatus FGP-2]
Length=192

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 97/187 (52%), Gaps = 10/187 (5%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
            +RF A +   +SV + + P+  Y+  P    + L D  R E++ D+ FR  +   +F   
Sbjct  3    IRFNASQSVEISVPEERVPIQHYLRQPRRLVNALVDQSRTEQLSDDCFRLKMRPLQFMML  62

Query  446  EVCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGV  273
             + P + +RV  Q DG +INL  ++C++ G   +   ND+F  ++  ++      + SGV
Sbjct  63   SLQPTVDMRVWAQSDG-TINLESVACEIRGVGYI---NDRFALNLKGQLCV---HQSSGV  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATG  93
              L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M QL+ DY+ WA+ 
Sbjct  116  AYLKGKADLEVQVELPPPFWLTPKPILEATGNALLKSVLMSVKQRLMHQLLSDYRRWASS  175

Query  92   DTSRQPL  72
            ++  + L
Sbjct  176  ESELKSL  182



>ref|XP_008365168.1| PREDICTED: uncharacterized protein LOC103428830 isoform X1 [Malus 
domestica]
Length=262

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 77/139 (55%), Gaps = 4/139 (3%)
 Frame = -1

Query  515  ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQND  336
            E  + +D +T+RC + + K   +E  PVL +RV    + C + +LSC+ EGS  +  QN 
Sbjct  100  ESFQSLDADTYRCTLPKLKLLNYEAAPVLDLRVTPTNEXCIVEMLSCRFEGSEALERQNS  159

Query  335  KFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQI  159
             F A M N +S+D N  +S ++    D  +++ +E+    F  +PV A+E  G  ++  +
Sbjct  160  HFSAFMTNHMSWDTNNSESFLE---VDVKLQLTLEIYTRPFNMMPVSAVERPGNLMMQAL  216

Query  158  LGIMLPRFMAQLVKDYQAW  102
            +  ++P  + QL++DY  W
Sbjct  217  VDRLVPLLLQQLLQDYGKW  235



>ref|WP_007356838.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN57642.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=196

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 91/179 (51%), Gaps = 10/179 (6%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFA  450
             +RF A +   + V Q Q P+  Y+  P    + L D  R+E++ +++FR  +    F  
Sbjct  2    HIRFNASQSVEIPVPQQQVPIQHYLRQPKRLVNALVDRSRLEQLSEDSFRLKMRPLDFMM  61

Query  449  FEVCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSG  276
              + P + ++V  QPDG +INL  + C++ G   +   N +F  ++  ++S   N+   G
Sbjct  62   VSIQPTVDLKVWAQPDG-AINLKSIGCQIRGVEYI---NQRFALNLKGQLSPYQNK---G  114

Query  275  VQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
               L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M QL+ DYQ WA
Sbjct  115  ATYLIGKADLEVQVELPPPFWLTPQPILEATGNGLLKSVLLTVKQRLMHQLLLDYQYWA  173



>ref|XP_008365169.1| PREDICTED: uncharacterized protein LOC103428830 isoform X2 [Malus 
domestica]
Length=255

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 86/157 (55%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S  +   ++L+    E  + +D +T+RC + + K   +E  PVL +RV    + C +
Sbjct  82   EFLSHQSGIEAMLNTRALESFQSLDADTYRCTLPKLKLLNYEAAPVLDLRVTPTNEXCIV  141

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFR  213
             +LSC+ EGS  +  QN  F A M N +S+D N  +S ++    D  +++ +E+    F 
Sbjct  142  EMLSCRFEGSEALERQNSHFSAFMTNHMSWDTNNSESFLE---VDVKLQLTLEIYTRPFN  198

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             +PV A+E  G  ++  ++  ++P  + QL++DY  W
Sbjct  199  MMPVSAVERPGNLMMQALVDRLVPLLLQQLLQDYGKW  235



>gb|KJB55232.1| hypothetical protein B456_009G069700 [Gossypium raimondii]
 gb|KJB55235.1| hypothetical protein B456_009G069700 [Gossypium raimondii]
Length=253

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            +++S P+   ++L+    E  E +D N +RC + +   F FE  PVL +RV    + C +
Sbjct  91   QFLSHPSGIQAILNTRALENFELLDTNAYRCTLPKLALFNFEASPVLDLRVIPTKEDCIV  150

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             L SCK +GS +V  QND F A+M+N I++D N  +  ++    D  + + +E+   PF 
Sbjct  151  ELFSCKFKGSEVVERQNDHFSATMINHITWDTNMSEPFLE---VDVKLNLCLEIYTRPFI  207

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               LP  A+E  G  ++  +L  ++P  + QLV+DY  W
Sbjct  208  L--LPTSAVEGPGNIMIQALLDRLVPLLLQQLVQDYSNW  244



>gb|KJB55234.1| hypothetical protein B456_009G069700 [Gossypium raimondii]
Length=255

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            +++S P+   ++L+    E  E +D N +RC + +   F FE  PVL +RV    + C +
Sbjct  93   QFLSHPSGIQAILNTRALENFELLDTNAYRCTLPKLALFNFEASPVLDLRVIPTKEDCIV  152

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             L SCK +GS +V  QND F A+M+N I++D N  +  ++    D  + + +E+   PF 
Sbjct  153  ELFSCKFKGSEVVERQNDHFSATMINHITWDTNMSEPFLE---VDVKLNLCLEIYTRPFI  209

Query  218  FRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
               LP  A+E  G  ++  +L  ++P  + QLV+DY  W
Sbjct  210  L--LPTSAVEGPGNIMIQALLDRLVPLLLQQLVQDYSNW  246



>ref|XP_008365170.1| PREDICTED: uncharacterized protein LOC103428830 isoform X3 [Malus 
domestica]
Length=254

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 85/157 (54%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S  +   ++L+    E  + +D +T+RC + + K   +E  PVL +RV    + C +
Sbjct  82   EFLSHQSGIEAMLNTRALESFQSLDADTYRCTLPKLKLLNYEAAPVLDLRVTPTNEXCIV  141

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFR  213
             +LSC+ EGS  +  QN  F A M N +S+D N  +S    L  D  +++ +E+    F 
Sbjct  142  EMLSCRFEGSEALERQNSHFSAFMTNHMSWDTNNSESF---LEVDVKLQLTLEIYTRPFN  198

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             +PV A+E  G  ++  ++  ++P  + QL++DY  W
Sbjct  199  MMPVSAVERPGNLMMQALVDRLVPLLLQQLLQDYGKW  235



>ref|XP_010095472.1| hypothetical protein L484_014899 [Morus notabilis]
 gb|EXB60446.1| hypothetical protein L484_014899 [Morus notabilis]
Length=204

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 74/133 (56%), Gaps = 11/133 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P++  ++L+   ++    +  NT+RC + R +   FE  PVL +RV    D C++
Sbjct  75   EFLSHPSAIEALLNTNALKSFQCLGTNTYRCTLQRVRLLNFEAAPVLDLRVTPTNDDCTV  134

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSCK EGS I+  QN  F A M N +++D N  +S ++    D  + + +E+   PF 
Sbjct  135  EMLSCKFEGSEIMERQNSHFSAFMRNHMTWDTNDSESFLE---VDVTLNLTLEIYTRPFT  191

Query  218  FRALPVQAIESTG  180
               +PV A+E  G
Sbjct  192  M--MPVSAVERPG  202



>ref|XP_007223805.1| hypothetical protein PRUPE_ppa010657mg [Prunus persica]
 gb|EMJ25004.1| hypothetical protein PRUPE_ppa010657mg [Prunus persica]
Length=241

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 75/138 (54%), Gaps = 8/138 (6%)
 Frame = -1

Query  506  ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFD  327
            E +D +T+RC + + +   FE  PVL +RV    + C + +LSC+ EGS  V  QN  F 
Sbjct  101  ESLDTDTYRCTLPKLQLLNFEAAPVLDLRVTPTNEDCIVEMLSCRFEGSEAVERQNSHFS  160

Query  326  ASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQIL  156
            A M N +S+D N  +S    L  D  + + +E+   PF    +PV A+E  G  ++  ++
Sbjct  161  AFMRNHMSWDTNDSESF---LEVDVKLNLTLEIYTRPFTM--MPVSAVERPGNLMMQALV  215

Query  155  GIMLPRFMAQLVKDYQAW  102
              ++P  + QL++DY  W
Sbjct  216  DRLVPLLLQQLLQDYSKW  233



>ref|XP_002991134.1| hypothetical protein SELMODRAFT_429500 [Selaginella moellendorffii]
 gb|EFJ07780.1| hypothetical protein SELMODRAFT_429500 [Selaginella moellendorffii]
Length=216

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 95/178 (53%), Gaps = 20/178 (11%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAERIE---RVDDNTFRCYVYRFKFFA  450
            +  A+R  +V  +   R L +++S PA    +++   ++   ++DD T+RC + +     
Sbjct  42   KLAAKRCLTVPFQDSSR-LNQFLSEPAGMQILINTNALQSYQKLDDTTYRCCLPKLDILK  100

Query  449  FEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            FEV P++ + ++ + D        C  EGS +V  QN  F ASM+N +++       G++
Sbjct  101  FEVAPIVDLSIDVKDD-------ECLFEGSELVEKQNQHFSASMINHLTW-------GLE  146

Query  269  K-LTSDAVIEVNIEV-PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            K L  +  + V++EV    F  LP+QA+E+ G+ VL  ++  ++P F+ QL   Y+ W
Sbjct  147  KQLNVNVELNVSLEVYTLPFTLLPLQAVETPGSIVLQAMVDRLVPIFLDQLFDGYRKW  204



>ref|XP_011003441.1| PREDICTED: uncharacterized protein LOC105110188 isoform X3 [Populus 
euphratica]
Length=226

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 84/163 (52%), Gaps = 21/163 (13%)
 Frame = -1

Query  632  APKVRFIARRKE--SVSVRQLQRPLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVY  468
            + K    A RKE  ++ +      + E++S P    ++L+    +  E +D NT+RC + 
Sbjct  71   SKKANLTAARKERMNLPITDGGYRISEFLSHPFGIQAILNTGSLQSFESLDANTYRCILP  130

Query  467  RFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNR  288
            + +   FE  PVL +RV    + C++ ++SCK +GS +V  QND+F A MVN ++++ N 
Sbjct  131  KVELLNFEAAPVLDLRVSPSDEHCTVEMISCKFQGSELVERQNDRFSAFMVNHMTWNTN-  189

Query  287  RDSGVQKLTSDAVIEVNIEVPFA-------FRALPVQAIESTG  180
                     S+  +EV++++          F  LP  A+ES G
Sbjct  190  --------ISEPFLEVDVKLNLMLEIYTKPFTLLPTSAVESAG  224



>ref|WP_009783224.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW38343.1| hypothetical protein L8106_09976 [Lyngbya sp. PCC 8106]
Length=195

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 88/178 (49%), Gaps = 8/178 (4%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
            ++F A +   ++V Q Q P+  Y+  P    + L D  R+E++  +TFR  +    F   
Sbjct  3    IKFNATQSVEMAVPQQQIPIQHYLRQPRRLMNALADPTRLEQLSKDTFRLKMRPLSFLML  62

Query  446  EVCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             + P + ++V    DG   +  + C++ G   +   N +F   +V R+S     +  G  
Sbjct  63   TIQPTVDLKVWALADGTIGLKSVGCEIRGVEYI---NQRFSLKLVGRLSPS---QKEGTT  116

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
             LT  A +EV +E+P A +  P+  +E+TG  +L  +L  +  R M  L+ DY+ WA+
Sbjct  117  HLTGQANLEVQVELPPALKFTPLSILETTGNGLLKSVLMTIKQRLMHNLLCDYRQWAS  174



>gb|KJB55231.1| hypothetical protein B456_009G069700 [Gossypium raimondii]
Length=220

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 11/133 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            +++S P+   ++L+    E  E +D N +RC + +   F FE  PVL +RV    + C +
Sbjct  91   QFLSHPSGIQAILNTRALENFELLDTNAYRCTLPKLALFNFEASPVLDLRVIPTKEDCIV  150

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             L SCK +GS +V  QND F A+M+N I++D N  +  ++    D  + + +E+   PF 
Sbjct  151  ELFSCKFKGSEVVERQNDHFSATMINHITWDTNMSEPFLE---VDVKLNLCLEIYTRPFI  207

Query  218  FRALPVQAIESTG  180
               LP  A+E  G
Sbjct  208  L--LPTSAVEGPG  218



>ref|XP_010325657.1| PREDICTED: uncharacterized protein LOC101245279 isoform X3 [Solanum 
lycopersicum]
Length=191

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -1

Query  566  LMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            + E++S  +   ++L+    +  E +D NT+RC + + +   FEV PVL ++V    + C
Sbjct  71   ISEFLSHKSGIEAMLNKRALQSFESIDSNTYRCTLPQVQLLNFEVAPVLTLKVNPTSENC  130

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            ++ +LSCK EGS +V  QND F ASMVNRI+++
Sbjct  131  TVEMLSCKFEGSDLVEQQNDHFSASMVNRITWE  163



>ref|XP_004138757.1| PREDICTED: uncharacterized protein LOC101204116 [Cucumis sativus]
 ref|XP_004160852.1| PREDICTED: uncharacterized protein LOC101226750 [Cucumis sativus]
Length=241

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/208 (25%), Positives = 106/208 (51%), Gaps = 20/208 (10%)
 Frame = -1

Query  674  YDSPRGSLRISADAAPKVRFIARRKESVSVRQLQR-------------PLMEYMSLPASQ  534
            + SPR     +  +         +K ++SV++ ++              + E+++ P+  
Sbjct  24   FSSPRKKFETTKLSKATNSETNTKKANLSVKKREKIRLPSYSGQGRTYHIKEFLNHPSGI  83

Query  533  YSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEG  363
             ++L+   ++    +D NT+RC + + +   FE  P L +RV    +  ++ +LSCK EG
Sbjct  84   EAMLNKNALKSFQLLDANTYRCTLPKLQLLNFEAAPTLDLRVIPTDEDFTVEMLSCKFEG  143

Query  362  SPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFRALPVQAIES  186
            S +V  QN+ F A M+N +++D    +S ++    D  + +++E+    F  +P  A+E+
Sbjct  144  SELVERQNEHFSALMINHLTWDTIDSNSYLE---VDVKLNLSLEIYTLPFTLMPTAAVEN  200

Query  185  TGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             G  +L  +L  ++P  + QL++DY+ W
Sbjct  201  PGNLMLQALLDNLVPLLLRQLMQDYEKW  228



>ref|XP_009793531.1| PREDICTED: uncharacterized protein LOC104240387 isoform X2 [Nicotiana 
sylvestris]
Length=202

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 71/128 (55%), Gaps = 11/128 (9%)
 Frame = -1

Query  647  ISADAAPKVRFIARRKESVSV--------RQLQRPLMEYMSLPASQYSVLDA---ERIER  501
            +S   A +    AR+KE + +          +   + E++S  +   ++L+    +  E 
Sbjct  35   LSDSDAKRANLSARKKERIKLPKHDGIGGDNISFHISEFLSHKSGVEAMLNKRALQSFES  94

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D N +RC + + +   FEV PVL+++V    + C++ +LSCK EGS +V  QND F AS
Sbjct  95   IDSNMYRCTLPQVQLLNFEVAPVLILQVNPTSEDCTVEMLSCKFEGSDLVEQQNDHFSAS  154

Query  320  MVNRISYD  297
            MVNRI+++
Sbjct  155  MVNRITWE  162



>ref|XP_006601098.1| PREDICTED: uncharacterized protein LOC100813897 isoform X4 [Glycine 
max]
Length=201

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 10/133 (8%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  39   KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  98

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  99   SFESLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  158

Query  332  FDASMVNRISYDG  294
            F A M N++++ G
Sbjct  159  FSAFMRNQMTWGG  171



>ref|XP_009377348.1| PREDICTED: uncharacterized protein LOC103965968 [Pyrus x bretschneideri]
 ref|XP_009377349.1| PREDICTED: uncharacterized protein LOC103965968 [Pyrus x bretschneideri]
Length=244

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 84/157 (54%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S  +   ++L+    E  + +D + +RC + + K   +E  PVL +RV    + C +
Sbjct  82   EFLSHQSGIEAMLNTRALESFQSLDADIYRCTLPKLKLLNYEAAPVLDLRVTPTNEDCIV  141

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFR  213
             +LSC+ EGS  V  QN  F A M N +S+D N  +S    L  D  +++ +E+    F 
Sbjct  142  EMLSCRFEGSEAVERQNSHFSAFMTNHMSWDTNNSESF---LEVDVKLQLTLEIYTPPFN  198

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             +PV A+E  G  ++  ++  ++P  + QL++DY  W
Sbjct  199  MMPVSAVERPGNLMMQALVDRLVPLLLQQLLQDYGKW  235



>ref|WP_023068083.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT05688.1| hypothetical protein M595_4382 [Lyngbya aestuarii BL J]
Length=195

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 86/177 (49%), Gaps = 8/177 (5%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAFE  444
            +F A +   ++V Q Q P+  Y+  P    + L D  R+E++  +TFR  +    F    
Sbjct  4    KFNATQSVEMAVTQQQIPIQHYLRQPRRLMNALADPSRLEQLSKDTFRLKMRPLSFLMLT  63

Query  443  VCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            + P + ++V    DG   +  + C++ G   +   N +F   +V R+S     +  G   
Sbjct  64   IQPTVDLKVWALADGTIGLKSVGCEIRGVEYI---NQRFSLKLVGRLSPS---QKEGTTH  117

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
            LT  A +EV +E+P A +  P+  +E TG  +L  +L  +  R M  L+ DY+ WA+
Sbjct  118  LTGQANLEVQVELPPALKFTPLSILEKTGNGLLKSVLMTIKQRLMHNLLCDYRQWAS  174



>gb|KGN62886.1| hypothetical protein Csa_2G379170 [Cucumis sativus]
Length=302

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 89/157 (57%), Gaps = 7/157 (4%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E+++ P+   ++L+   ++    +D NT+RC + + +   FE  P L +RV    +  ++
Sbjct  136  EFLNHPSGIEAMLNKNALKSFQLLDANTYRCTLPKLQLLNFEAAPTLDLRVIPTDEDFTV  195

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV-PFAFR  213
             +LSCK EGS +V  QN+ F A M+N +++D    +S ++    D  + +++E+    F 
Sbjct  196  EMLSCKFEGSELVERQNEHFSALMINHLTWDTIDSNSYLE---VDVKLNLSLEIYTLPFT  252

Query  212  ALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
             +P  A+E+ G  +L  +L  ++P  + QL++DY+ W
Sbjct  253  LMPTAAVENPGNLMLQALLDNLVPLLLRQLMQDYEKW  289



>ref|XP_006591054.1| PREDICTED: uncharacterized protein LOC100803285 isoform X5 [Glycine 
max]
Length=201

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 72/133 (54%), Gaps = 10/133 (8%)
 Frame = -1

Query  662  RGSLRISADAAPKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERI-  507
            + +  ++++A  K    A +KE + +      L        E++S P+   +VL+ + + 
Sbjct  39   KAATSLNSNAKKKANLFAEKKERIRLPTYNDDLGGKKYHISEFLSQPSGIAAVLNTKALQ  98

Query  506  --ERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDK  333
              E +D NT+RC + + +F  FE  P+L +RV    + C + +LSCK EGS +V  QND 
Sbjct  99   SFESLDANTYRCELPKLQFLNFEAVPLLDLRVTSTDEDCLVEMLSCKFEGSEVVKEQNDH  158

Query  332  FDASMVNRISYDG  294
            F A M N++++ G
Sbjct  159  FSAFMRNQMTWGG  171



>ref|XP_010325656.1| PREDICTED: uncharacterized protein LOC101245279 isoform X1 [Solanum 
lycopersicum]
Length=253

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = -1

Query  566  LMEYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            + E++S  +   ++L+    +  E +D NT+RC + + +   FEV PVL ++V    + C
Sbjct  71   ISEFLSHKSGIEAMLNKRALQSFESIDSNTYRCTLPQVQLLNFEVAPVLTLKVNPTSENC  130

Query  395  SINLLSCKLEGSPIVVAQNDKFDASMVNRISYD  297
            ++ +LSCK EGS +V  QND F ASMVNRI+++
Sbjct  131  TVEMLSCKFEGSDLVEQQNDHFSASMVNRITWE  163



>gb|KFK29693.1| hypothetical protein AALP_AA7G166500 [Arabis alpina]
Length=200

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 88/158 (56%), Gaps = 12/158 (8%)
 Frame = -1

Query  626  KVRFIARRKESVSVR---QLQRPLMEYMSLPASQYSVLDAERIER---VDD--NTFRCYV  471
            K    A RK+ + ++   + +    +++  P+   +V++A+ ++    VDD  NT+RC +
Sbjct  44   KANLSASRKQRIKLQINGEKELTFSDFLKHPSGMEAVINAKALQSYHLVDDIDNTYRCTL  103

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             + +  +FEV PVL++RV    + C++ LLSCKLEGS ++  Q+++F A+M N ++++  
Sbjct  104  PKVQLMSFEVSPVLVLRVTPTQEDCTVELLSCKLEGSEVLENQSERFLANMTNCMTWNME  163

Query  290  RRDSGVQKLTSDAVIEVNIEVPF-AFRALPVQAIESTG  180
              +     L  D  + V +E+    F  LP  A+E  G
Sbjct  164  NPEPF---LEVDVKLNVTLEISTPPFTMLPASAVEVPG  198



>ref|XP_009039730.1| hypothetical protein AURANDRAFT_5676, partial [Aureococcus anophagefferens]
 gb|EGB05599.1| hypothetical protein AURANDRAFT_5676, partial [Aureococcus anophagefferens]
Length=159

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 82/164 (50%), Gaps = 12/164 (7%)
 Frame = -1

Query  566  LMEYMSLPASQYSVLD---AERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
            L  YM LP++QY++LD      +ER++   F   V   KFF   V P +   VE + D  
Sbjct  1    LTAYMRLPSAQYALLDLPYGASLERLEGENFLLKVPTVKFFFLSVEPNVFATVESREDSV  60

Query  395  SINLLSCKLEGSPIVVAQ---NDKFDASMVNRISY-DGNRRDSGVQKLTSDAVIEVNIEV  228
             +    C L GS  ++ +   ND F+ ++   +++ DG+ R      +  D  + V++  
Sbjct  61   VVKSDRCTLLGSDALIERIGLNDAFEFAVTATMTWTDGDAR-----SIDCDCTLAVDVAP  115

Query  227  PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT  96
            P  FRA+P   +++TG  V+      +L  F+  L++DY AW +
Sbjct  116  PGPFRAMPRGLLQTTGNAVMRVATDQVLRGFLRTLIRDYDAWGS  159



>gb|KJB55230.1| hypothetical protein B456_009G069700 [Gossypium raimondii]
Length=222

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            +++S P+   ++L+    E  E +D N +RC + +   F FE  PVL +RV    + C +
Sbjct  91   QFLSHPSGIQAILNTRALENFELLDTNAYRCTLPKLALFNFEASPVLDLRVIPTKEDCIV  150

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             L SCK +GS +V  QND F A+M+N I++D N
Sbjct  151  ELFSCKFKGSEVVERQNDHFSATMINHITWDTN  183



>ref|XP_010929428.1| PREDICTED: uncharacterized protein LOC105050903 isoform X4 [Elaeis 
guineensis]
Length=213

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +   + P+   ++++ P+   ++L+   +     +D +T+RC + + +F  F
Sbjct  79   ARRKERIKLPDFEGPITFSDFLNHPSGVEALLNTRALHSFQPLDSHTYRCTLQKIQFLKF  138

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            EV PVL +RV    +GC++ +L C+ EGS  V  QN  F A M N I+++ N
Sbjct  139  EVAPVLDLRVTPTREGCTVEMLDCRFEGSETVQQQNHAFSAFMRNHITWERN  190



>ref|XP_004296677.1| PREDICTED: uncharacterized protein LOC101305160 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=235

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 95/186 (51%), Gaps = 14/186 (8%)
 Frame = -1

Query  632  APKVRFIARRKESVSVRQLQR---PLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYV  471
            A K    A +KE + +         + E++S  +   ++L+    +  E +  +T+RC +
Sbjct  45   AKKANLSAAKKERIKLPSFDSNNVHIREFLSHQSGTEAMLNTRALQSFEPLSTDTYRCTL  104

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             + K   FE  PV+ +RV    + C + +LSC+ +GS  V  QN +F A M N +S++  
Sbjct  105  PKLKLLNFEAAPVVDLRVNPTDEDCMVEMLSCRFDGSEAVERQNSRFSALMTNHMSWE--  162

Query  290  RRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLV  120
             RD     L  D  +++ +E+   PF    +PV A+E  G  ++  +L  ++P  + QL+
Sbjct  163  -RDDSESYLEVDVKLKLTLEIYTRPFTM--MPVSAVERPGNLMMQALLDRLVPLLLQQLL  219

Query  119  KDYQAW  102
            +DYQ W
Sbjct  220  EDYQKW  225



>ref|XP_011462558.1| PREDICTED: uncharacterized protein LOC101305160 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462559.1| PREDICTED: uncharacterized protein LOC101305160 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462560.1| PREDICTED: uncharacterized protein LOC101305160 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011462561.1| PREDICTED: uncharacterized protein LOC101305160 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=239

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 95/186 (51%), Gaps = 14/186 (8%)
 Frame = -1

Query  632  APKVRFIARRKESVSVRQLQR---PLMEYMSLPASQYSVLDA---ERIERVDDNTFRCYV  471
            A K    A +KE + +         + E++S  +   ++L+    +  E +  +T+RC +
Sbjct  49   AKKANLSAAKKERIKLPSFDSNNVHIREFLSHQSGTEAMLNTRALQSFEPLSTDTYRCTL  108

Query  470  YRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
             + K   FE  PV+ +RV    + C + +LSC+ +GS  V  QN +F A M N +S++  
Sbjct  109  PKLKLLNFEAAPVVDLRVNPTDEDCMVEMLSCRFDGSEAVERQNSRFSALMTNHMSWE--  166

Query  290  RRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLV  120
             RD     L  D  +++ +E+   PF    +PV A+E  G  ++  +L  ++P  + QL+
Sbjct  167  -RDDSESYLEVDVKLKLTLEIYTRPFTM--MPVSAVERPGNLMMQALLDRLVPLLLQQLL  223

Query  119  KDYQAW  102
            +DYQ W
Sbjct  224  EDYQKW  229



>gb|EYU37480.1| hypothetical protein MIMGU_mgv1a011869mg [Erythranthe guttata]
Length=268

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 101/196 (52%), Gaps = 12/196 (6%)
 Frame = -1

Query  668  SPRGSLRISADAAPKVRF-IARRKESVSVRQLQRPLMEYMSLPASQYSVLDA---ERIER  501
            S  G+ R +  A  K R  I    + V+       + E+ S P+   ++L+    +  + 
Sbjct  69   SESGAKRANLSAGKKERIKIPNCSDGVNGGSGSYSISEFFSHPSGIEALLNTRALQSCQS  128

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D N +RC + + +   F V PVL ++V    + C + +LSCK EGS +V  QN+ F AS
Sbjct  129  LDSNLYRCVLPQLQLLNFRVAPVLDLQVTPSSEDCLVEMLSCKFEGSEVVERQNEHFSAS  188

Query  320  MVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFAFRALPVQAIESTGAQVLNQILGI  150
            M N I+++    +   Q L  D  + + +E+   PFA   LPV A+E  G  ++  ++  
Sbjct  189  MKNHITWETIDTE---QFLNVDVKLNLVLEIYTQPFAL--LPVLAVEGPGNIMMQTLVDK  243

Query  149  MLPRFMAQLVKDYQAW  102
            ++P  + QL+++Y+ W
Sbjct  244  LVPLLVQQLLQNYEEW  259



>ref|WP_039713949.1| hypothetical protein [Scytonema millei]
 gb|KIF21651.1| hypothetical protein QH73_24140 [Scytonema millei VB511283]
Length=192

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 95/191 (50%), Gaps = 10/191 (5%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAFE  444
            RF A +   + V +   P+  Y+  P      L D  RIE++D  +FR  +    F    
Sbjct  4    RFTASQSVEIVVPEQPVPIQHYLRQPQRLVKALVDPSRIEQLDCESFRLKIRPLSFMTLN  63

Query  443  VCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            + P   ++V  +P+G ++NL  ++C++ G   +   N +F+ ++   ++     +   + 
Sbjct  64   IQPTADLKVWTEPNG-TVNLRSVACEILGLDYI---NQRFELNLQGHLA---PYQHQNIT  116

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
             L   A +EV +E+PF     P   +E+TG  +L  +L  +  R + QL+ DY++W + +
Sbjct  117  LLKGKADLEVKVELPFPLNMTPQPIVETTGNGLLKSVLVTIKQRLLHQLLTDYRSWVSDN  176

Query  89   TSRQPLGTGQI  57
             ++ P+ + Q+
Sbjct  177  QNQLPVTSYQL  187



>ref|WP_015174041.1| Protein of unknown function DUF1997 [Oscillatoria nigro-viridis]
 gb|AFZ04702.1| Protein of unknown function DUF1997 [Oscillatoria nigro-viridis 
PCC 7112]
Length=192

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 94/182 (52%), Gaps = 10/182 (5%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
             RF A +   ++V + + P+  Y+  P    + L D  R +++ D+ FR  +   +F   
Sbjct  3    TRFNASQFVELAVPEERVPIQHYLRQPRRLVNALVDRSRTQQLSDDCFRLKMRPLQFMML  62

Query  446  EVCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGV  273
             + P + +RV  Q DG +INL  ++C++ G   +   ND+F  ++  ++      + SGV
Sbjct  63   SIQPTVDMRVWAQADG-TINLESVACEIRGVGYI---NDRFALNLKGKLCV---HQSSGV  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATG  93
              L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M QL+ DY+ WA+ 
Sbjct  116  AYLKGKADLEVQVELPPPFWLTPKPILETTGNALLKSVLLSVKQRLMYQLLLDYRRWASS  175

Query  92   DT  87
            ++
Sbjct  176  ES  177



>ref|WP_015156308.1| hypothetical protein [Chroococcidiopsis thermalis]
 gb|AFY89768.1| Protein of unknown function DUF1997 [Chroococcidiopsis thermalis 
PCC 7203]
Length=192

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 94/191 (49%), Gaps = 10/191 (5%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAFE  444
            RF A +   + V +   P+  Y+  P      L D  RIE++D  +FR  +    F    
Sbjct  4    RFTASQSVEIVVPEQPVPIQHYLRQPQRLVKALVDPSRIEQLDCESFRLKIRPLSFMTLN  63

Query  443  VCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            + P   ++V  +P+G ++NL  ++C++ G   +   N +F+ ++   ++     +   + 
Sbjct  64   IQPTADLKVWTEPNG-TVNLRSVACEILGLDYI---NQRFELNLQGHLA---PYQHQNIT  116

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
             L   A +EV +E+PF     P   +E+TG  +L  +L  +  R + QL+ DY++W   +
Sbjct  117  LLKGKADLEVKVELPFPLNMTPQPIVETTGNGLLKSVLVTIKQRLLHQLLTDYRSWVNDN  176

Query  89   TSRQPLGTGQI  57
             ++ P+ + Q+
Sbjct  177  QNQLPVTSYQL  187



>emb|CCH47217.1| hypothetical protein [Lupinus angustifolius]
Length=292

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 52/234 (22%)
 Frame = -1

Query  632  APKVRFIARRKESVSVRQLQRPL-------MEYMSLPASQYSVLDAERIER---VDDNTF  483
            + K    A +KE V +      L        E++S  +   +VL+   ++    +DDNT+
Sbjct  63   SKKANLFAEKKERVKLPTYNDDLGGKKYHISEFLSHSSGIAAVLNTRALQSFQPLDDNTY  122

Query  482  RCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDA-------  324
            +C + + +F  FE  P + +RV    + C + +LSCK EGS +V  QN+ F A       
Sbjct  123  KCALPKLQFLNFEAAPWMDLRVTSTDEDCLVEMLSCKFEGSELVEEQNNHFSALINQRMV  182

Query  323  ----------------------------SMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV  228
                                         M N +++ G   D     L  D  + + +E+
Sbjct  183  ISSDTCLFFLEQDQSLSHAYGENPHWETFMRNHMTWGGG--DDAESFLEVDVKLNLTLEI  240

Query  227  ---PFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDTSRQP  75
               PF    LP+ A+E  G  ++  ++  ++P  + Q+++DY  W        P
Sbjct  241  YTRPFTM--LPISAVERPGNLMMQALVDKLVPMLLQQMIQDYDEWVQNQLENTP  292



>ref|XP_009628396.1| PREDICTED: uncharacterized protein LOC104118758 isoform X2 [Nicotiana 
tomentosiformis]
Length=202

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 69/128 (54%), Gaps = 7/128 (5%)
 Frame = -1

Query  671  DSPRGSLRISADAAPKVRFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDA---ERIER  501
            DS R +L     A  K R    + + +        + E++S  +   ++L+    +  E 
Sbjct  39   DSKRANL----SARKKERIKLPKHDGIGGDNKSFHISEFLSHKSGVEAMLNKRALQSFES  94

Query  500  VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDAS  321
            +D N +RC + + +   FEV PVL+++V    + C++ +LSCK EGS +V  QND F AS
Sbjct  95   IDSNMYRCTLPQVQLLNFEVAPVLILQVNPTSEDCTVKMLSCKFEGSDLVEQQNDHFSAS  154

Query  320  MVNRISYD  297
            MVN I+++
Sbjct  155  MVNCITWE  162



>ref|XP_008812691.1| PREDICTED: uncharacterized protein LOC103723532 isoform X4 [Phoenix 
dactylifera]
Length=246

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query  611  ARRKESVSVRQLQRPLM--EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAF  447
            ARRKE + +     P+   ++++ P+   ++L+   +     +D NT+RC + + +F  F
Sbjct  112  ARRKERIELPHYGGPITFSDFVNHPSGVEALLNTRALHSFRPLDSNTYRCTLQKIQFLKF  171

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGN  291
            EV PVL +RV    +GC++ ++ C+ EGS IV  QN  F A + N I+++ N
Sbjct  172  EVAPVLDLRVTPTREGCTVEMVDCRFEGSGIVEQQNHVFSAFVRNHITWERN  223



>ref|XP_006596139.1| PREDICTED: uncharacterized protein LOC100793446 isoform X2 [Glycine 
max]
Length=201

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 71/133 (53%), Gaps = 15/133 (11%)
 Frame = -1

Query  560  EYMSLPASQYSVLDA---ERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++S P+   +VL+    +  + +D NT+RC + + +F  FE  P+L +RV    + C +
Sbjct  80   EFLSQPSGIAAVLNTKAFQSFQSLDANTYRCELPKLQFLNFEAAPLLDLRVTSTDEDCLV  139

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRA  210
             +LSCK EGS +V  QN+ F A M N +++ G   +S ++       ++VN+ +      
Sbjct  140  EMLSCKFEGSEVVKEQNNHFSAFMRNHMTWGGAGAESFLE-------VDVNLNL-----T  187

Query  209  LPVQAIESTGAQV  171
            L + A  ST   +
Sbjct  188  LEISACRSTHNHL  200



>ref|WP_015160888.1| Protein of unknown function (DUF1997) [Chamaesiphon minutus]
 gb|AFY94768.1| Protein of unknown function (DUF1997) [Chamaesiphon minutus PCC 
6605]
Length=195

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 91/188 (48%), Gaps = 11/188 (6%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
            V+F A R   ++V +   P+  Y+  P    + L D  R++++ ++ FR  +    FF F
Sbjct  4    VKFSADRSVDIAVPKQPIPIGHYLRQPHRLVNALVDPSRVQQLSEDEFRLAMRTLNFFGF  63

Query  446  EVCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            E+ P + +RV  + DG   I    C++ G   +   + +F   ++ ++S     +++G  
Sbjct  64   ELQPTVFLRVWTEADGTVRIASTKCEIRGIDYI---DRRFSLQLMGKLS---PYQENGQT  117

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA---  99
             L   A ++V +++P     +P   +ES G  +L  IL     R + QL+ DY  WA   
Sbjct  118  YLEGLADLQVRVDLPPPLNFMPRSMVESAGNSLLKGILNTFKQRLLHQLIADYILWANTG  177

Query  98   TGDTSRQP  75
            T  TS +P
Sbjct  178  TEGTSTKP  185



>ref|WP_017718063.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=193

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 100/196 (51%), Gaps = 15/196 (8%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQ-YSVLDAERIERVDDNTFRCYVYRFKFFAFE  444
            RF+A +   ++V +   P+  Y+  P    Y+++D  R+E++  + FR  +    F    
Sbjct  4    RFVASQSVEIAVPEQPVPIQHYLRQPKRLVYALVDPSRMEQLRADVFRLKMRPLSFMMLS  63

Query  443  VCPVLLVRVEEQPDGCSINLLS--CKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
            + P + ++V  + DG +INL S  C++ G   +   N +F   ++ ++     ++ +G+ 
Sbjct  64   IQPTVDMKVWAEADG-TINLKSVRCEIRGVEYI---NQRFALKLIGKLY---PQQIAGLT  116

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGD  90
             L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M  L++DY  WA+ +
Sbjct  117  YLKGKADLEVRVELPPPFWLTPQPIMEATGNTLLKSVLLTVKQRLMHHLLQDYCRWASEE  176

Query  89   ---TSRQPLGT--GQI  57
                S QP+ +  GQI
Sbjct  177  REAQSSQPVLSPKGQI  192



>ref|WP_006456460.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX86684.1| hypothetical protein S7335_4390 [Synechococcus sp. PCC 7335]
Length=188

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 86/187 (46%), Gaps = 7/187 (4%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
            VRF A +  ++SV +   P+  Y+S P    + L D  ++E +  N FR  +   KF   
Sbjct  2    VRFTACQAVTISVPEQPLPIETYLSEPQRLVTALVDKTQVEVLGPNLFRLKIRPLKFVGL  61

Query  446  EVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
             + PV  + +  +     +    C +EG     + N KF   M     Y  ++  S  +K
Sbjct  62   TIQPVCDIEIWLEEQTVRLRSNQCHIEGYE---SFNQKFSMDMQG---YLVSQSTSTGKK  115

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATGDT  87
            L   A + V++++P     +P   +  TG  +LN IL  +  R M QL+ DY  WAT D 
Sbjct  116  LRGQANLRVSVDLPSVATLMPRPILVRTGNGLLNSILITLKQRLMRQLITDYCNWATADV  175

Query  86   SRQPLGT  66
            + Q  G+
Sbjct  176  TSQSPGS  182



>ref|WP_009788862.1| hypothetical protein [Synechococcus sp. BL107]
 gb|EAU71506.1| hypothetical protein BL107_08234 [Synechococcus sp. BL107]
Length=184

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  530  SVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIV  351
            ++LD+ ++ ++    +R  V   + F  +V PV+ +++E + D   +  + C+LEG  +V
Sbjct  42   ALLDSRQLTKIKPGHYRYLVTSLQVFQLQVKPVVSLQIETESDTLVMKAVDCELEGLGLV  101

Query  350  VAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQV  171
                D F  S+ +++  DG+        L+  A + V +  P   R +P + +ESTG  +
Sbjct  102  ----DDFQLSLESKLISDGH-------GLSGHAHLSVEVSQPQLLRLIPRRVLESTGESI  150

Query  170  LNQILGIMLPRFMAQLVKDYQAW  102
            LN IL  +  R   QL+ D+Q W
Sbjct  151  LNGILIGIKARVGQQLISDFQDW  173



>gb|EKQ68777.1| Protein of unknown function (DUF1997) [Oscillatoriales cyanobacterium 
JSC-12]
Length=198

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 11/184 (6%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAE-RIERVDDNTFRCYVYRFKFFAFE  444
            RF A +   + V     P+  Y+  P    + L A  R+E + ++ FR  +    F    
Sbjct  4    RFFASQSVDIPVADQPIPIQHYLRQPHRLVNALTASSRVEVLGNDLFRLKMRPLTFMTLS  63

Query  443  VCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            + P + +RV    DG   ++ + C++ G   +   ND+F  +++ +++       +GV  
Sbjct  64   LQPTVDMRVWAAADGTVHLHSVQCEILGVDYI---NDRFALNLLGKLT---PVTINGVTH  117

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWAT---  96
            L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M QLV DY+AW +   
Sbjct  118  LRGRADLEVMVELPLPFALTPKPILETTGNGLLKSVLLTVKQRLMHQLVSDYRAWVSCQF  177

Query  95   GDTS  84
            G+T+
Sbjct  178  GETA  181



>ref|XP_010669559.1| PREDICTED: uncharacterized protein LOC104886760 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=229

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 76/143 (53%), Gaps = 19/143 (13%)
 Frame = -1

Query  611  ARRKESVSVRQLQRP-------LMEYMSLPASQYSVLDAERIER---VDDNTFRCYVYRF  462
            AR+KE + +   +         + ++++ P    ++L+   +E    +D NT+RC +   
Sbjct  55   ARKKERIKLPSYENARVGETYHISQFLNHPTGVEAMLNVNVLENYVSIDVNTYRCKIPPI  114

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FEV PVL ++V    + C++ LLSCK EGS IV +QN  F A+M N I++D     
Sbjct  115  QLLNFEVSPVLDLQVSPASECCTVELLSCKFEGSEIVESQNKYFSATMKNLITWD-----  169

Query  281  SGVQKLTSDAVIEVNIEVPFAFR  213
                K  S++ ++V++++  A  
Sbjct  170  ----KTGSESFLDVDVKLNIALE  188



>ref|WP_036617098.1| hypothetical protein, partial [Oscillatoriales cyanobacterium 
JSC-12]
Length=173

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 84/175 (48%), Gaps = 8/175 (5%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVLDAE-RIERVDDNTFRCYVYRFKFFAFE  444
            RF A +   + V     P+  Y+  P    + L A  R+E + ++ FR  +    F    
Sbjct  4    RFFASQSVDIPVADQPIPIQHYLRQPHRLVNALTASSRVEVLGNDLFRLKMRPLTFMTLS  63

Query  443  VCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQK  267
            + P + +RV    DG   ++ + C++ G   +   ND+F  +++ +++       +GV  
Sbjct  64   LQPTVDMRVWAAADGTVHLHSVQCEILGVDYI---NDRFALNLLGKLT---PVTINGVTH  117

Query  266  LTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAW  102
            L   A +EV +E+P  F   P   +E+TG  +L  +L  +  R M QLV DY+AW
Sbjct  118  LRGRADLEVMVELPLPFALTPKPILETTGNGLLKSVLLTVKQRLMHQLVSDYRAW  172



>ref|WP_039726589.1| MULTISPECIES: hypothetical protein [Oscillatoriophycideae]
 gb|KIF14775.1| hypothetical protein QP59_29595 [Aphanocapsa montana BDHKU210001]
 gb|KIF39698.1| hypothetical protein QQ91_22515 [Lyngbya confervoides BDU141951]
Length=199

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 89/177 (50%), Gaps = 8/177 (5%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQ-YSVLDAERIERVDDNTFRCYVYRFKFFAF  447
            +R  A++  ++ + +   PL  Y+  P    +++++ +++E +  NTFR ++  F+F   
Sbjct  2    LRLAAQQTANMQIARHGVPLSHYLRQPRRLVHALMNPDQVEELSANTFRFHLRGFQFLML  61

Query  446  EVCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQ  270
             + PV+ ++++   D   ++  L C ++G+  +   N++F   +  ++      +   V 
Sbjct  62   NIRPVVDLQIDTSHDHLLTVRSLDCWIKGNQFI---NEQFSLDLQGQLQLTEREQ---VT  115

Query  269  KLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
             LT D  + + + +P      P   +E+TG Q+L  +L  +  R M QL  DYQ W+
Sbjct  116  DLTGDVDLAIAVGLPPILSMTPHSILETTGNQILRGVLNTIKHRLMHQLAADYQRWS  172



>ref|XP_010669561.1| PREDICTED: uncharacterized protein LOC104886760 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=219

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 76/143 (53%), Gaps = 19/143 (13%)
 Frame = -1

Query  611  ARRKESVSVRQLQRP-------LMEYMSLPASQYSVLDAERIER---VDDNTFRCYVYRF  462
            AR+KE + +   +         + ++++ P    ++L+   +E    +D NT+RC +   
Sbjct  55   ARKKERIKLPSYENARVGETYHISQFLNHPTGVEAMLNVNVLENYVSIDVNTYRCKIPPI  114

Query  461  KFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRD  282
            +   FEV PVL ++V    + C++ LLSCK EGS IV +QN  F A+M N I++D     
Sbjct  115  QLLNFEVSPVLDLQVSPASECCTVELLSCKFEGSEIVESQNKYFSATMKNLITWD-----  169

Query  281  SGVQKLTSDAVIEVNIEVPFAFR  213
                K  S++ ++V++++  A  
Sbjct  170  ----KTGSESFLDVDVKLNIALE  188



>emb|CAK29078.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
Length=183

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = -1

Query  530  SVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIV  351
            ++L  E++E + +  +R  V   + F   + P + ++VE+Q     +  L C L+G P +
Sbjct  37   ALLSPEQLEPLGEGRYRYSVSPLQLFQLRIMPTVEIQVEQQASRLEMRSLQCNLDGVPGL  96

Query  350  VAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQV  171
               +D F  S+ + +    N        L  +A + V +  P   R +P + +ESTG  +
Sbjct  97   ---DDDFKLSLSSWLEATAN-------GLVGEAKLGVQVTQPAVLRLIPTRLLESTGESL  146

Query  170  LNQILGIMLPRFMAQLVKDYQAW  102
            LN IL  +  R   QL++D+Q+W
Sbjct  147  LNGILLTIKGRVGQQLIQDFQSW  169



>ref|WP_008188841.1| hypothetical protein [Moorea producens]
 gb|EGJ29919.1| protein of unknown function, DUF1997 [Moorea producens 3L]
Length=193

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 84/182 (46%), Gaps = 10/182 (5%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPAS-QYSVLDAERIERVDDNTFRCYVYRFKFFAF  447
             +F A ++  ++V Q   P+  Y+  P    Y++ D  RI+++    FR  +    F + 
Sbjct  3    TQFFASQRVEMTVPQESVPIQHYLRQPERIVYAIADLNRIQQLTQKRFRLKMNPLHFMSL  62

Query  446  EVCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRIS-YDGNRRDSGV  273
               P + + V  + D    +  + CK+ G   +   N +F   +  ++  +D    D GV
Sbjct  63   TFQPTVDLEVWAESDATVHLRSVGCKILGLDYI---NQRFALELTGKLHPWD----DQGV  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATG  93
             KLT  A + V ++VP  F   P   +E+TG  +L  +L  +    M QL+ DY+ WA  
Sbjct  116  TKLTGRADLTVKVDVPLPFSLTPKPILETTGNGLLKSVLVRIKQTLMHQLLLDYRQWARN  175

Query  92   DT  87
             T
Sbjct  176  GT  177



>ref|WP_043737372.1| hypothetical protein [Synechococcus sp. RCC307]
Length=181

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 71/143 (50%), Gaps = 10/143 (7%)
 Frame = -1

Query  530  SVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIV  351
            ++L  E++E + +  +R  V   + F   + P + ++VE+Q     +  L C L+G P +
Sbjct  35   ALLSPEQLEPLGEGRYRYSVSPLQLFQLRIMPTVEIQVEQQASRLEMRSLQCNLDGVPGL  94

Query  350  VAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQV  171
               +D F  S+ + +    N        L  +A + V +  P   R +P + +ESTG  +
Sbjct  95   ---DDDFKLSLSSWLEATAN-------GLVGEAKLGVQVTQPAVLRLIPTRLLESTGESL  144

Query  170  LNQILGIMLPRFMAQLVKDYQAW  102
            LN IL  +  R   QL++D+Q+W
Sbjct  145  LNGILLTIKGRVGQQLIQDFQSW  167



>ref|WP_027840933.1| hypothetical protein [Mastigocoleus testarum]
Length=195

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 90/185 (49%), Gaps = 10/185 (5%)
 Frame = -1

Query  623  VRFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAF  447
             +F A     ++V +   P+  Y+  P    + L D +R+E++    FR  +    F + 
Sbjct  3    TKFFASESVEITVTRQAIPVEHYLRQPQRLVNALVDQKRVEQLSREVFRLKMRPLHFMSV  62

Query  446  EVCPVLLVRVEEQPDGCSINL--LSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGV  273
            ++ P + ++V  Q +G +INL  ++CK+ G   +   N +F+   +N   Y    + +GV
Sbjct  63   KIQPTVDMKVWAQSNG-TINLESIACKILGLDYI---NQRFN---LNLKGYLLPIQRNGV  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATG  93
              L  +A +EV +E+P  F   P   +E TG  +L  +L  +  R + QL+ DY +W   
Sbjct  116  TYLKGNANLEVRLELPPPFSFTPQLIMEKTGNALLKSVLMTIKQRLLNQLLNDYHSWVKS  175

Query  92   DTSRQ  78
             T  Q
Sbjct  176  QTQGQ  180



>ref|WP_014276029.1| hypothetical protein [Arthrospira platensis]
 dbj|BAI91588.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR58570.1| hypothetical protein APPUASWS_004375 [Arthrospira platensis str. 
Paraca]
Length=206

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 91/189 (48%), Gaps = 13/189 (7%)
 Frame = -1

Query  620  RFIARRKESVSVRQLQRPLMEYMSLPASQYSVL-DAERIERVDDNTFRCYVYRFKFFAFE  444
            RF A +   ++V +   P+  Y+  P    + L D  R+ER++ + FR  +    F    
Sbjct  4    RFTASQSLEIAVGEQTIPIQHYLRQPRRLVNALVDPNRLERLEADCFRLKMRPLSFMTMT  63

Query  443  VCPVLLVRVEEQPDGCSINLLS--CKLEGSPIVVAQNDKFDASMVNRIS-YDGNRRDSGV  273
            + P + ++V    +G ++ L S  C++ G   +   N +F  ++  R++ Y  N    G+
Sbjct  64   IQPTVDMKVSALANG-TVRLRSQGCEIRGIEYI---NQRFSLNLYGRLAPYKIN----GI  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWATG  93
              L   A +EV +EVP+     P   IE+TG  +L  +L  +  R M  L+ DYQ W T 
Sbjct  116  TYLRGQADLEVQVEVPYPLSLTPQPIIEATGNGLLKSVLLTIKQRLMHNLLSDYQRW-TC  174

Query  92   DTSRQPLGT  66
            + + Q + T
Sbjct  175  EVADQGMAT  183



>ref|WP_010468046.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=194

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 85/178 (48%), Gaps = 8/178 (4%)
 Frame = -1

Query  626  KVRFIARRKESVSVRQLQRPLMEYMSLPASQ-YSVLDAERIERVDDNTFRCYVYRFKFFA  450
            ++ F A     ++V +   P+  Y+  P    Y++ D  R+ER+ D+ FR  +   +F A
Sbjct  2    QLNFAASHSVLITVPEASVPIQHYLRQPRRLVYALTDRSRVERLADDCFRLTMRPREFLA  61

Query  449  FEVCPVLLVRVEEQPDGC-SINLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGV  273
                PV+ ++V  +P+G   +  + C++ G   +   N++FD ++  R+         G 
Sbjct  62   MSFQPVVDLKVWAEPNGTVHLQSVGCEIRGIEYI---NNRFDLTLNGRLYPLAT---DGP  115

Query  272  QKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQVLNQILGIMLPRFMAQLVKDYQAWA  99
             +L     + V++E+P  F   P   +E+ G ++L  I      R   QLV+DY  WA
Sbjct  116  TQLMGQGDVSVSVELPPIFWMTPQPILEAAGQRILQGIFLTFKQRLGHQLVEDYLRWA  173



>ref|XP_008663740.1| PREDICTED: uncharacterized protein LOC103642199 isoform X2 [Zea 
mays]
 tpg|DAA48049.1| TPA: hypothetical protein ZEAMMB73_345767 [Zea mays]
Length=275

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 11/133 (8%)
 Frame = -1

Query  560  EYMSLPASQYSVLDAERIER---VDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSI  390
            E++  P +  S+L+   +E        TF C + R     FEV PVL +RV      C+I
Sbjct  148  EFLRHPDAVESILNTGALESFAPAGPGTFTCALRRVGLLGFEVAPVLDLRVAPTSTDCTI  207

Query  389  NLLSCKLEGSPIVVAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEV---PFA  219
             +LSC+ EGS ++  QN+ F A M N I++  +  +     L     +EV +EV   PF+
Sbjct  208  EMLSCRFEGSEVLEQQNELFSAFMSNHITWSDDAEEPC---LDIHVKLEVTLEVYTKPFS  264

Query  218  FRALPVQAIESTG  180
               LP+ A+E  G
Sbjct  265  M--LPLSAVEKPG  275



>ref|XP_002504818.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66076.1| predicted protein [Micromonas sp. RCC299]
Length=303

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 81/177 (46%), Gaps = 24/177 (14%)
 Frame = -1

Query  575  QRPLMEYMSLPASQYSVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGC  396
             R +++Y+ LPA +Y+VLD+  + R+D  TFR      K   +E+ PV  +R+    DGC
Sbjct  102  NRGVLQYVRLPAEEYNVLDSSAVTRIDVGTFRVNAGAQKILMWEIEPVGTLRIVPTDDGC  161

Query  395  SINLLSCKL---------EGSPIVVAQNDKF-DASMVNRISYDGNRRDSGVQKLTSDAVI  246
               LL   +         + S ++ A N    D +M N +S   +  + G         I
Sbjct  162  EQILLGAVMNDVKARRTGKESVVIKAMNASLKDLTMRNAVSAVKSGSEGGT-------AI  214

Query  245  EVNIEVPFAFRALPVQAIESTGAQ----VLNQILGIMLPRFMAQLVKDYQAWATGDT  87
               I+V   F   P  A    G+Q    +L+  L  +LP F+ QL  DY  WA+G T
Sbjct  215  RCQIDVAGTFTEGPFAA---AGSQRLCAMLDWCLRSVLPWFLEQLAADYADWASGKT  268



>ref|WP_041425200.1| hypothetical protein [Synechococcus sp. CC9902]
Length=184

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 73/143 (51%), Gaps = 11/143 (8%)
 Frame = -1

Query  530  SVLDAERIERVDDNTFRCYVYRFKFFAFEVCPVLLVRVEEQPDGCSINLLSCKLEGSPIV  351
            ++LD+ ++ ++    +R  V   + F  +V PV+ +++E + D   +  + C+LEG  +V
Sbjct  42   ALLDSRQLTKIRPGHYRYLVTSLQVFQLQVKPVVSLQIETESDTLVMKAVDCELEGLGLV  101

Query  350  VAQNDKFDASMVNRISYDGNRRDSGVQKLTSDAVIEVNIEVPFAFRALPVQAIESTGAQV  171
                D F  S+ +R+  D +        L+  A + V +  P   R +P + +ESTG  +
Sbjct  102  ----DDFQLSLESRLISDEH-------GLSGHAHLSVEVSQPQLLRLIPRRVLESTGESI  150

Query  170  LNQILGIMLPRFMAQLVKDYQAW  102
            LN IL  +  R   QL+ D+Q W
Sbjct  151  LNGILIGIKARVGKQLISDFQDW  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420