BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002P10

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    325   2e-105   Populus euphratica
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   6e-105   Populus euphratica
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    322   1e-104   Populus trichocarpa [western balsam poplar]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             321   2e-104   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    321   4e-104   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             322   4e-104   
gb|KJB14201.1|  hypothetical protein B456_002G114000                    320   1e-103   Gossypium raimondii
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    320   2e-103   Gossypium arboreum [tree cotton]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    319   3e-103   Tarenaya hassleriana [spider flower]
gb|KJB57938.1|  hypothetical protein B456_009G186400                    317   3e-103   Gossypium raimondii
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    318   1e-102   Gossypium arboreum [tree cotton]
emb|CDP07271.1|  unnamed protein product                                318   1e-102   Coffea canephora [robusta coffee]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   2e-102   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    317   2e-102   
gb|KJB57936.1|  hypothetical protein B456_009G186400                    317   2e-102   Gossypium raimondii
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    317   2e-102   Glycine soja [wild soybean]
gb|ACU20783.1|  unknown                                                 317   2e-102   Glycine max [soybeans]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   2e-102   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   3e-102   Malus domestica [apple tree]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    316   5e-102   Populus euphratica
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    316   6e-102   Pyrus x bretschneideri [bai li]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   9e-102   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   1e-101   Sesamum indicum [beniseed]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   1e-101   Camelina sativa [gold-of-pleasure]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              315   2e-101   Pyrus x bretschneideri [bai li]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         315   2e-101   Jatropha curcas
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   2e-101   Nicotiana sylvestris
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   2e-101   Nicotiana tomentosiformis
ref|NP_001240080.1|  uncharacterized protein LOC100806482               314   3e-101   Glycine max [soybeans]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    314   3e-101   Glycine max [soybeans]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    313   4e-101   Pyrus x bretschneideri [bai li]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   5e-101   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   5e-101   Nicotiana tomentosiformis
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   5e-101   Prunus mume [ume]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    313   6e-101   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      311   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   8e-101   Citrus sinensis [apfelsine]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   8e-101   Elaeis guineensis
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            312   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    313   1e-100   Ricinus communis
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             312   1e-100   Capsella rubella
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              312   2e-100   Scoparia dulcis [escobilla]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             312   2e-100   Citrus clementina [clementine]
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              307   2e-100   Medicago truncatula
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    312   2e-100   Fragaria vesca subsp. vesca
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    311   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     311   2e-100   Vitis vinifera
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    311   3e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    311   3e-100   Vitis vinifera
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             311   3e-100   Phaseolus vulgaris [French bean]
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    311   4e-100   Arabis alpina [alpine rockcress]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   5e-100   Camelina sativa [gold-of-pleasure]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             311   5e-100   Prunus persica
emb|CDY69523.1|  BnaC08g46180D                                          308   9e-100   Brassica napus [oilseed rape]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   1e-99    Brassica rapa
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           309   2e-99    Medicago truncatula
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              306   3e-99    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   3e-99    Phoenix dactylifera
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               308   4e-99    Solanum tuberosum [potatoes]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             308   5e-99    Eutrema salsugineum [saltwater cress]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    308   7e-99    Pisum sativum [garden pea]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   8e-99    Solanum tuberosum [potatoes]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    307   1e-98    
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   2e-98    Solanum lycopersicum
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    309   2e-98    Cicer arietinum [garbanzo]
gb|ACJ84309.1|  unknown                                                 306   2e-98    Medicago truncatula
gb|EPS70760.1|  hypothetical protein M569_03997                         305   4e-98    Genlisea aurea
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    300   8e-98    Oryza sativa Japonica Group [Japonica rice]
emb|CAA33262.1|  unnamed protein product                                304   1e-97    Pisum sativum [garden pea]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   3e-97    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   3e-97    Cucumis melo [Oriental melon]
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   4e-97    Cucumis sativus [cucumbers]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   5e-97    
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             302   7e-97    
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             302   7e-97    Selaginella moellendorffii
dbj|BAJ86633.1|  predicted protein                                      302   7e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048847.1|  Os03g0129300                                       302   8e-97    
dbj|BAJ87214.1|  predicted protein                                      301   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    301   3e-96    Triticum urartu
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-96    
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   4e-96    Eucalyptus grandis [rose gum]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   3e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          296   5e-95    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         313   1e-94    
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    286   2e-91    Spinacia oleracea
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    288   5e-91    Spinacia oleracea
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           288   1e-90    
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       275   2e-89    Cucumis sativus [cucumbers]
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    283   3e-89    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    282   8e-89    
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               283   8e-89    Chara vulgaris
gb|ABK24645.1|  unknown                                                 280   5e-88    Picea sitchensis
gb|ACN40006.1|  unknown                                                 280   5e-88    Picea sitchensis
gb|ACN40526.1|  unknown                                                 280   7e-88    Picea sitchensis
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    270   1e-87    Ricinus communis
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      276   1e-86    Chlorokybus atmophyticus
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    263   5e-85    Agave tequilana
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               269   1e-83    Marchantia polymorpha
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      267   1e-83    Mesostigma viride
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    265   2e-83    Spinacia oleracea
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    266   6e-83    Nicotiana tabacum [American tobacco]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    262   8e-82    Mesostigma viride
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   2e-80    Setaria italica
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           258   3e-80    Bathycoccus prasinos
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             253   5e-78    Micromonas pusilla CCMP1545
ref|XP_001415434.1|  predicted protein                                  251   2e-77    Ostreococcus lucimarinus CCE9901
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         251   3e-77    Micromonas commoda
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    242   3e-77    Olea europaea
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    247   1e-75    Ostreococcus tauri
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    245   9e-75    
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    245   1e-74    Ostreococcus tauri
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    240   4e-74    Chlorokybus atmophyticus
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    235   2e-73    Sinapis alba [bai jie]
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      238   3e-73    Chlorokybus atmophyticus
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   4e-73    
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    238   5e-73    Marchantia polymorpha
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   1e-72    Camelina sativa [gold-of-pleasure]
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     236   1e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               239   1e-72    Marchantia polymorpha
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   1e-72    Camelina sativa [gold-of-pleasure]
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                234   2e-72    Mesostigma viride
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    236   2e-72 
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              238   3e-72    Medicago truncatula
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   4e-72    Brassica rapa
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             237   4e-72    Selaginella moellendorffii
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    235   4e-72    Spinacia oleracea
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    234   4e-72    Mesostigma viride
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   5e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   5e-72    Camelina sativa [gold-of-pleasure]
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                233   6e-72    Mesostigma viride
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             236   1e-71    Selaginella moellendorffii
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    229   1e-71    Monoraphidium neglectum
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   2e-71    
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    234   2e-71    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    234   2e-71    Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    234   2e-71    Spinacia oleracea
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             235   2e-71    Nicotiana benthamiana
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   2e-71    Nicotiana sylvestris
dbj|BAK02737.1|  predicted protein                                      232   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             235   2e-71    Eutrema salsugineum [saltwater cress]
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      233   3e-71    Mesostigma viride
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     233   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   3e-71    Nicotiana tomentosiformis
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             233   3e-71    
ref|XP_002892719.1|  GAPA-2                                             235   3e-71    Arabidopsis lyrata subsp. lyrata
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   3e-71    Camelina sativa [gold-of-pleasure]
gb|EPS59235.1|  hypothetical protein M569_15573                         235   3e-71    Genlisea aurea
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   3e-71    Camelina sativa [gold-of-pleasure]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        235   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    227   4e-71    Cucurbita pepo
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   4e-71    Brassica rapa
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             234   4e-71    
emb|CDY19412.1|  BnaC05g09210D                                          234   4e-71    Brassica napus [oilseed rape]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   235   4e-71    Citrus sinensis [apfelsine]
gb|KJB11770.1|  hypothetical protein B456_001G276400                    232   4e-71    Gossypium raimondii
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              233   5e-71    Brassica rapa subsp. chinensis [bok-choy]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    234   5e-71    Spinacia oleracea
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    233   7e-71    Micromonas commoda
emb|CDY16038.1|  BnaC08g40850D                                          234   8e-71    Brassica napus [oilseed rape]
emb|CDX83635.1|  BnaC07g23750D                                          233   8e-71    
emb|CDY26599.1|  BnaA09g46780D                                          234   1e-70    Brassica napus [oilseed rape]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    234   1e-70    Glycine soja [wild soybean]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    233   1e-70    Arabis alpina [alpine rockcress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             233   1e-70    Eutrema salsugineum [saltwater cress]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    233   1e-70    
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    233   1e-70    Arabis alpina [alpine rockcress]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    233   1e-70    Glycine soja [wild soybean]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Brachypodium distachyon [annual false brome]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Eucalyptus grandis [rose gum]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    233   2e-70    Brassica rapa
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-70    Brassica rapa
emb|CDY13649.1|  BnaA06g32740D                                          232   3e-70    Brassica napus [oilseed rape]
emb|CDY28536.1|  BnaC02g36240D                                          232   3e-70    Brassica napus [oilseed rape]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   3e-70    Solanum tuberosum [potatoes]
dbj|BAH57068.1|  AT1G12900                                              231   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             232   4e-70    Phaseolus vulgaris [French bean]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             231   4e-70    Micromonas pusilla CCMP1545
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    230   4e-70    Arabidopsis thaliana [mouse-ear cress]
gb|ACU21011.1|  unknown                                                 232   5e-70    Glycine max [soybeans]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    232   5e-70    Ricinus communis
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   5e-70    
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                231   5e-70    Syntrichia caninervis
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               229   6e-70    Brassica rapa subsp. chinensis [bok-choy]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      230   6e-70    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90530.1|  predicted protein                                      231   6e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   7e-70    Nelumbo nucifera [Indian lotus]
dbj|BAJ90885.1|  predicted protein                                      231   7e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         231   8e-70    Jatropha curcas
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    231   9e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                231   9e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   9e-70    
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    231   9e-70    
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   9e-70    Solanum lycopersicum
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      229   1e-69    Spirogyra sp. SAG 170.80
ref|XP_002875330.1|  gapa                                               231   1e-69    Arabidopsis lyrata subsp. lyrata
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               231   1e-69    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   1e-69    Oryza brachyantha
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   1e-69    
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              230   1e-69    Volvox carteri f. nagariensis
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          229   2e-69    Chlamydomonas sp. W80
ref|XP_001771209.1|  predicted protein                                  230   2e-69    
dbj|BAJ34149.1|  unnamed protein product                                230   3e-69    Eutrema halophilum
gb|KJB11771.1|  hypothetical protein B456_001G276400                    230   3e-69    Gossypium raimondii
gb|KJB70724.1|  hypothetical protein B456_011G088800                    227   3e-69    Gossypium raimondii
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             229   4e-69    Capsella rubella
ref|XP_001771246.1|  predicted protein                                  229   4e-69    
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               227   4e-69    Capsicum annuum
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           228   5e-69    Chlamydomonas reinhardtii
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   7e-69    Fragaria vesca subsp. vesca
ref|XP_001779769.1|  predicted protein                                  229   7e-69    
emb|CDY48981.1|  BnaA02g28150D                                          228   7e-69    Brassica napus [oilseed rape]
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    226   9e-69    Miscanthus sinensis
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   1e-68    
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    228   1e-68    
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    228   1e-68    Chlamydomonas incerta
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   1e-68    Setaria italica
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    228   1e-68    Ostreococcus tauri
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     226   1e-68    Physcomitrella patens
ref|XP_001753934.1|  predicted protein                                  228   1e-68    
ref|XP_001779753.1|  predicted protein                                  228   2e-68    
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      224   2e-68    Spermatozopsis similis
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     227   2e-68    Physcomitrella patens
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                228   2e-68    Arachis hypogaea [goober]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           227   3e-68    Bathycoccus prasinos
emb|CAA30152.1|  GADPH (383 AA)                                         227   3e-68    Zea mays [maize]
ref|XP_001766703.1|  predicted protein                                  226   3e-68    
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         227   3e-68    
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    227   3e-68    Zea mays [maize]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   4e-68    Pyrus x bretschneideri [bai li]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    227   5e-68    Theobroma cacao [chocolate]
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    226   6e-68    Marchantia polymorpha
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   7e-68    Malus domestica [apple tree]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   8e-68    Pyrus x bretschneideri [bai li]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             226   8e-68    Prunus persica
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   9e-68    Malus domestica [apple tree]
ref|NP_001052984.1|  Os04g0459500                                       226   1e-67    
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   1e-67    Prunus mume [ume]
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    226   1e-67    Botryococcus braunii
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    225   3e-67    Auxenochlorella protothecoides
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         224   3e-67    Morus notabilis
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      224   3e-67    Cladophora rupestris
gb|KJB70723.1|  hypothetical protein B456_011G088800                    225   3e-67    Gossypium raimondii
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      222   4e-67    Chlorella sp. JP-2005
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                224   6e-67    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   7e-67    Cicer arietinum [garbanzo]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         223   9e-67    Medicago truncatula
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       223   9e-67    Medicago sativa [alfalfa]
emb|CAA33264.1|  unnamed protein product                                223   1e-66    Pisum sativum [garden pea]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    223   2e-66    Pyrus x bretschneideri [bai li]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    223   2e-66    Pisum sativum [garden pea]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                222   2e-66    Vicia sativa [spring vetch]
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    221   5e-66    Ostreococcus sp. 'lucimarinus'
ref|XP_001420043.1|  predicted protein                                  220   5e-66    Ostreococcus lucimarinus CCE9901
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              221   6e-66    Phaseolus vulgaris [French bean]
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                215   8e-66    Helianthus annuus
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      221   9e-66    Scherffelia dubia
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                214   9e-66    Helianthus annuus
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-65    Tarenaya hassleriana [spider flower]
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                214   2e-65    Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                214   2e-65    Helianthus annuus
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               217   3e-65    Coleochaete scutata
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    216   2e-64    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    216   2e-64    Gossypium arboreum [tree cotton]
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                212   2e-64    Helianthus annuus
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          217   2e-64    Amborella trichopoda
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   214   3e-64    Citrus sinensis [apfelsine]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               214   5e-64    Sphagnum cuspidatum
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    214   6e-64    Chamaesiphon minutus
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   7e-64    Tarenaya hassleriana [spider flower]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              216   8e-64    Scoparia dulcis [escobilla]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    215   1e-63    Sesamum indicum [beniseed]
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     207   2e-63    Arabidopsis thaliana [mouse-ear cress]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                213   2e-63    Lilium regale
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                216   3e-63    
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   5e-63    
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                214   6e-63    
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    212   6e-63    
dbj|BAK05515.1|  predicted protein                                      205   7e-63    
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      213   9e-63    
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           213   9e-63    
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  213   1e-62    
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   1e-62    
gb|ACN39951.1|  unknown                                                 211   1e-62    
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                212   1e-62    
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   1e-62    
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   1e-62    
gb|ABK25233.1|  unknown                                                 213   2e-62    
gb|ACN40537.1|  unknown                                                 213   2e-62    
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    212   2e-62    
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   2e-62    
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             212   2e-62    
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    208   2e-62    
gb|ABK96233.1|  unknown                                                 212   3e-62    
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             212   3e-62    
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               209   3e-62    
gb|ABK96725.1|  unknown                                                 211   4e-62    
gb|ABK94956.1|  unknown                                                 211   6e-62    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        207   7e-62    
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    212   9e-62    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           209   9e-62    
gb|ACN40000.1|  unknown                                                 211   1e-61    
gb|ABK24313.1|  unknown                                                 211   1e-61    
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                203   1e-61    
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             210   1e-61    
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      207   1e-61    
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    210   2e-61    
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             209   2e-61    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           207   3e-61    
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   3e-61    
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   3e-61    
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   3e-61    
emb|CAN78872.1|  hypothetical protein VITISV_021726                     209   3e-61    
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   4e-61    
gb|AGJ50596.1|  GAPDH                                                   209   4e-61    
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   4e-61    
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   4e-61    
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   5e-61    
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                206   7e-61    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           206   8e-61    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         206   8e-61    
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    207   1e-60    
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                200   1e-60    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    206   1e-60    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         205   2e-60    
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    206   4e-60    
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    206   5e-60    
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    205   5e-60    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           204   7e-60    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    204   8e-60    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           204   8e-60    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    204   8e-60    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    201   9e-60    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    203   1e-59    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    203   1e-59    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              202   1e-59    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           203   1e-59    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           203   1e-59    
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    205   2e-59    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    203   2e-59    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           203   2e-59    
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           202   2e-59    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           202   2e-59    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           202   2e-59    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           202   2e-59    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           202   3e-59    
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               201   3e-59    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           202   3e-59    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           202   4e-59    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           202   4e-59    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    202   4e-59    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    202   4e-59    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    202   4e-59    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           201   5e-59    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           201   5e-59    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           201   5e-59    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           201   6e-59    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           201   6e-59    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                201   6e-59    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           201   6e-59    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           201   7e-59    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           201   8e-59    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           201   8e-59    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           201   8e-59    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           201   8e-59    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             201   9e-59    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         201   9e-59    
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   203   9e-59    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    201   1e-58    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    201   1e-58    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        201   1e-58    
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             201   1e-58    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    200   1e-58    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    200   1e-58    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           200   1e-58    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             201   2e-58    
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    201   2e-58    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             201   2e-58    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    200   2e-58    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           200   2e-58    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           199   3e-58    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           199   3e-58    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           199   3e-58    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           199   4e-58    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           199   4e-58    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    199   4e-58    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           199   4e-58    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           199   5e-58    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           199   5e-58    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        199   5e-58    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           199   5e-58    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    199   5e-58    
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                199   6e-58    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           198   7e-58    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           198   8e-58    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    198   8e-58    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    198   8e-58    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           198   9e-58    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    200   9e-58    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    198   1e-57    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                198   1e-57    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           198   1e-57    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    198   1e-57    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    198   1e-57    
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit      191   2e-57    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    197   2e-57    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    197   2e-57    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    197   2e-57    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           197   2e-57    
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase                192   2e-57    
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           197   3e-57    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           197   3e-57    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    196   3e-57    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           197   3e-57    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           197   3e-57    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    197   3e-57    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           196   4e-57    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    196   5e-57    
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase      192   5e-57    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           196   6e-57    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           196   6e-57    
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   199   6e-57    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           196   6e-57    
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        197   7e-57    
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               195   7e-57    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           196   8e-57    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           196   8e-57    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    196   8e-57    
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase                190   8e-57    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    196   8e-57    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               196   9e-57    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           197   1e-56    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    197   1e-56    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           195   1e-56    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    195   2e-56    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    194   2e-56    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           194   2e-56    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        194   2e-56    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    194   3e-56    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    194   3e-56    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    196   3e-56    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    194   4e-56    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           194   5e-56    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        194   6e-56    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           193   8e-56    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           194   8e-56    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    193   1e-55    
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               191   1e-55    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           193   1e-55    
ref|WP_007133015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    192   2e-55    
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               189   3e-55    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           192   3e-55    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           191   4e-55    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           191   4e-55    
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                194   4e-55    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    191   5e-55    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    191   5e-55    
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           191   6e-55    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    191   6e-55    
dbj|GAK42869.1|  glyceraldehyde-3-phosphate dehydrogenase               191   8e-55    
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase                185   9e-55    
emb|CDP18560.1|  unnamed protein product                                192   9e-55    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                190   1e-54    
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           190   1e-54    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           190   1e-54    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                189   1e-54    
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase      191   1e-54    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           190   2e-54    
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    184   2e-54    
ref|WP_016423763.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    189   2e-54    
ref|WP_009593640.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    189   2e-54    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    189   4e-54    
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    188   7e-54    
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    187   1e-53    
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           187   1e-53    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    187   2e-53    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           187   2e-53    
ref|WP_036655810.1|  glyceraldehyde-3-phosphate dehydrogenase           187   2e-53    
ref|WP_038262010.1|  glyceraldehyde-3-phosphate dehydrogenase [         187   3e-53    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                187   3e-53    
gb|ADB81482.1|  glyceraldehyde-3-phosphate dehydrogenase                181   3e-53    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           186   4e-53    
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    186   4e-53    
ref|WP_010272964.1|  glyceraldehyde-3-phosphate dehydrogenase           186   4e-53    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           187   5e-53    
ref|WP_012818436.1|  glyceraldehyde-3-phosphate dehydrogenase           186   5e-53    
ref|WP_006207583.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    186   6e-53    
ref|WP_042118357.1|  glyceraldehyde-3-phosphate dehydrogenase           185   8e-53    
gb|AHD04124.1|  glyceraldehyde-3-phosphate dehydrogenase Gap            185   9e-53    



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/209 (93%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  213  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  272

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDV
Sbjct  273  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDV  332

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  333  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWP  392

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  393  GVAAAGSGDPLEDFCKTNPADEECKVYEA  421



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   321 bits (823),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             V  AGS DPLED+CKTNP D+ECKV+EA
Sbjct  424  GVPAAGSADPLEDFCKTNPADEECKVYEA  452



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 193/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  266  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  325

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDV
Sbjct  326  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDV  385

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDL HLVASKWP
Sbjct  386  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLGHLVASKWP  445

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  446  GVAAAGSGDPLEDFCKTNPADEECKVYEA  474



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  246  LAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  305

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRK+++GPLKGVL+V
Sbjct  306  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSAEGPLKGVLEV  365

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  366  CDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  425

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             + VAGSGDPLEDYCKTNP D+ECKV+EA
Sbjct  426  GMPVAGSGDPLEDYCKTNPADEECKVYEA  454



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  246  LAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  305

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVL+V
Sbjct  306  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLEV  365

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  366  CDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  425

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             + VAGSGDPLEDYCK NP D+ECKV+EA
Sbjct  426  GMPVAGSGDPLEDYCKANPADEECKVYEA  454



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+ GPL G+LDV
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAASGPLNGILDV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  365  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A   SGDPLED+C+TNP DKECKVFEA
Sbjct  425  GAAAGSSGDPLEDFCETNPADKECKVFEA  453



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  191  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  250

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+ GPLKGVLDV
Sbjct  251  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDV  310

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  311  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  370

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             +   GS DPLED+CKTNP D+ECKV+EA
Sbjct  371  GMPAGGSSDPLEDFCKTNPADEECKVYEA  399



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  247  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  306

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDV
Sbjct  307  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDV  366

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  367  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  426

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             +   GS DPLED+CKTNP D+ECKV+EA
Sbjct  427  GMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 190/209 (91%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  250  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  309

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFRKA+DGPLKG+LDV
Sbjct  310  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFRKAADGPLKGILDV  369

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDF+C+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  370  CDAPLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  429

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             + + GSGDPLEDYCKTN  D+ECKV+EA
Sbjct  430  GLFIDGSGDPLEDYCKTNAADEECKVYEA  458



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDV
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  363  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  423  GVAAPGSGDPLDEFCETNPSDEECKVYE  450



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  424  GAAKAGSGDPLEEFCETNPADEECKVYE  451



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  247  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  306

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+ GPLKGVLDV
Sbjct  307  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDV  366

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  367  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  426

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             +   GS DPLED+CKTNP D+ECKV+EA
Sbjct  427  GMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  365  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  425  GAAKAGSGDPLEEFCETNPADEECKVYE  452



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  365  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  425  GTAKAGSGDPLEEFCETNPADEECKVYE  452



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  246  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  305

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  306  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  365

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  366  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  425

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  426  GAAKAGSGDPLEEFCETNPADEECKVYE  453



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              AVAGSGDPLED+C+TNP D+ECKV+EA
Sbjct  424  GAAVAGSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 200/209 (96%), Gaps = 2/209 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGY  RVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGY--RVVDLAHLVASKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  422  GVAAAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GTAQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDV
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  363  CDAPLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  423  GVAAPGSGDPLDEFCETNPSDEECKVYE  450



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPL GVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLAGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                 GSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GATAEGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  360  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 G+GDPLED+C+TNPGD+ECKVFE
Sbjct  420  GEKAVGTGDPLEDFCQTNPGDEECKVFE  447



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              AV GSGDPLED+C+TNP D+ECKV+EA
Sbjct  424  GAAVVGSGDPLEDFCQTNPADEECKVYEA  452



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANEWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA  GSGDPLE++C+ NP D+ECKV+EA
Sbjct  424  GVAATGSGDPLEEFCEKNPADEECKVYEA  452



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L V
Sbjct  304  SLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A +GSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GAAASGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  242  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  301

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFRKA+DGPL G+L V
Sbjct  302  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAADGPLNGILAV  361

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  362  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              +V GSGD LEDYCKTNP DKECKV+E
Sbjct  422  GSSVEGSGDALEDYCKTNPADKECKVYE  449



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  242  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  301

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFRKA+DGPL G+L V
Sbjct  302  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAADGPLNGILAV  361

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  362  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              +V GSGD LEDYCKTNP DKECKV+E
Sbjct  422  GSSVEGSGDSLEDYCKTNPADKECKVYE  449



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+C+TNP D+ECKV+E
Sbjct  424  GAPKAGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 188/208 (90%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDV
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  365  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+C+TNP D+ECKV+E
Sbjct  425  GAPKAGSGDPLEDFCETNPADEECKVYE  452



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GAAEVGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  242  LAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  301

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  302  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAV  361

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  362  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  422  GVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  242  LAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  301

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  302  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAV  361

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  362  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  422  GVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA++GPL+G+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              + AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  GTSQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   313 bits (802),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  360  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+CKTNP D+ECKV+E
Sbjct  420  GEEAVGSGDPLEDFCKTNPADEECKVYE  447



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  195  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  254

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  255  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  314

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  315  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  374

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+CKTNP D+ECKV++
Sbjct  375  GAEAVGSGDPLEDFCKTNPADEECKVYD  402



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L V
Sbjct  305  SLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  365  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  425  GVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKG+LDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAANGPLKGILDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             + V GSGDPLED+CKT+P  +ECKV+EA
Sbjct  424  GMPVQGSGDPLEDFCKTSPATEECKVYEA  452



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  360  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+CKTNP D+ECKV++
Sbjct  420  GAEAVGSGDPLEDFCKTNPADEECKVYD  447



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 191/215 (89%), Positives = 200/215 (93%), Gaps = 6/215 (3%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGD------QrlldashrdlrraraaaLNIVPTST  553
            L   VKVMDEEFGIVKGTMTTTHSYTGD      QRLLDASHRDLRRARAAALNIVPTST
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDXSYTGDQRLLDASHRDLRRARAAALNIVPTST  303

Query  552  GAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPL  373
            GAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPL
Sbjct  304  GAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPL  363

Query  372  KGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHL  193
            KG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHL
Sbjct  364  KGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHL  423

Query  192  VASKWPVVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
            VA+KWP  + AGSGD LED+C+TNP DKECKVFE+
Sbjct  424  VAAKWPGASAAGSGDALEDFCETNPADKECKVFES  458



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFRKA++GP+KG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFRKAANGPMKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  360  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNPG++ECKVFE
Sbjct  420  GEKAVGSGDPLEDFCQTNPGEEECKVFE  447



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFRKA++GPL GVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFRKAANGPLAGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMV+GDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVLGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
               V+GSGDPLED+CKTNP D+ECKV+E
Sbjct  424  GATVSGSGDPLEDFCKTNPADEECKVYE  451



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKG +TTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKVMDEELGIVKGAITTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L V
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  365  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             VA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  425  GVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  110  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  169

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  170  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDV  229

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  230  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  289

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+C+TNP   ECKVFE
Sbjct  290  GTPQAGSGDPLEDFCETNPSTDECKVFE  317



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
               V GSGDPLED+CK NP D+ECKV+EA
Sbjct  424  GTPVEGSGDPLEDFCKDNPADEECKVYEA  452



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  239  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  298

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA+ GPLKG+L V
Sbjct  299  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAV  358

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  359  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  418

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             V   GSGDPLED+C+TNP  KECKV+EA
Sbjct  419  GVPAQGSGDPLEDFCQTNPETKECKVYEA  447



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+L V
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  365  CDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  425  GFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  241  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  300

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA+ GPLKG+L V
Sbjct  301  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAV  360

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  361  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  420

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             V   GSGDPLED+C+TNP  KECKV+EA
Sbjct  421  GVPAQGSGDPLEDFCQTNPETKECKVYEA  449



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+L V
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  365  CDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  424

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  425  GFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFRKA++GPLKGVLDV
Sbjct  304  SLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLE++C+TNP D+ECKV+E
Sbjct  424  GTPKAGSGDPLEEFCETNPADEECKVYE  451



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   311 bits (796),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GP+KG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPMKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  360  CDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  420  GEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  195  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  254

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  255  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  314

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  315  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  374

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNP ++ECKV+E
Sbjct  375  GEKAVGSGDPLEDFCQTNPANEECKVYE  402



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  238  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  297

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDV
Sbjct  298  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDV  357

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  358  CDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  417

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNP ++ECKV+E
Sbjct  418  GEKAVGSGDPLEDFCQTNPANEECKVYE  445



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   311 bits (796),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA++GPL+G+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                AGSGDPLE++CKTNP D+ECKV+EA
Sbjct  424  GTPQAGSGDPLEEFCKTNPADEECKVYEA  452



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  194  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  253

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+V
Sbjct  254  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEV  313

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  314  CDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  373

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  374  GEVAAGSGDPLEDFCKTNPADEECKVYEA  402



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+V
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  360  CDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  420  GEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+C+TNP   ECKVFE
Sbjct  424  GTPQAGSGDPLEDFCETNPSTDECKVFE  451



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  160  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  219

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+V
Sbjct  220  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEV  279

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  280  CDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  339

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+CKTNP D+ECKV+E
Sbjct  340  GEVAAGSGDPLEDFCKTNPADEECKVYE  367



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             + V GSGDPLED+C+T+P  +ECKV+EA
Sbjct  424  GMPVQGSGDPLEDFCQTSPDTEECKVYEA  452



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFRKA+DGPL G+L V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAADGPLNGILAV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  363  CDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A  GSGD LEDYCKTNP DKECKV+E
Sbjct  423  GSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFRKA+DGPLKGVL V
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFRKAADGPLKGVLAV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  360  CDIPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+CKTNP D+ECKV+E
Sbjct  420  GEVAAGSGDPLEDFCKTNPADEECKVYE  447



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   308 bits (788),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKG+LDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  364  CDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNP D+ECKV+E
Sbjct  424  GTPKVGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPL G+L V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLNGILAV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  363  CDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A  GSGD LEDYCKTNP DKECKV+E
Sbjct  423  GSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 197/209 (94%), Gaps = 2/209 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  RVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY--RVVDLAHLVASKWP  421

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  422  GTAQAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA+DGPL G+L V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAADGPLNGILAV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  363  CDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              A  GSGD LEDYCKTNP DKECKV+E
Sbjct  423  GSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  318  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  377

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  378  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAAEGPLKGVLDV  437

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  438  CDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  497

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNP D ECKV+E
Sbjct  498  GTPQKGSGDPLEDFCETNPADDECKVYE  525



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEW YSQRVVDLAHLVA+KWP
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVVDLAHLVANKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                AGSGDPLED+C+TNP   ECKVFE
Sbjct  424  GTPQAGSGDPLEDFCETNPSTDECKVFE  451



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  232  LAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  291

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFRKA++GPLKGVLDV
Sbjct  292  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAAEGPLKGVLDV  351

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CDAPLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  352  CDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  411

Query  174  VVAVA-GSGDPLEDYCKTNPGDKECKVFE  91
                A GSGDPLEDYCKT+P D+ECKV+E
Sbjct  412  GATPAEGSGDPLEDYCKTSPADEECKVYE  440



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GP  GVL V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGMTAEDVNDAFRKAANGPSNGVLAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  364  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             +   GSGDPLED+C+TNP  KECKV+E
Sbjct  424  GIPAQGSGDPLEDFCQTNPETKECKVYE  451



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  110  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  169

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDV
Sbjct  170  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDV  229

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  230  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  289

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              AV GSGDPLED+CK NP   ECKV+E
Sbjct  290  GAAVQGSGDPLEDFCKDNPETDECKVYE  317



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  240  LAPFAKVLDEESGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  299

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKG+LDV
Sbjct  300  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDV  359

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  360  CDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  419

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLED+C+TNP D+ECKV+E
Sbjct  420  GTPKVGSGDPLEDFCETNPADEECKVYE  447



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  364  CDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWP  423

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                  SGDPLED+C+TNP D+ECKV+EA
Sbjct  424  GAGSGKSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  363  CDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                  SGDPLED+C+TNP D+ECKV+EA
Sbjct  423  GAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  363  CDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWP  422

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                  SGDPLED+C+TNP D+ECKV+EA
Sbjct  423  GAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDV
Sbjct  296  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAASGPLNGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  356  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VA  GSGDPLED+CK NP   ECKV+E
Sbjct  416  GVAAQGSGDPLEDFCKDNPETDECKVYE  443



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKG+L V
Sbjct  283  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAADGPLKGILAV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  343  CDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAEKWP  402

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A A SGDPL+++CKTNP   ECKV++A
Sbjct  403  GGAPAPSGDPLDEFCKTNPDTDECKVYDA  431



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKG+L V
Sbjct  283  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAADGPLKGILAV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  343  CDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWP  402

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A A SGDPL+++CKTNP   EC+V++A
Sbjct  403  GGAAAPSGDPLDEFCKTNPDTDECRVYDA  431



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  236  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAELNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDV
Sbjct  296  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  356  CDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLEDYCKT+P   ECKVF+
Sbjct  416  GAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDV
Sbjct  296  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  356  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
              AV GSGDPLED+CK NP   ECKV+E
Sbjct  416  GAAVQGSGDPLEDFCKDNPETDECKVYE  443



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDV
Sbjct  296  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  356  CDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLEDYCKT+P   ECKVF+
Sbjct  416  GAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDV
Sbjct  296  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  356  CDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 GSGDPLEDYCKT+P   ECKVF+
Sbjct  416  GAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  239  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  298

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDV
Sbjct  299  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAAAGPLNGILDV  358

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  359  CDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  418

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
               V G+GDPLEDYCKTNP   ECKV++
Sbjct  419  GSEVKGTGDPLEDYCKTNPETDECKVYD  446



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR A++GPLKG+L V
Sbjct  305  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAAEGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSL+MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  365  CDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVKWP  424

Query  174  VVAVAGS-GDPLEDYCKTNPGDKECKVFE  91
             + + GS GDPLED+CK NP D+ECKV+E
Sbjct  425  GIEIPGSTGDPLEDFCKKNPADEECKVYE  453



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 195/209 (93%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK+MDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFRKA+ GP KGVL+V
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKAAAGPSKGVLEV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  363  CDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWP  422

Query  174  VVAVA-GSGDPLEDYCKTNPGDKECKVFE  91
             +  A  SGDPLED+CK NP D+ECKV+E
Sbjct  423  GMEGAISSGDPLEDFCKDNPADEECKVYE  451



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  206  LAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  265

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRK+++GPLKG+L V
Sbjct  266  SLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSAEGPLKGILAV  325

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW 
Sbjct  326  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWS  385

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A +G GDPLE++C+T+P   ECKV+EA
Sbjct  386  GAAKSG-GDPLEEFCQTSPETVECKVYEA  413



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   313 bits (802),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/215 (87%), Positives = 198/215 (92%), Gaps = 0/215 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  247  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  306

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK ++GPLKG+LDV
Sbjct  307  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKEAEGPLKGILDV  366

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP
Sbjct  367  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  426

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA*FTTNF  70
                 GSGDPLED+CKTNP D+ECK+  A F   F
Sbjct  427  GSGTGGSGDPLEDFCKTNPADEECKIVIASFIGCF  461



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  160  LAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  219

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+ GPLKGVLDV
Sbjct  220  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDV  279

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWP
Sbjct  280  CDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWP  339

Query  174  -VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             +     SGDPLED+CK NP D+ECK++E
Sbjct  340  GLEGSVASGDPLEDFCKDNPADEECKLYE  368



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  243  LAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  302

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+ GPLKGVLDV
Sbjct  303  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDV  362

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWP
Sbjct  363  CDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWP  422

Query  174  -VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             +     SGDPLED+CK NP D+ECK++E
Sbjct  423  GLEGSVASGDPLEDFCKDNPADEECKLYE  451



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   288 bits (737),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 196/247 (79%), Gaps = 39/247 (16%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG-----------------  226
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWG                 
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGAHFVWAFSLMFLFSGRG  423

Query  225  ----------------------YSQRVVDLAHLVASKWPVVAVAGSGDPLEDYCKTNPGD  112
                                  ++QRVVDLAHLVA+KWP    AGSGDPLED+C+TNP  
Sbjct  424  YWQELIESIVWAHNKLKYKVCFHNQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPST  483

Query  111  KECKVFE  91
             ECKVFE
Sbjct  484  DECKVFE  490



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -1

Query  660  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRv  481
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  60

Query  480  ptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSST  301
            PTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSST
Sbjct  61   PTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSST  120

Query  300  IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPVVAVAGSGDPLEDYCKTN  121
            IDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWP      SGDPLED+C+TN
Sbjct  121  IDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAGSGKSGDPLEDFCQTN  180

Query  120  PGDKECKVFEA  88
            P D+ECKV+EA
Sbjct  181  PADEECKVYEA  191



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDV
Sbjct  296  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  356  CDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  415

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 G G   EDYCKT+P   ECKVF+
Sbjct  416  GAGTGGGG--GEDYCKTDPNAVECKVFD  441



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   282 bits (721),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  241  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  300

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL+G+L+V
Sbjct  301  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLQGILEV  360

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVS TID+SL+MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  361  CDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  420

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
              A AGSGDPLED+CK NP   ECKV+EA
Sbjct  421  GAAAAGSGDPLEDFCKDNPETDECKVYEA  449



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 190/211 (90%), Gaps = 3/211 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  270  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  329

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFRKA++GPLKGVL V
Sbjct  330  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFRKAANGPLKGVLAV  389

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  390  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  449

Query  174  VVAVAGSG---DPLEDYCKTNPGDKECKVFE  91
                A  G   DPL  YC++NP D EC+VFE
Sbjct  450  GAKPAPDGKDADPLGTYCESNPDDAECRVFE  480



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  252  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  311

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L V
Sbjct  312  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAV  371

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  372  CDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  431

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                 GS DPL+++CKTNP   EC+V+EA
Sbjct  432  GAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  252  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  311

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L V
Sbjct  312  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAV  371

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  372  CDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  431

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                 GS DPL+++CKTNP   EC+V+EA
Sbjct  432  GAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  252  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  311

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L V
Sbjct  312  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAV  371

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWP
Sbjct  372  CDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  431

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
                 GS DPL+++CKTNP   EC+V+EA
Sbjct  432  GAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -1

Query  573  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  394
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  32   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91

Query  393  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  214
            KA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  92   KAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  151

Query  213  VVDLAHLVASKWPVVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
            VVDLAHLVA+KWP  + AGSGD LED+C+TNP DKECKVFE+
Sbjct  152  VVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  193



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 188/211 (89%), Gaps = 3/211 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  247  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  306

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+ VNAAFRKA++GPL GVL V
Sbjct  307  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFRKAAEGPLNGVLAV  366

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVS+DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAH+VA+ WP
Sbjct  367  SDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHIVANNWP  426

Query  174  ---VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                 +   SGDPL+ YC TNP   EC+V++
Sbjct  427  GQKADSEEESGDPLDKYCATNPEADECRVYD  457



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -1

Query  573  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  394
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  11   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70

Query  393  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  214
            KA++GPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  71   KAANGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  130

Query  213  VVDLAHLVASKWPVVAVAGSGDPLEDYCKTNPGDKECKVFEA*F  82
            VVDLAHLVASKWP +   GS DPLED+CKTNP  +ECKV+EA F
Sbjct  131  VVDLAHLVASKWPGMPAQGSSDPLEDFCKTNPETEECKVYEAGF  174



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 192/208 (92%), Gaps = 1/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  250  LAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  309

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A++GPLKG+L V
Sbjct  310  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGILAV  369

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WP
Sbjct  370  CDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAQWP  429

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             VA   SGDPLE++C TNP   EC++ +
Sbjct  430  GVAKP-SGDPLEEFCVTNPDTDECRLHD  456



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  207  LAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  266

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK ++G +KG+L V
Sbjct  267  SLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAV  326

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ WP
Sbjct  327  SDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWP  386

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             +      DPLE +C TNP   EC+V+ 
Sbjct  387  GMVQETGSDPLETFCNTNPDADECRVYN  414



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 185/209 (89%), Gaps = 2/209 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW 
Sbjct  277  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336

Query  174  -VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
             +     SGDPLED+CK NP D+ECK++E
Sbjct  337  GLEGSVASGDPLEDFCKDNPADEECKLYE  365



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 169/180 (94%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  213  LAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  272

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  273  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAV  332

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+ WP
Sbjct  333  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANNWP  392



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA NIVPTSTGAAKAV
Sbjct  179  LAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAAFNIVPTSTGAAKAV  238

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK ++G +KG+L V
Sbjct  239  SLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAV  298

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWY NEWGYSQRVVDLA +VA+ WP
Sbjct  299  SDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQRVVDLADIVANNWP  358

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKV  97
             +      DPLE +C TNP   EC+V
Sbjct  359  GMVQETGSDPLETFCNTNPDADECRV  384



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  236  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  295

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFRKA+ GPLKGVL V
Sbjct  296  ALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFRKAAAGPLKGVLQV  355

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV-ASKW  178
            CD PLVSVDFRCSDVSS+IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV A   
Sbjct  356  CDEPLVSVDFRCSDVSSSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWP  415

Query  177  PVVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
               A  GSGDPLED+CK NP   ECKV+EA
Sbjct  416  GAAAAGGSGDPLEDFCKDNPETDECKVYEA  445



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  199  LAPFAKVLDESFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  258

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAFR+A +GP+KGVL +
Sbjct  259  ALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGITAEEVNAAFREAQNGPMKGVLAI  318

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL  +VA K  
Sbjct  319  TDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTLIVA-KAL  377

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
            V  V    DP++  C ++PG +ECKVF+
Sbjct  378  VTGVENFSDPMDALCASDPGAEECKVFD  405



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKGTMTT HSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  199  LAPFAKVLDDKFGIVKGTMTTCHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  258

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++AS+GP+KG+L +
Sbjct  259  ALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEASEGPMKGILAI  318

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA+   
Sbjct  319  TETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAAGLI  378

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
                   GDP++ +C  +P  +ECKVF+
Sbjct  379  EGGEVTVGDPMDAFCADDPSAEECKVFD  406



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  200  LAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  259

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAE+VNAAF++A DGP+KGVL +
Sbjct  260  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEEVNAAFKEAQDGPMKGVLAI  319

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL+ +VA+   
Sbjct  320  TDVPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLSLIVANGLI  379

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
               VA S DP++  C  +P   ECKVF+
Sbjct  380  NEGVA-SADPMDQLCADDPSADECKVFD  406



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE+FGI+KGTMTT HSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  199  LAPFAKVLDEKFGIIKGTMTTCHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  258

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLV NV+KKG+TAE+VNAAF++A+DGP+KGVL +
Sbjct  259  ALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFKEAADGPMKGVLAI  318

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA K  
Sbjct  319  TETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVA-KGL  377

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFE  91
            +     S DP++  C  +P  +ECKVF+
Sbjct  378  IEGGDVSADPMDALCADDPSAEECKVFD  405



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -1

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFRKAADGPLKGVLAV  60

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
            CD PLVSVDFRC+DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  61   CDVPLVSVDFRCTDVSATIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWP  120

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
             +A   SGDPLED+CKTNP D+ECKV+EA
Sbjct  121  GMAAQESGDPLEDFCKTNPADEECKVYEA  149



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  200  LAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  259

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL +
Sbjct  260  ALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAI  319

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL  +VA+   
Sbjct  320  TDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSL-  378

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
            +   + + DPL+  C  +P   ECKVF++
Sbjct  379  INEGSVTLDPLDQLCSDDPSADECKVFDS  407



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL +
Sbjct  287  ALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAI  346

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+   
Sbjct  347  TDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSL-  405

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
            +   + + DPL+  C  +P   ECKVF++
Sbjct  406  INEGSVTLDPLDQLCSDDPSADECKVFDS  434



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  232  LAPFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  291

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL +
Sbjct  292  ALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAI  351

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  175
             D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+   
Sbjct  352  TDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSL-  410

Query  174  VVAVAGSGDPLEDYCKTNPGDKECKVFEA  88
            +   + + DPL+  C  +P   ECKVF++
Sbjct  411  INEGSVTLDPLDQLCSDDPSADECKVFDS  439



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  135  LAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  194

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A++GPLKG+L V
Sbjct  195  ALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREAANGPLKGILAV  253

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  254  CDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  312



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  55   LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  114

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  115  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  173

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  174  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  232



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  157  LAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  216

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A++GPLKG+L V
Sbjct  217  ALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREAANGPLKGILAV  275

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  276  CDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  334



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  258  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  179  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  238

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A++G +KG+L V
Sbjct  239  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAANGDMKGILAV  297

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  298  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  356



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  258  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  258  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A++G +KG+L V
Sbjct  280  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAANGDMKGILAV  338

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  339  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  397



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  258  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  108  LAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  167

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL V
Sbjct  168  ALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAV  226

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  181
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  227  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  284



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  218  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  277  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDV
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  223
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  258  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  316



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A+D  L G+L V
Sbjct  284  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAADKALNGILAV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  343  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  156  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  215

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  216  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADQELKGILSV  274

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  275  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  333



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   234 bits (598),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  134  LAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  193

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL V
Sbjct  194  ALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAV  252

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  181
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  253  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  310



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  258  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  139  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  198

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  199  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  257

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  258  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 167/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  108  LAPFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  167

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL V
Sbjct  168  ALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAV  226

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  181
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A++
Sbjct  227  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMANQ  284



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  L G+L V
Sbjct  284  ALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKALNGILAV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  343  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>gb|KIY93372.1| NADP-dependent glyceraldehydephosphatedehydrogenase subunit A 
[Monoraphidium neglectum]
Length=176

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  705  LVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLV  526
            ++ V+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+LV
Sbjct  1    MLFVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALV  60

Query  525  LPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDA  346
            LP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR+A+ GP+ GVL V D 
Sbjct  61   LPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAAFREAAAGPMAGVLAVADE  119

Query  345  PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            PLVSVDFRC+DVS++IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA L A KW
Sbjct  120  PLVSVDFRCTDVSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQKW  175



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  244  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  303

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L V
Sbjct  304  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAV  363

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  223
            CD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  364  CDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  277  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  277  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  277  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDV
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAADKELKGILDV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDV
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAADKELKGILDV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  128  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  187

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDV
Sbjct  188  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDV  246

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  247  CDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  305



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  155  LAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  214

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL V
Sbjct  215  ALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAV  273

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  181
            CD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  274  CDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  331



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  290

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  291  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDV
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAADKELKGILDV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  290

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  291  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  217  LAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  276

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  LKG+L V
Sbjct  277  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKELKGILSV  335

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  336  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  394



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  9    LAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  68

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL V
Sbjct  69   SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAV  128

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  226
            CD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDN+WG
Sbjct  129  CDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNDWG  171



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  245  LAPFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  304

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L V
Sbjct  305  SLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAV  364

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  223
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  365  CDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  408



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  127  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  186

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L V
Sbjct  187  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSV  245

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  246  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  304



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDV  276

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  277  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  335



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  342  CDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D++FGIVKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  198  LAPFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  257

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVD+ +  +KK  TAE++NAAFR+A++GP+KG+L V
Sbjct  258  ALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKK-CTAEEINAAFREAAEGPMKGILAV  316

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS+DFRCSDVS+TID++LTMVMGDD++KVVAWYDNEWGYSQRVVDLA L A+KW
Sbjct  317  ADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKW  375



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+V
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESAEKELKGILEV  320

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  321  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  341  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  341  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   +KG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANEMKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR A+   LKG+LDV
Sbjct  285  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDAAANELKGILDV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  CDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR+++D  LKG+L V
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRESADNELKGILSV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA  W
Sbjct  343  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNW  401



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  283  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESADNELKGILSV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA KW
Sbjct  342  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKW  400



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  341  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  341  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  341  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  398



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+V
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELKGILEV  320

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  321  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  202  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  261

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE++NAAFR +++  LKG+L+V
Sbjct  262  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEINAAFRDSAEKELKGILEV  320

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  321  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  L G+L V
Sbjct  281  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAADKELNGILAV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  340  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDV
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDV  290

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+ W
Sbjct  291  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANNW  349



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    KV+D+ FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  200  LAPFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAV  259

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVD+V+ V+KK  TAEDVNAAFR+A+ GP+KG+L V
Sbjct  260  ALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKK-CTAEDVNAAFREAAAGPMKGILQV  318

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS+DFRC+DVS++IDS+LTMVMG+D+VK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  319  VDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVVDLAELTASKW  377



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  159  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  218

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  219  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  277

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  278  CDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  336



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANKW  402



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  LKG+L V
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKELKGILSV  344

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L+G+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELQGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 165/180 (92%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  198  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  257

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLD  358
            +LVLP+LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A + P LKG+L 
Sbjct  258  ALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETPQLKGILA  316

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  317  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  376



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  150  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  209

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  210  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAAANELKGILDV  268

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  269  CDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  327



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  172  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  231

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  232  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  290

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  291  CDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDV
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  284  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADKELKGILSV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  401



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDV
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  233  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  292

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  293  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADKELKGILSV  351

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  352  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  410



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  336

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  337  CDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  336

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  337  CDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  341  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDV
Sbjct  284  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  343  CDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  231  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  290

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L G+L V
Sbjct  291  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELAGILSV  349

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA++W
Sbjct  350  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  158  LAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  217

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLV+N +KKG+TAE+VNAAFRKA+DGP+KG+L V
Sbjct  218  ALVLPNLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTAEEVNAAFRKAADGPMKGILGV  277

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  223
            CD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNE GY
Sbjct  278  CDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNELGY  321



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  218  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  277

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDV
Sbjct  278  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDV  336

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  337  CDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDV
Sbjct  281  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAAANELKGILDV  339

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  340  CDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++   L+G+L+V
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSAANELQGILEV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++   L+G+L+V
Sbjct  285  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSAANELQGILEV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+ E+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  195  LAPFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  254

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A+ GP+KGVL V
Sbjct  255  ALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAAAGPMKGVLHV  313

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             DAPLVS+DF+C+D S++IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  314  EDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQKW  372



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            +   VKV++E+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKAV
Sbjct  191  MAPFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAV  250

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP +KGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAAFR+A++G  KGVL V
Sbjct  251  ALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAFREAANGAQKGVLAV  309

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  310  SDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQKW  368



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  220  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  279

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-SDGPLKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL 
Sbjct  280  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACATEELKGVLA  338

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  339  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  398



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTT SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  341  CDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L V
Sbjct  285  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  125  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  184

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++++  L+G+L V
Sbjct  185  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKESAEKELQGILSV  243

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            C+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  244  CEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  302



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  222  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  281

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+V
Sbjct  282  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILEV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  341  CDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-SDGPLKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL 
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACATEELKGVLA  345

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  346  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  405



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L    K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  155  LAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  214

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK++DGPL G+L V
Sbjct  215  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKSADGPLNGILAV  274

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW  229
            CD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEW
Sbjct  275  CDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEW  316



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  195  LAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  254

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A++GP+KGVL V
Sbjct  255  SLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAANGPMKGVLHV  313

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  314  EDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW  372



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L G+L V
Sbjct  286  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESADKELAGILSV  344

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  221  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL 
Sbjct  281  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETEQLKGVLA  339

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  340  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  399



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  190  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  249

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGK NGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L V
Sbjct  250  ALVLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRNSAEKELKGILKV  308

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDF+CSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  309  CDEPLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  367



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  138  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  197

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+V
Sbjct  198  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELIGILEV  256

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A KW
Sbjct  257  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIKW  315



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  267  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  326

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR  ++  LKG+L V
Sbjct  327  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDTAEKELKGILSV  385

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  386  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  444



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FG+VKG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  200  LAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAV  259

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR+A++GPLKG+L V
Sbjct  260  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFREAANGPLKGILAV  318

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQRVVDLA L A+ W
Sbjct  319  ADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANW  377



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  190  LAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  249

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A++GP+KGVL V
Sbjct  250  ALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAANGPMKGVLHV  308

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  309  EDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAKKW  367



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  223  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  282

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++   L G+L+V
Sbjct  283  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSAANELAGILEV  341

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CDAPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  CDAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  400



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FG+VKG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAV
Sbjct  202  LAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAV  261

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR+A++GPLKG+L V
Sbjct  262  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFREAANGPLKGILAV  320

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQRVVDLA L A+ W
Sbjct  321  ADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANW  379



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  144  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  203

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASD-GPLKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A +   LKGVL 
Sbjct  204  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDACNTDQLKGVLA  262

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  263  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  322



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A     LKGVL 
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACQTEQLKGVLA  345

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  346  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL 
Sbjct  287  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETEQLKGVLA  345

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  346  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            +    KV+D +FGIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  85   MAPFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  144

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNG ALRVPTPNVS+VDLV+ V+KK   AE+VN AFR+A+ G +KGVL V
Sbjct  145  ALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTF-AEEVNNAFREAAAGEMKGVLAV  203

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVS +IDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  204  CDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELAASKW  262



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  199  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  258

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A     LKGVL 
Sbjct  259  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACQTEQLKGVLA  317

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  318  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  377



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  227  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  L G+L V
Sbjct  287  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELNGILSV  345

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  404



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV++++FG+VKG MTTTHSYTGDQ++LDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  201  LAPFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASHRDLRRARAAALNIVPTSTGAAKAV  260

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNGIALRVPTPNVSVVDLV+   KK +TAE+VN AFR+++ GPLKG+L V
Sbjct  261  ALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTAEEVNNAFRESAAGPLKGILSV  319

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+D S+TIDS+LTMV+GDDM+KVVAWYDNEWGYSQRVVDLA L A+ W
Sbjct  320  CDEPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAANW  378



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  205  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  264

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+V
Sbjct  265  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEV  323

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  324  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  382



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 2/180 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  197  LAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  256

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASD-GPLKGVLD  358
            +LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A +   LKGVL 
Sbjct  257  ALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDACNTDQLKGVLA  315

Query  357  VCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            VCD PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  316  VCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  375



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+V
Sbjct  285  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  344  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+V
Sbjct  285  SLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  344  CDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  177  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  236

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L V
Sbjct  237  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSV  295

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  296  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  354



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L V
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELNGILSV  344

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  CDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG AKAV
Sbjct  221  LAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGVAKAV  280

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            SLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A++GPLKG+L V
Sbjct  281  SLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGILAV  340

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH  196
            CD PLVS+DF CSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH
Sbjct  341  CDIPLVSIDFHCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH  393



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L V
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L V
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S   L G+L V
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSSAKELAGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L V
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  224  LAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  283

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++   LKG+L+V
Sbjct  284  ALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSAANELKGILEV  342

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRCSDVS TID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  343  CDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  225  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  284

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S   L G+L V
Sbjct  285  ALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSSAKELAGILSV  343

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  CDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+ GIVKGT+TTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  233  LAPFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  292

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VN AFR+A++GP+KG+L V
Sbjct  293  ALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNEAFREAANGPMKGILVV  351

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS DF CSD SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA KW
Sbjct  352  SDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAKKW  410



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+++ FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  234  LAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  293

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR+AS+G LKG+L V
Sbjct  294  ALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFREASEGYLKGILAV  352

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS D+R +DVSSTID++LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA LVA KW
Sbjct  353  SDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKW  411



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  226  LAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  285

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  L G+L V
Sbjct  286  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELNGILSV  344

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  CDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+ E+FG+VKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  198  LAPFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  257

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK L AE+VN AFR A+ GPLKGVL V
Sbjct  258  ALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTL-AEEVNQAFRDAAAGPLKGVLGV  316

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS+DF+ SDVS+TIDS+LTMVMGDDMVKVVAWYDNEWGYSQRV+DLA L A KW
Sbjct  317  ADIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQRVLDLAELCAEKW  375



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  230  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  289

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++++  L+G+L V
Sbjct  290  ALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKESAEKELQGILSV  348

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            C+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  349  CEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  407



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV
Sbjct  138  LAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAV  197

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP+LKGKLNG+ALRVPTP VSVVDLVV V+KK   AE+VN AFR+A++GPLKG+L V
Sbjct  198  ALVLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKTF-AEEVNEAFREAANGPLKGILGV  256

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
             D PLVS DF+ ++VSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA   A  W
Sbjct  257  SDEPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAAYTAKHW  315



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 1/179 (1%)
 Frame = -1

Query  714  LGSLVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  535
            L   VKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK V
Sbjct  227  LAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKPV  286

Query  534  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  355
            +LVLP L+GKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L V
Sbjct  287  ALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADKELKGILSV  345

Query  354  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  178
            CD PLVSVDFRC DVSST+DSSLTMVMGDDMVKV+AWYDNEWGY QRVVDLA +VA KW
Sbjct  346  CDEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVVDLADVVAEKW  404



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630