BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002O12

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001182857.1|  uncharacterized protein LOC100501115 precursor     203   3e-61   
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             212   1e-60   Prunus persica
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    212   1e-60   Prunus mume [ume]
gb|KJB79239.1|  hypothetical protein B456_013G038900                    209   2e-60   Gossypium raimondii
gb|KJB47459.1|  hypothetical protein B456_008G027700                    207   2e-60   Gossypium raimondii
gb|KJB12212.1|  hypothetical protein B456_002G006200                    212   2e-60   Gossypium raimondii
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             211   2e-60   Citrus clementina [clementine]
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    211   2e-60   Malus domestica [apple tree]
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    211   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    211   2e-60   Citrus sinensis [apfelsine]
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    211   3e-60   Fragaria vesca subsp. vesca
gb|KJB77692.1|  hypothetical protein B456_012G151500                    211   3e-60   Gossypium raimondii
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    211   3e-60   Nicotiana tomentosiformis
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    211   3e-60   
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    212   3e-60   Cucumis melo [Oriental melon]
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    211   4e-60   Nicotiana sylvestris
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1    210   5e-60   Populus euphratica
gb|AAL07091.2|  putative endomembrane protein EMP70 precusor isolog     207   5e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDO97576.1|  unnamed protein product                                210   6e-60   Coffea canephora [robusta coffee]
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    210   6e-60   Pyrus x bretschneideri [bai li]
ref|XP_006384984.1|  endomembrane protein 70                            210   6e-60   
ref|XP_007042269.1|  Transmembrane nine 1                               211   6e-60   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       211   6e-60   
ref|XP_002530674.1|  endomembrane protein emp70, putative               210   7e-60   Ricinus communis
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    210   7e-60   Sesamum indicum [beniseed]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         210   7e-60   Jatropha curcas
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                210   8e-60   Erythranthe guttata [common monkey flower]
emb|CDX94774.1|  BnaC07g17830D                                          210   9e-60   
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    210   9e-60   Eucalyptus grandis [rose gum]
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             210   1e-59   Phaseolus vulgaris [French bean]
emb|CDY20974.1|  BnaA08g25510D                                          209   1e-59   Brassica napus [oilseed rape]
gb|AFX67030.1|  endomembrane protein emp70                              204   1e-59   Solanum tuberosum [potatoes]
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    209   1e-59   Arabis alpina [alpine rockcress]
emb|CDY19333.1|  BnaC05g08420D                                          209   1e-59   Brassica napus [oilseed rape]
emb|CDY20592.1|  BnaC08g14660D                                          209   1e-59   Brassica napus [oilseed rape]
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    209   1e-59   Brassica rapa
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    209   1e-59   Glycine soja [wild soybean]
emb|CDX97924.1|  BnaA06g06750D                                          209   1e-59   
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    209   1e-59   
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             209   1e-59   Eutrema salsugineum [saltwater cress]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    209   1e-59   Gossypium raimondii
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Brassica rapa
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Nicotiana sylvestris
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Populus euphratica
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    209   2e-59   Glycine soja [wild soybean]
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Glycine max [soybeans]
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Glycine max [soybeans]
emb|CDY34861.1|  BnaA09g47870D                                          209   2e-59   Brassica napus [oilseed rape]
ref|XP_006392091.1|  hypothetical protein EUTSA_v10023368mg             206   2e-59   
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    209   2e-59   Gossypium arboreum [tree cotton]
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    209   2e-59   Elaeis guineensis
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    209   2e-59   Solanum lycopersicum
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    209   3e-59   Solanum tuberosum [potatoes]
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    208   3e-59   Zea mays [maize]
gb|KJB79240.1|  hypothetical protein B456_013G038900                    208   3e-59   Gossypium raimondii
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1    209   3e-59   Vitis vinifera
emb|CDY34667.1|  BnaC08g42260D                                          210   3e-59   Brassica napus [oilseed rape]
gb|KJB47458.1|  hypothetical protein B456_008G027700                    208   3e-59   Gossypium raimondii
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    208   3e-59   
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    208   3e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    208   3e-59   
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg                208   3e-59   Erythranthe guttata [common monkey flower]
gb|KHG27380.1|  Tm9sf3                                                  209   3e-59   Gossypium arboreum [tree cotton]
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             208   3e-59   Capsella rubella
emb|CDY54577.1|  BnaCnng27330D                                          207   3e-59   Brassica napus [oilseed rape]
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    208   3e-59   Elaeis guineensis
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    208   3e-59   Nicotiana sylvestris
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    208   3e-59   Nicotiana tomentosiformis
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    208   4e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    208   4e-59   Camelina sativa [gold-of-pleasure]
ref|NP_563881.1|  transmembrane nine 1                                  208   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    208   4e-59   
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          208   4e-59   Sorghum bicolor [broomcorn]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    208   4e-59   Camelina sativa [gold-of-pleasure]
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    207   4e-59   Triticum urartu
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    208   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             208   4e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    208   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    208   5e-59   Setaria italica
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    207   5e-59   Elaeis guineensis
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    207   6e-59   Phoenix dactylifera
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    207   6e-59   Brachypodium distachyon [annual false brome]
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    207   6e-59   Solanum tuberosum [potatoes]
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    210   6e-59   
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    207   6e-59   Phoenix dactylifera
ref|NP_001065897.1|  Os11g0181100                                       207   6e-59   
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    207   7e-59   Solanum lycopersicum
dbj|BAJ96423.1|  predicted protein                                      207   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    207   7e-59   Elaeis guineensis
dbj|BAJ86318.1|  predicted protein                                      207   7e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY12876.1|  BnaA09g13980D                                          207   7e-59   Brassica napus [oilseed rape]
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    207   8e-59   Brachypodium distachyon [annual false brome]
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    207   9e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             207   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_011092339.1|  PREDICTED: transmembrane 9 superfamily membe...    204   1e-58   
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    207   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                    206   1e-58   
dbj|BAJ87519.1|  predicted protein                                      207   1e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAF01745.1|  putative endomembrane protein EMP70 precusor isolog    194   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3    207   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...    207   1e-58   
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    206   1e-58   Brassica rapa
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                    206   1e-58   Arabis alpina [alpine rockcress]
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Oryza brachyantha
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Cicer arietinum [garbanzo]
emb|CDY54580.1|  BnaCnng27350D                                          206   2e-58   Brassica napus [oilseed rape]
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Glycine max [soybeans]
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Phoenix dactylifera
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Glycine max [soybeans]
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g             206   2e-58   Phaseolus vulgaris [French bean]
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Glycine max [soybeans]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Glycine max [soybeans]
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    206   2e-58   Setaria italica
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         206   2e-58   Medicago truncatula
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    206   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...    206   3e-58   
emb|CDY03772.1|  BnaC01g28890D                                          206   3e-58   
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350          206   3e-58   Amborella trichopoda
ref|NP_001066292.1|  Os12g0175700                                       206   3e-58   
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    206   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001785033.1|  predicted protein                                  199   4e-58   
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    205   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...    205   6e-58   Zea mays [maize]
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    204   6e-58   
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    205   6e-58   Solanum tuberosum [potatoes]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...    205   7e-58   Zea mays [maize]
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...    204   8e-58   Setaria italica
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...    204   9e-58   Sesamum indicum [beniseed]
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...    204   9e-58   
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    204   9e-58   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              204   1e-57   
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500          204   1e-57   Sorghum bicolor [broomcorn]
ref|NP_001047104.1|  Os02g0552000                                       204   1e-57   
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    204   1e-57   Solanum lycopersicum
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...    204   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          204   1e-57   Sorghum bicolor [broomcorn]
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...    204   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003592977.1|  Transmembrane 9 superfamily protein member         199   6e-57   
gb|EPS65883.1|  hypothetical protein M569_08888                         201   9e-57   Genlisea aurea
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    201   2e-56   Cicer arietinum [garbanzo]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    200   3e-56   Cicer arietinum [garbanzo]
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331             200   5e-56   
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         199   6e-56   Medicago truncatula
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...    199   8e-56   Brachypodium distachyon [annual false brome]
ref|XP_001785045.1|  predicted protein                                  199   1e-55   
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    195   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    194   4e-54   Sesamum indicum [beniseed]
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520             194   5e-54   Selaginella moellendorffii
emb|CDY33319.1|  BnaAnng04300D                                          189   3e-52   Brassica napus [oilseed rape]
emb|CDY46193.1|  BnaA01g23150D                                          189   5e-52   Brassica napus [oilseed rape]
emb|CDY44834.1|  BnaCnng11900D                                          188   6e-52   Brassica napus [oilseed rape]
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              188   1e-51   Coccomyxa subellipsoidea C-169
ref|NP_001140443.1|  uncharacterized protein LOC100272502               174   5e-51   
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...    181   3e-49   Nicotiana sylvestris
ref|XP_007509634.1|  predicted protein                                  179   3e-48   Bathycoccus prasinos
ref|XP_009631163.1|  PREDICTED: transmembrane 9 superfamily membe...    176   4e-48   
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...    177   1e-47   Solanum tuberosum [potatoes]
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...    176   3e-47   Nicotiana tomentosiformis
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3               176   4e-47   Auxenochlorella protothecoides
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...    173   4e-46   Solanum lycopersicum
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511              172   6e-46   Chlorella variabilis
gb|AAX96186.1|  Endomembrane protein 70                                 169   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3               169   9e-45   
gb|KFO35950.1|  Phosphoinositide 3-kinase adapter protein 1             172   1e-44   Fukomys damarensis [Damara mole rat]
gb|KDD76545.1|  endomembrane protein 70                                 167   3e-44   Helicosporidium sp. ATCC 50920
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231              167   6e-44   Volvox carteri f. nagariensis
gb|KHG20579.1|  Tm9sf3                                                  167   7e-44   Gossypium arboreum [tree cotton]
gb|KHG20578.1|  Tm9sf3                                                  167   7e-44   Gossypium arboreum [tree cotton]
gb|KJB47460.1|  hypothetical protein B456_008G027700                    166   9e-44   Gossypium raimondii
gb|KJB47461.1|  hypothetical protein B456_008G027700                    166   1e-43   Gossypium raimondii
gb|ETN57960.1|  hypothetical protein AND_010453                         168   3e-43   Anopheles darlingi [American malaria mosquito]
ref|XP_009511961.1|  PREDICTED: transmembrane 9 superfamily member 3    156   3e-43   Phalacrocorax carbo [common cormorant]
ref|XP_006385204.1|  hypothetical protein POPTR_0003s011002g            154   3e-43   
gb|KJB77693.1|  hypothetical protein B456_012G151500                    163   1e-42   Gossypium raimondii
ref|XP_009976834.1|  PREDICTED: transmembrane 9 superfamily member 3    156   3e-42   Tauraco erythrolophus
gb|EPS62158.1|  hypothetical protein M569_12635                         161   4e-42   Genlisea aurea
dbj|BAG60075.1|  unnamed protein product                                155   4e-42   Homo sapiens [man]
dbj|BAB55110.1|  unnamed protein product                                156   1e-41   Homo sapiens [man]
ref|XP_008057299.1|  PREDICTED: transmembrane 9 superfamily member 3    156   2e-41   Carlito syrichta
ref|XP_003061693.1|  predicted protein                                  159   3e-41   Micromonas pusilla CCMP1545
ref|XP_009951614.1|  PREDICTED: transmembrane 9 superfamily member 3    156   5e-41   Leptosomus discolor
ref|XP_009478867.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-41   Pelecanus crispus
dbj|BAC11232.1|  unnamed protein product                                156   5e-41   Homo sapiens [man]
ref|XP_006756739.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-41   
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...    157   1e-40   
ref|XP_008942019.1|  PREDICTED: transmembrane 9 superfamily member 3    155   1e-40   Merops nubicus
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3    157   1e-40   Megachile rotundata
gb|KFU99061.1|  Transmembrane 9 superfamily member 3                    155   1e-40   Pterocles gutturalis
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3    157   2e-40   Camponotus floridanus
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3    157   2e-40   Ooceraea biroi
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3    157   2e-40   Harpegnathos saltator
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3    157   2e-40   Solenopsis invicta [imported red fire ant]
dbj|BAE91187.1|  unnamed protein product                                155   2e-40   Macaca fascicularis [crab eating macaque]
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3    156   2e-40   Acromyrmex echinatior
gb|AAQ89178.1|  PATY245                                                 155   2e-40   Homo sapiens [man]
ref|XP_006263564.1|  PREDICTED: transmembrane 9 superfamily membe...    156   2e-40   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...    156   2e-40   Apis dorsata [rock honeybee]
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3    156   2e-40   Apis mellifera [bee]
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    156   2e-40   
ref|XP_007441347.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-40   
ref|XP_007615223.1|  PREDICTED: transmembrane 9 superfamily membe...    155   3e-40   
gb|AAH20959.2|  TM9SF3 protein                                          156   3e-40   Homo sapiens [man]
ref|XP_007258750.1|  PREDICTED: transmembrane 9 superfamily membe...    156   3e-40   Astyanax mexicanus [blind cave fish]
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...    156   3e-40   Lepisosteus oculatus
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3    156   3e-40   Oreochromis niloticus
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...    156   3e-40   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010018436.1|  PREDICTED: transmembrane 9 superfamily member 3    155   3e-40   Nestor notabilis
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    156   3e-40   Stegastes partitus
ref|XP_009916579.1|  PREDICTED: transmembrane 9 superfamily membe...    155   3e-40   Haliaeetus albicilla
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3    156   3e-40   Latimeria chalumnae
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...    156   4e-40   Poecilia reticulata
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3    156   4e-40   Poecilia formosa
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...    156   4e-40   Xiphophorus maculatus
ref|XP_006157459.1|  PREDICTED: transmembrane 9 superfamily member 3    156   4e-40   
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor        156   4e-40   Danio rerio [leopard danio]
gb|AAH04799.2|  Tm9sf3 protein                                          155   4e-40   Mus musculus [mouse]
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3    156   4e-40   Callorhinchus milii [Australian ghost shark]
gb|ELK35693.1|  Transmembrane 9 superfamily member 3                    155   4e-40   Myotis davidii
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...    156   4e-40   Pundamilia nyererei
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3    156   4e-40   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_003787418.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3    156   4e-40   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...    156   4e-40   Maylandia zebra
ref|XP_008428274.1|  PREDICTED: transmembrane 9 superfamily membe...    155   4e-40   Poecilia reticulata
ref|XP_004616433.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Sorex araneus [Eurasian shrew]
ref|XP_003963762.1|  PREDICTED: transmembrane 9 superfamily membe...    156   4e-40   Takifugu rubripes [tiger puffer]
ref|XP_008948979.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    155   4e-40   Pan paniscus [bonobo]
ref|XP_005153929.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Melopsittacus undulatus
gb|KFP32607.1|  Transmembrane 9 superfamily member 3                    155   4e-40   Colius striatus
ref|XP_006116276.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...    155   4e-40   
ref|XP_004892237.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Ochotona princeps [southern American pika]
ref|XP_009705892.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Cariama cristata
ref|XP_009574595.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Fulmarus glacialis
ref|XP_011285801.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...    155   4e-40   Meleagris gallopavo [common turkey]
ref|XP_002509072.1|  predicted protein                                  156   4e-40   Micromonas commoda
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                  155   4e-40   Homo sapiens [man]
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor        155   4e-40   Homo sapiens [man]
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Chrysemys picta bellii
emb|CDQ61092.1|  unnamed protein product                                156   4e-40   Oncorhynchus mykiss
ref|XP_009669621.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Struthio camelus australis
ref|XP_005025241.1|  PREDICTED: transmembrane 9 superfamily membe...    155   4e-40   
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3    155   4e-40   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_009470788.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   Nipponia nippon
ref|XP_007080322.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_008932762.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_007187499.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Balaenoptera acutorostrata scammoni
ref|XP_005520596.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004625742.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_005407638.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Chrysochloris asiatica
ref|XP_005637634.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Rhinopithecus roxellana
gb|AAF21983.1|  SM-11044 binding protein                                155   5e-40   Homo sapiens [man]
gb|EHB07803.1|  Transmembrane 9 superfamily member 3                    155   5e-40   Heterocephalus glaber [naked mole rat]
ref|XP_005407641.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Heterocephalus glaber [naked mole rat]
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   Macaca mulatta [rhesus macaque]
ref|XP_007053441.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
gb|EHH19260.1|  hypothetical protein EGK_19936                          155   5e-40   Macaca mulatta [rhesus macaque]
ref|XP_010409948.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_005416571.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Geospiza fortis
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Xenopus tropicalis [western clawed frog]
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor     155   5e-40   Bos taurus [bovine]
ref|XP_008641953.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004020122.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                    155   5e-40   Bos mutus
ref|XP_004680642.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Condylura cristata
ref|XP_003255319.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Orcinus orca [Orca]
ref|XP_001662153.1|  AAEL012016-PA                                      155   5e-40   Aedes aegypti
gb|EPQ19715.1|  Transmembrane 9 superfamily member 3                    155   5e-40   Myotis brandtii
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                    155   5e-40   Cariama cristata
gb|EMC79922.1|  Transmembrane 9 superfamily member 3                    155   5e-40   
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   Erinaceus europaeus [common hedgehog]
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004701094.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor     155   5e-40   
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...    155   5e-40   
ref|XP_009966566.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004427950.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                    155   5e-40   
gb|EDL41855.1|  mCG2375, isoform CRA_b                                  155   5e-40   
ref|XP_009470713.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_008142341.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_005407639.1|  PREDICTED: transmembrane 9 superfamily membe...    155   5e-40   
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor        155   5e-40   
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    155   5e-40   
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3       155   5e-40   
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3    155   5e-40   
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_008684538.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...    155   6e-40   
ref|XP_010969423.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_005407637.1|  PREDICTED: transmembrane 9 superfamily membe...    155   6e-40   
emb|CAN77106.1|  hypothetical protein VITISV_037096                     155   6e-40   
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
ref|XP_007654581.1|  PREDICTED: transmembrane 9 superfamily member 3    155   6e-40   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                    155   7e-40   
ref|XP_001656277.1|  AAEL012833-PA                                      155   7e-40   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3    155   7e-40   
ref|XP_008205311.1|  PREDICTED: transmembrane 9 superfamily membe...    155   7e-40   
ref|XP_005885527.1|  PREDICTED: transmembrane 9 superfamily member 3    155   7e-40   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...    155   7e-40   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3    155   8e-40   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...    155   8e-40   
ref|XP_011303436.1|  PREDICTED: transmembrane 9 superfamily member 3    155   8e-40   
gb|AIC62213.1|  TM9SF3                                                  154   9e-40   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    155   9e-40   
dbj|BAD90204.1|  mKIAA4036 protein                                      155   9e-40   
emb|CDQ58548.1|  unnamed protein product                                155   9e-40   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3    155   1e-39   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-39   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3    154   1e-39   
emb|CDY14555.1|  BnaC03g49040D                                          154   1e-39   
ref|XP_009615816.1|  PREDICTED: transmembrane 9 superfamily membe...    144   1e-39   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3    154   1e-39   
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    153   1e-39   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...    154   1e-39   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...    154   1e-39   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3    155   1e-39   
ref|XP_004347030.2|  transmembrane protein TM9SF3                       154   2e-39   
ref|XP_001698971.1|  EMP/nonaspanin domain family protein               154   2e-39   
ref|XP_009868517.1|  PREDICTED: transmembrane 9 superfamily member 3    153   2e-39   
gb|KFP89360.1|  Transmembrane 9 superfamily member 3                    153   2e-39   
dbj|BAA91362.1|  unnamed protein product                                152   2e-39   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3    154   2e-39   
ref|XP_004622652.1|  PREDICTED: transmembrane 9 superfamily membe...    145   2e-39   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3    154   3e-39   
ref|XP_008471864.1|  PREDICTED: transmembrane 9 superfamily membe...    152   3e-39   
dbj|BAD12191.1|  SM-11044 binding protein                               151   3e-39   
ref|XP_009895972.1|  PREDICTED: transmembrane 9 superfamily member 3    152   9e-39   
ref|XP_001353740.2|  GA10420                                            152   9e-39   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...    152   9e-39   
ref|XP_002025369.1|  GL11985                                            152   9e-39   
ref|XP_008502202.1|  PREDICTED: transmembrane 9 superfamily member 3    152   1e-38   
gb|EHJ69950.1|  putative endomembrane protein emp70                     151   1e-38   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    152   1e-38   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3    151   1e-38   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...    151   2e-38   
ref|XP_001630700.1|  predicted protein                                  151   2e-38   
ref|XP_004932208.1|  PREDICTED: transmembrane 9 superfamily membe...    151   2e-38   
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    151   2e-38   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341             150   3e-38   
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                  150   3e-38   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...    150   3e-38   
ref|XP_002035457.1|  GM13907                                            149   6e-38   
ref|XP_002093812.1|  GE20545                                            149   7e-38   
gb|EKC24508.1|  Transmembrane 9 superfamily member 3                    152   7e-38   
ref|XP_002047393.1|  GJ11952                                            149   7e-38   
ref|NP_647979.1|  CG10590                                               149   7e-38   
ref|XP_001984443.1|  GH15015                                            149   8e-38   
ref|NP_001146830.1|  uncharacterized protein LOC100280437               139   8e-38   
ref|XP_002062013.1|  GK16877                                            149   8e-38   
ref|XP_001957525.1|  GF10453                                            149   9e-38   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                    149   1e-37   
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884              149   1e-37   
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872             149   1e-37   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243             149   1e-37   
emb|CBN79799.1|  conserved unknown protein                              142   2e-37   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570    151   2e-37   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3       148   2e-37   
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                   148   2e-37   
gb|ELU00390.1|  hypothetical protein CAPTEDRAFT_170344                  147   3e-37   
ref|XP_001972005.1|  GG14121                                            147   4e-37   
ref|XP_002007870.1|  GI13177                                            147   4e-37   
ref|XP_008895868.1|  hypothetical protein, variant 2                    147   4e-37   
gb|ETK76717.1|  hypothetical protein, variant 2                         147   5e-37   
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative     147   5e-37   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                    147   5e-37   
gb|ETK76715.1|  hypothetical protein L915_16929                         147   5e-37   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152              147   6e-37   
gb|ETI36484.1|  hypothetical protein F443_17408                         147   6e-37   
gb|ETI36485.1|  hypothetical protein, variant 1                         147   6e-37   
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515             147   6e-37   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative         147   7e-37   
ref|XP_009827098.1|  hypothetical protein, variant                      146   8e-37   
ref|XP_785201.2|  PREDICTED: transmembrane 9 superfamily member 3       146   9e-37   
ref|XP_004990450.1|  endomembrane protein emp70                         145   1e-36   
gb|KDR11018.1|  hypothetical protein L798_14383                         145   2e-36   
ref|XP_006819376.1|  PREDICTED: transmembrane 9 superfamily membe...    145   2e-36   
ref|XP_008614772.1|  hypothetical protein SDRG_10554                    145   2e-36   
gb|KDO15767.1|  hypothetical protein SPRG_18692                         144   4e-36   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...    144   5e-36   
gb|AEE63341.1|  unknown                                                 144   5e-36   
ref|XP_005768973.1|  hypothetical protein EMIHUDRAFT_60571              135   5e-36   
gb|ENN73181.1|  hypothetical protein YQE_10235                          144   6e-36   
ref|XP_008555159.1|  PREDICTED: transmembrane 9 superfamily member 3    144   7e-36   
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    143   1e-35   
emb|CDS34226.1|  Transmembrane 9 superfamily                            144   2e-35   
ref|XP_008868877.1|  hypothetical protein H310_05822                    143   2e-35   
gb|KDO27371.1|  hypothetical protein SPRG_06957                         142   3e-35   
emb|CCI39563.1|  unnamed protein product                                140   1e-34   
gb|EYB86903.1|  hypothetical protein Y032_0271g885                      136   2e-34   
emb|CCI39562.1|  unnamed protein product                                139   2e-34   
ref|XP_001746206.1|  hypothetical protein                               141   2e-34   
emb|CCA19624.1|  endomembrane protein 70like protein putative           139   2e-34   
gb|EYB86905.1|  hypothetical protein Y032_0271g885                      136   4e-34   
gb|EYB86904.1|  hypothetical protein Y032_0271g885                      136   4e-34   
emb|CEJ05344.1|  hypothetical protein RMCBS344292_19287                 136   4e-34   
ref|XP_002426886.1|  conserved hypothetical protein                     138   5e-34   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                    138   7e-34   
gb|ERG85277.1|  transmembrane 9 superfamily member 3                    138   8e-34   
emb|CEJ03838.1|  hypothetical protein RMCBS344292_17813                 135   9e-34   
emb|CEG68095.1|  hypothetical protein RMATCC62417_04417                 135   1e-33   
emb|CDS07558.1|  hypothetical protein LRAMOSA01507                      138   1e-33   
gb|EEE57172.1|  hypothetical protein OsJ_07106                          137   2e-33   
gb|KFU99734.1|  Transmembrane 9 superfamily member 3                    129   2e-33   
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3    136   3e-33   
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                   135   4e-33   
ref|XP_009173090.1|  hypothetical protein T265_08898                    135   7e-33   
emb|CDQ00788.1|  Protein Bm6514, isoform c                              135   8e-33   
gb|EJW85205.1|  endomembrane protein emp70                              135   9e-33   
emb|CDH93341.1|  Y41D4A.4, isoform c                                    134   9e-33   
emb|CEG80626.1|  hypothetical protein RMATCC62417_14930                 135   1e-32   
ref|NP_500130.1|  Protein Y41D4A.4                                      134   1e-32   
emb|CDH93340.1|  Y41D4A.4, isoform b                                    134   1e-32   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                      134   2e-32   
emb|CDW55076.1|  Transmembrane 9 superfamily                            134   2e-32   
ref|XP_003094144.1|  hypothetical protein CRE_13729                     133   4e-32   
ref|XP_002634585.1|  Hypothetical protein CBG08396                      133   4e-32   
ref|XP_003143038.1|  endomembrane protein emp70                         132   1e-31   
emb|CDS23908.1|  Transmembrane 9 superfamily                            132   1e-31   
emb|CDI96724.1|  Transmembrane 9 superfamily                            132   1e-31   
gb|ELW49306.1|  Transmembrane 9 superfamily member 3                    131   2e-31   
gb|EDL41854.1|  mCG2375, isoform CRA_a                                  130   2e-31   
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3    131   3e-31   
gb|KFP99383.1|  Transmembrane 9 superfamily member 3                    129   4e-31   
gb|EPB84661.1|  hypothetical protein HMPREF1544_08604                   130   5e-31   
ref|XP_007122871.1|  PREDICTED: transmembrane 9 superfamily membe...    127   8e-31   
gb|KFQ32916.1|  Transmembrane 9 superfamily member 3                    128   8e-31   
emb|CEP16327.1|  hypothetical protein                                   129   8e-31   
ref|XP_002679262.1|  predicted protein                                  130   9e-31   
gb|KFZ51498.1|  Transmembrane 9 superfamily member 3                    128   1e-30   
gb|KFQ54713.1|  Transmembrane 9 superfamily member 3                    128   1e-30   
dbj|BAE27875.1|  unnamed protein product                                128   1e-30   
gb|KFV52836.1|  Transmembrane 9 superfamily member 3                    128   1e-30   
gb|KFO54227.1|  Transmembrane 9 superfamily member 3                    128   1e-30   
gb|EFB24098.1|  hypothetical protein PANDA_005202                       128   2e-30   
gb|KFQ90694.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFP38896.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFW76816.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFV79427.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFM06419.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFV91617.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|KFO94520.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|EMP41799.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|EOA97287.1|  Transmembrane 9 superfamily member 3                    128   2e-30   
gb|ERE79681.1|  transmembrane 9 superfamily member 3                    128   2e-30   
ref|XP_314301.3|  AGAP004882-PA                                         128   3e-30   
gb|EIE90684.1|  hypothetical protein RO3G_15395                         128   4e-30   
ref|XP_006749965.1|  PREDICTED: transmembrane 9 superfamily member 3    126   4e-30   
ref|XP_004320666.1|  PREDICTED: transmembrane 9 superfamily member 3    126   8e-30   
gb|KFV65167.1|  Transmembrane 9 superfamily member 3                    124   4e-29   
emb|CBY17963.1|  unnamed protein product                                123   2e-28   
gb|KFH64844.1|  hypothetical protein MVEG_09573                         122   3e-28   
ref|XP_006679870.1|  hypothetical protein BATDEDRAFT_25752              120   6e-28   
gb|EUB64714.1|  Transmembrane 9 superfamily member                      120   3e-27   
ref|XP_002290902.1|  endomembrane protein EMP70 precusor                119   6e-27   
ref|XP_002178644.1|  predicted protein                                  119   1e-26   
gb|KFP08579.1|  Transmembrane 9 superfamily member 3                    117   1e-26   
gb|KHJ41501.1|  endomembrane protein 70                                 114   4e-25   
emb|CEF59928.1|  Nonaspanin (TM9SF) family-containing protein           113   4e-25   
ref|XP_002784348.1|  conserved hypothetical protein                     111   2e-24   
gb|KFD51698.1|  hypothetical protein M513_07394                         111   3e-24   
ref|XP_001899401.1|  Transmembrane 9 superfamily protein member 3...    106   1e-22   
ref|XP_001870554.1|  transmembrane 9 superfamily protein member 3       103   2e-22   
emb|CBK24710.2|  unnamed protein product                                104   2e-22   
gb|ETK76718.1|  hypothetical protein, variant 3                         103   1e-21   
ref|XP_008895869.1|  hypothetical protein, variant 3                    103   2e-21   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    103   2e-21   
gb|ETI36486.1|  hypothetical protein, variant 2                         103   2e-21   
ref|XP_008487150.1|  PREDICTED: transmembrane 9 superfamily membe...    102   2e-21   
emb|CAF90946.1|  unnamed protein product                                102   3e-21   
gb|KJB15314.1|  hypothetical protein B456_002G170500                  99.4    5e-21   
gb|KJB15315.1|  hypothetical protein B456_002G170500                  99.4    6e-21   
gb|AFK34316.1|  unknown                                               99.8    7e-21   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...    100   7e-21   
dbj|BAH20237.1|  AT2G01970                                            99.4    8e-21   
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    101   1e-20   
gb|ABR26036.1|  transmembrane 9 superfamily protein member 1 prec...  96.3    1e-20   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    100   1e-20   
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    100   1e-20   
gb|EEE68090.1|  hypothetical protein OsJ_26137                          101   2e-20   
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             100   2e-20   
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    100   2e-20   
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             100   2e-20   
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    100   2e-20   



>ref|NP_001182857.1| uncharacterized protein LOC100501115 precursor [Zea mays]
 gb|ACR34922.1| unknown [Zea mays]
Length=195

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  53   SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  112

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  113  LNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  172

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  173  CGAIGYLGSTLFVRRIYRNIKCD  195



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY+ KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>gb|KJB79239.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=461

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  319  SVVSLMGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  378

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  379  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  438

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  439  CGAVGYLGSNLFVRRIYRNIKCD  461



>gb|KJB47459.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=400

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  258  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  317

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY+YS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  318  LNAENYHWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  377

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  378  CGAVGYLGSNLFVRRIYRNIKCD  400



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  450  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYS+YYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+GFLGSNLFVRRIYRNIKCD
Sbjct  570  CGAIGFLGSNLFVRRIYRNIKCD  592



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  445  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  445  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  456  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  515

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  516  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  575

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  576  CGAVGYLGSNLFVRRIYRNIKCD  598



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  450  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFFSAASTAIYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  570  CGAVGYLGSNLFVRRIYRNIKCD  592



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  446  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  451  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  510

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY YSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  511  LNAENYHWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  570

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  571  CGAVGYLGSNLFVRRIYRNIKCD  593



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  490  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  549

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY YSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  550  LNAENYHWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  609

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  610  CGAVGYLGSNLFVRRIYRNIKCD  632



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  446  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  448  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIY+NIKCD
Sbjct  568  CGAVGYLGSNLFVRRIYKNIKCD  590



>gb|AAL07091.2| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=461

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  319  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  378

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  379  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  438

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  439  CGAVGYLGSNLFVRRIYRNIKCD  461



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  444  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIY+NIKCD
Sbjct  564  CGAVGYLGSNLFVRRIYKNIKCD  586



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  498  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  557

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  558  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  617

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  618  CGAVGYLGSNLFVRRIYRNIKCD  640



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  522  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  581

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY YSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  582  LNAENYHWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  641

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  642  CGAVGYLGSNLFVRRIYRNIKCD  664



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  460  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  519

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  520  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  579

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  580  CGAVGYLGSNLFVRRIYRNIKCD  602



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  441  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  501  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGYLGSNLFVRRIYRNIKCD  583



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  454  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  513

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  514  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  573

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  574  CGAVGYLGSNLFVRRIYRNIKCD  596



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   210 bits (534),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S++S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  441  SIISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  501  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGYLGSNLFVRRIYRNIKCD  583



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   210 bits (534),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGYLGSNLFVRRIYRNIKCD  585



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  488  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  547

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  548  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYFVKTKMSGFFQTSFYFGYTLMFCLGLGIL  607

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  608  CGAVGYLGSNLFVRRIYRNIKCD  630



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGFLGSNLFVRRIYRNIKCD  585



>gb|AFX67030.1| endomembrane protein emp70, partial [Solanum tuberosum]
Length=346

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  204  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  263

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSA STAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  264  LNAENYHWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  323

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGS+LFVRRIYRNIKCD
Sbjct  324  CGAVGFLGSHLFVRRIYRNIKCD  346



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  568  CGAVGFLGSNLFVRRIYRNIKCD  590



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFL
Sbjct  441  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  501  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGYLGSNLFVRRIYRNIKCD  583



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  568  CGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSXMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYY KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYAKTKMSGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  444  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  564  CGAVGFLGSNLFVRRIYRNIKCD  586



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  451  SVVSLMGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  510

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  511  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  570

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  571  CGAVGYLGSNLFVRRIYRNIKCD  593



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  440  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFL  499

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  500  LNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGIL  559

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  560  CGAVGYLGSNLFVRRIYRNIKCD  582



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  451  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  510

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  511  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  570

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIY+NIKCD
Sbjct  571  CGAVGYLGSNLFVRRIYKNIKCD  593



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  442  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  501

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  502  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  561

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  562  CGAVGYLGSNLFVRRIYRNIKCD  584



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFL
Sbjct  443  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  563  CGAVGYLGSNLFVRRIYRNIKCD  585



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  442  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  501

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  502  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  561

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  562  CGAVGYLGSNLFVRRIYRNIKCD  584



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  444  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  564  CGAVGFLGSNLFVRRIYRNIKCD  586



>ref|XP_006392091.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29377.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=471

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  329  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  388

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  389  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  448

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  449  CGAVGFLGSNLFVRRIYRNIKCD  471



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSNLFVRRIYRNIKCD  587



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  444  TVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  564  CGAVGYLGSNLFVRRIYRNIKCD  586



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  446  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFSSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  446  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFSSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSNLFVRRIYRNIKCD  588



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  444  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  564  CGAVGYLGSTLFVRRIYRNIKCD  586



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  569  CGAVGYLGSNLFVRRIYRNIKCD  591



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  450  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  570  CGAVGYLGSTLFVRRIYRNIKCD  592



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  523  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  582

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  583  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  642

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  643  CGAVGFLGSNLFVRRIYRNIKCD  665



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY+YS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  568  CGAVGYLGSNLFVRRIYRNIKCD  590



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  439  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  498

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  499  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGIL  558

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  559  CGAVGYLGSTLFVRRIYRNIKCD  581



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  448  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK++GFFQ+SFY GYT+MFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAIYVYLYSIYYYHVKTKMTGFFQISFYFGYTMMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIY+NIKCD
Sbjct  568  CGAVGFLGSNLFVRRIYKNIKCD  590



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  444  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  564  CGAVGYLGSTLFVRRIYRNIKCD  586



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  441  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAAST++YVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFC+GLGIL
Sbjct  501  LNAENYHWQWTSFFSAASTSLYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCMGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGYLGSNLFVRRIYRNIKCD  583



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  472  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  531

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  532  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  591

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  592  CGAVGYLGSNLFVRRIYRNIKCD  614



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>emb|CDY54577.1| BnaCnng27330D [Brassica napus]
Length=513

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  371  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFL  430

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  431  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  490

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  491  CGAVGFLGSNLFVRRIYRNIKCD  513



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSTLFVRRIYRNIKCD  587



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  446  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGS+LFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  446  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGS+LFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  441  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  501  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  561  CGAVGYLGSTLFVRRIYRNIKCD  583



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  448  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  568  CGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSNLFVRRIYRNIKCD  587



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  429  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFL  488

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  489  LNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  548

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  549  CGAIGYLGSTLFVRRIYRNIKCD  571



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  446  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  566  CGAVGYLGSNLFVRRIYRNIKCD  588



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  450  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSN+FVRRIYRNIKCD
Sbjct  570  CGAVGYLGSNMFVRRIYRNIKCD  592



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   208 bits (529),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  444  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  564  CGAVGYLGSTLFVRRIYRNIKCD  586



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  444  TVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSN+FVRRIYRNIKCD
Sbjct  564  CGAVGYLGSNMFVRRIYRNIKCD  586



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  444  TVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSN+FVRRIYRNIKCD
Sbjct  564  CGAVGYLGSNMFVRRIYRNIKCD  586



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  443  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  563  CGAIGYLGSTLFVRRIYRNIKCD  585



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  440  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFL  499

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHW+WTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  500  LNAENYHWRWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGIL  559

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  560  CGAVGYLGSNLFVRRIYRNIKCD  582



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  607  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFMILMIVTVCVTIVGTYFL  666

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA YVY YSIYYYY+KTK+SGFFQ SFY GYTLM CLGLGIL
Sbjct  667  LNAENYHWQWTSFFSAASTAFYVYFYSIYYYYMKTKMSGFFQTSFYFGYTLMLCLGLGIL  726

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  727  CGAVGFLGSNLFVRRIYRNIKCD  749



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  416  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  475

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  476  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  535

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS +FVRRIYRNIKCD
Sbjct  536  CGAVGYLGSTMFVRRIYRNIKCD  558



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  451  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  510

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  511  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  570

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  571  CGAVGYLGSTLFVRRIYRNIKCD  593



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVTVCVTIVGTYFL
Sbjct  440  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFIILIIVTVCVTIVGTYFL  499

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHW+WTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  500  LNAENYHWRWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGIL  559

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  560  CGAVGYLGSNLFVRRIYRNIKCD  582



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  563  CGAIGYLGSTLFVRRIYRNIKCD  585



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  444  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  504  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS +FVRRIYRNIKCD
Sbjct  564  CGAVGYLGSTMFVRRIYRNIKCD  586



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  443  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  503  LNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  563  CGAIGYLGSTLFVRRIYRNIKCD  585



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  422  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  481

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  482  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  541

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  542  CGAVGFLGSNLFVRRIYRNIKCD  564



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  452  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  511

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  512  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  571

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  572  CGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   207 bits (527),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLL
Sbjct  447  VVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLL  506

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHWQWTSFFSAASTAVYVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGILC
Sbjct  507  NAENYHWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGILC  566

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GAVG+LGS LFVRRIYRNIKCD
Sbjct  567  GAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  569  CGAVGFLGSNLFVRRIYRNIKCD  591



>ref|XP_011092339.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Sesamum 
indicum]
Length=460

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIV  YFL
Sbjct  318  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVSIYFL  377

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY YSIYYYYVKTK+SG FQ SFY GYTLMFCLGLGIL
Sbjct  378  LNAENYHWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGLFQTSFYFGYTLMFCLGLGIL  437

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSN+FVRRIYRNIKCD
Sbjct  438  CGAVGYLGSNMFVRRIYRNIKCD  460



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYV+LYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVFLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  565  CGAVGYLGSTLFVRRIYRNIKCD  587



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  410  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  469

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  470  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  529

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++GS LFVRRIYRNIKCD
Sbjct  530  CGAIGYVGSTLFVRRIYRNIKCD  552



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  453  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  512

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  513  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  572

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++GS LFVRRIYRNIKCD
Sbjct  573  CGAIGYVGSTLFVRRIYRNIKCD  595



>dbj|BAF01745.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=136

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = -2

Query  738  GLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYH  559
            GLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYH
Sbjct  1    GLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYH  60

Query  558  WQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCGAVGFL  379
            WQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGILCGAVG+L
Sbjct  61   WQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYL  120

Query  378  GSNLFVRRIYRNIKCD  331
            GSNLFVRRIYRNIKCD
Sbjct  121  GSNLFVRRIYRNIKCD  136



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTAIYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  569  CGAVGYLGSTLFVRRIYRNIKCD  591



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  474  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  533

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  534  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  593

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS +FVRRIYRNIKCD
Sbjct  594  CGAVGYLGSTMFVRRIYRNIKCD  616



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  452  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  511

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  512  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  571

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  572  CGAVGFLGSNLFVRRIYRNIKCD  594



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  453  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  512

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY+YSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  513  LNAENYHWQWTSFFSAASTAVYVYIYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  572

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  573  CGAVGFLGSNLFVRRIYRNIKCD  595



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  438  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  497

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  498  LNAENYHWQWTSFLSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  557

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  558  CGAIGYLGSTLFVRRIYRNIKCD  580



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAAST+VYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTSVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  569  CGAVGFLGSNLFVRRIYRNIKCD  591



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYY+YVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGFLGSNLFVRRIYRNIKCD  587



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS  FVRRIYRNIKCD
Sbjct  569  CGAVGYLGSTFFVRRIYRNIKCD  591



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYY+YVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  568  CGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAAST+VYVYLYSIYYYY+KTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTSVYVYLYSIYYYYMKTKMSGFFQTSFYFGYTLMFSLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  445  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYY+YVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  565  CGAVGFLGSNLFVRRIYRNIKCD  587



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYY+YVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYFYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  568  CGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  455  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  514

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  515  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  574

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++GS LFVRRIYRNIKCD
Sbjct  575  CGAIGYVGSTLFVRRIYRNIKCD  597



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL IVTVCVTIVGTYFL
Sbjct  447  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILTIVTVCVTIVGTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAAST+VYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMF LGLGIL
Sbjct  507  LNAENYHWQWTSFFSAASTSVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFSLGLGIL  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  567  CGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  453  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  512

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  513  LNAENYHWQWTSFFSAASTAIYVYLYSIYYYHVKTKMSGFFQTSFYFGYTMMFCLGLGIL  572

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  573  CGAVGYLGSKLFVRRIYRNIKCD  595



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  485  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFL  544

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  545  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  604

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  605  CGAVGFLGSNLFVRRIYRNIKCD  627



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFL
Sbjct  452  TVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFL  511

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGIL
Sbjct  512  LNAENYHWQWTSFFSAASTAIYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGIL  571

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGSNLFVRRIYRNIKCD
Sbjct  572  CGAVGFLGSNLFVRRIYRNIKCD  594



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ  FY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTGFYFGYTLMFCLGLGIL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  568  CGAVGYLGSTLFVRRIYRNIKCD  590



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  456  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  515

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  516  LNAENYHWQWTSFLSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  575

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  576  CGAIGYLGSTLFVRRIYRNIKCD  598



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFLSAASTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  569  CGAVGYLGSTLFVRRIYRNIKCD  591



>ref|XP_001785033.1| predicted protein [Physcomitrella patens]
 gb|EDQ50148.1| predicted protein, partial [Physcomitrella patens]
Length=325

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVV+++GGLLP GSIFIEMYFVFTSFW YKVYYVYGFMLLVF+IL IVTVCVTIVGTYFL
Sbjct  183  SVVALLGGLLPFGSIFIEMYFVFTSFWQYKVYYVYGFMLLVFIILTIVTVCVTIVGTYFL  242

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA YVYLYS+YY+Y+KTK+SGFFQ+SFY GYTLMFCLGLGI 
Sbjct  243  LNAENYHWQWTSFLSAASTAGYVYLYSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIF  302

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS++FVRRIYRNIKCD
Sbjct  303  CGAVGYLGSSMFVRRIYRNIKCD  325



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVT+CVTIVG+YFL
Sbjct  449  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTICVTIVGSYFL  508

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  509  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  568

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS+LF+RRIYRNIKCD
Sbjct  569  CGAVGYLGSSLFIRRIYRNIKCD  591



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  443  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  563  CGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            VVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLL
Sbjct  429  VVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLL  488

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGILC
Sbjct  489  NAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILC  548

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GAVGFLGSNLFVRRIYRNIKCD
Sbjct  549  GAVGFLGSNLFVRRIYRNIKCD  570



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  446  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSA STAVYVYLYS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGS+LFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  446  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  566  CGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score =   204 bits (520),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  443  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  563  CGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIV  YFL
Sbjct  446  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVSIYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY YSIYYYYVKTK+SG FQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYFYSIYYYYVKTKMSGLFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSN+FVRRIYRNIKCD
Sbjct  566  CGAVGYLGSNMFVRRIYRNIKCD  588



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  426  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  485

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  486  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGTL  545

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  546  CGAVGYLGSTLFVRRIYRNIKCD  568



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   204 bits (520),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  454  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  513

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  514  LNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  573

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  574  CGAIGYLGSTLFVRRIYRNIKCD  596



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  450  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  570  CGAIGYLGSTLFVRRIYRNIKCD  592



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  443  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  503  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTL  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  563  CGAVGYLGSTLFVRRIYRNIKCD  585



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  448  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGTL  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  568  CGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  446  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSA STAVYVYLYS+YYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAFSTAVYVYLYSVYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVGFLGS+LFVRRIYRNIKCD
Sbjct  566  CGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S++S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVG YFL
Sbjct  446  SIISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTMCVTIVGAYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYY+KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYMKTKMSGFFQTSFYFGYTLMFCLGLGIL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS +FVRRIYRNIKCD
Sbjct  566  CGAVGYLGSTMFVRRIYRNIKCD  588



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVT+CVTIVGTYFL
Sbjct  452  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTICVTIVGTYFL  511

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  512  LNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  571

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G+LGS LFVRRIYRNIKCD
Sbjct  572  CGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S++S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVG YFL
Sbjct  493  SIISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTMCVTIVGAYFL  552

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYS+YYYY+KTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  553  LNAENYHWQWTSFFSAASTAVYVYLYSVYYYYMKTKMSGFFQTSFYFGYTLMFCLGLGIL  612

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS +FVRRIYRNIKCD
Sbjct  613  CGAVGYLGSTMFVRRIYRNIKCD  635



>ref|XP_003592977.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=446

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  304  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  363

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENY+WQWTSF SAAST VYVYLYSIYYYYVKTK+SGFFQ SFY GYT MFCLGLGIL
Sbjct  364  LNAENYNWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTAMFCLGLGIL  423

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG LGSNLFVRRIYRNIKCD
Sbjct  424  CGAVGHLGSNLFVRRIYRNIKCD  446



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILI+VTVCVTIVGTYFL
Sbjct  416  SVISIMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIVVTVCVTIVGTYFL  475

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YV  YS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  476  LNAENYHWQWTSFFSAASTALYVLFYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  535

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS+LFV+RIYRNIK D
Sbjct  536  CGAVGYLGSDLFVKRIYRNIKLD  558



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  441  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENY+WQWTSF SAAST VYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  501  LNAENYNWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  441  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENY+WQWTSF SAAST VYVYLYSIYYYYVKTK+SGFFQ SFY GYT+MFCLGLGIL
Sbjct  501  LNAENYNWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTMMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S+V++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+IL+IVTVCVTIVGTYFL
Sbjct  445  SIVALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILLIVTVCVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA YVYLYS+YYY++KTK+SGFFQ SFY GYTLM C+GLG L
Sbjct  505  LNAENYHWQWTSFFSAASTAAYVYLYSVYYYFMKTKMSGFFQTSFYFGYTLMLCVGLGSL  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS++FVRRIYRNIKCD
Sbjct  565  CGAVGYLGSSVFVRRIYRNIKCD  587



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILI+VTVCVTIVGTYFL
Sbjct  441  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIVVTVCVTIVGTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENY+WQWTSF SAAST VYVYLYSIYYYYVKTK+SGFFQ SFY GYT MFCLGLGIL
Sbjct  501  LNAENYNWQWTSFLSAASTGVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTAMFCLGLGIL  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG LGSNLFVRRIYRNIKCD
Sbjct  561  CGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score =   199 bits (506),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVT+CVTIVGTYFL
Sbjct  446  SVIALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLIVTICVTIVGTYFL  505

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYY VKTK+SGFFQ SFY GYTLMFCLGLG L
Sbjct  506  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYNVKTKMSGFFQTSFYFGYTLMFCLGLGTL  565

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS LFVRRIYRNIKCD
Sbjct  566  CGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVV+++GGLLP GSIFIEMYFVFTSFW YKVYYVYGFMLLVF+IL IVTVCVTIVGTYFL
Sbjct  448  SVVALLGGLLPFGSIFIEMYFVFTSFWQYKVYYVYGFMLLVFIILTIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF SAASTA YVYLYS+YY+Y+KTK+SGFFQ+SFY GYTLMFCLGLGI 
Sbjct  508  LNAENYHWQWTSFLSAASTAGYVYLYSVYYFYMKTKMSGFFQISFYFGYTLMFCLGLGIF  567

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS++FVRRIYRNIKCD
Sbjct  568  CGAVGYLGSSMFVRRIYRNIKCD  590



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 138/149 (93%), Gaps = 6/149 (4%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYF-  583
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYF 
Sbjct  450  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFA  509

Query  582  -----LLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFC  418
                 LLNAENY+WQWTSF SAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFC
Sbjct  510  XXXXXLLNAENYNWQWTSFLSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFC  569

Query  417  LGLGILCGAVGFLGSNLFVRRIYRNIKCD  331
            LGLGILCGAVG++GSNLFVRRIYRNIKCD
Sbjct  570  LGLGILCGAVGYMGSNLFVRRIYRNIKCD  598



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 5/143 (3%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGT   
Sbjct  441  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGT---  497

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
              AENYHWQWTSFFSAASTA+YVY YSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  498  --AENYHWQWTSFFSAASTALYVYFYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  555

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLFVRRIYRNIKCD
Sbjct  556  CGAVGYLGSNLFVRRIYRNIKCD  578



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S+V++MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  444  SIVALMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLIVTVCVTIVGTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA YVYLYS+YYY++KTK+SGFFQ SFY GYTLM C+GLG L
Sbjct  504  LNAENYHWQWTSFFSAASTAAYVYLYSVYYYFMKTKMSGFFQTSFYFGYTLMLCVGLGSL  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGS++FVRRIYRNIKCD
Sbjct  564  CGAVGYLGSSVFVRRIYRNIKCD  586



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  753  VSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLN  574
            V  +   +P  +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLN
Sbjct  404  VKTIPRPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLN  463

Query  573  AENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCG  394
            AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGILCG
Sbjct  464  AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCG  523

Query  393  AVGFLGSNLFVRRIYRNIKCD  331
            AVGFLGSNLFVRRIYRNIKCD
Sbjct  524  AVGFLGSNLFVRRIYRNIKCD  544



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  753  VSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLN  574
            V  +   +P  +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLN
Sbjct  435  VKTIPRPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLN  494

Query  573  AENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCG  394
            AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGILCG
Sbjct  495  AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCG  554

Query  393  AVGFLGSNLFVRRIYRNIKCD  331
            AVGFLGSNLFVRRIYRNIKCD
Sbjct  555  AVGFLGSNLFVRRIYRNIKCD  575



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  753  VSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLN  574
            V  +   +P  +IFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLN
Sbjct  407  VKTIPRPIPEKNIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLN  466

Query  573  AENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCG  394
            AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+ GFFQ SFY GYTLMFCLGLGILCG
Sbjct  467  AENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCG  526

Query  393  AVGFLGSNLFVRRIYRNIKCD  331
            AVGFLGSNLFVRRIYRNIKCD
Sbjct  527  AVGFLGSNLFVRRIYRNIKCD  547



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+++MGGLLP GSIFIEMYF+FTSFWNYKVYYVYGFMLLVFLIL I+TVCVTIVGTYFL
Sbjct  468  TVIALMGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFMLLVFLILAIMTVCVTIVGTYFL  527

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSF +AASTA+YV+LY+++Y++VKTK++GFFQ  FY GYTLMFCLGL I+
Sbjct  528  LNAENYHWQWTSFCAAASTALYVFLYAVHYFFVKTKMTGFFQTCFYFGYTLMFCLGLSIM  587

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
             GA+G+LGS +FVRRIYRNIKCD
Sbjct  588  TGALGYLGSAIFVRRIYRNIKCD  610



>ref|NP_001140443.1| uncharacterized protein LOC100272502 [Zea mays]
 gb|ACF83850.1| unknown [Zea mays]
Length=125

 Score =   174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -2

Query  705  MYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAAS  526
            MYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAAS
Sbjct  1    MYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAAS  60

Query  525  TAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCGAVGFLGSNLFVRRIYR  346
            TAVYVYLYSIYYY++KTK+SGFFQ SFY GYTLMFCLGLG LCGAVG+LGS LFVRRIYR
Sbjct  61   TAVYVYLYSIYYYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYR  120

Query  345  NIKCD  331
            NIKCD
Sbjct  121  NIKCD  125



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYF  583
            SV+SM+GGLLP GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYF
Sbjct  440  SVISMVGGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYF  499

Query  582  LLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGI  403
            LLNAENYHWQWTSFFSAASTA YVYLYSIYYYY KT++ G FQ S Y GYTLMFCLGLG 
Sbjct  500  LLNAENYHWQWTSFFSAASTAFYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGT  559

Query  402  LCGAVGFLGSNLFVRRIYRNIKCD  331
            LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  560  LCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ ++GGLLP GSIFIE YFVFTS WNYKVYYVYGF LLVF+IL+IVT+CVT+VGTYFLL
Sbjct  488  VIGVVGGLLPFGSIFIETYFVFTSIWNYKVYYVYGFFLLVFMILMIVTLCVTVVGTYFLL  547

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHW WTSF SAASTA YVY+YSIYY+  KTK++GFFQ  FY GYT MFCLGLG++C
Sbjct  548  NAENYHWHWTSFISAASTAFYVYVYSIYYFIFKTKMTGFFQTCFYFGYTAMFCLGLGLMC  607

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GAVG+ G+N FVRRIYRNIKCD
Sbjct  608  GAVGYFGANAFVRRIYRNIKCD  629



>ref|XP_009631163.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=468

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYF  583
            S +SM+GGLLP GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYF
Sbjct  325  SAISMVGGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYF  384

Query  582  LLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGI  403
            LL+AENYHWQWTSF+SAASTA YVYLYSIYYYY KT++ G FQ S Y GYTLMFCLGLG 
Sbjct  385  LLSAENYHWQWTSFYSAASTACYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGT  444

Query  402  LCGAVGFLGSNLFVRRIYRNIKCD  331
            LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  445  LCGAVGYIGSNLFVRRIFSNIKCD  468



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKV-YYVYGFMllvfliliivtvcvtiVGTYF  583
            SV+S++GGLLP  SIFIEMY +F SFW Y V YYVYGF+LLVF++LIIVTVCVTIVGTY+
Sbjct  441  SVISLVGGLLPFASIFIEMYCIFASFWTYMVHYYVYGFLLLVFIVLIIVTVCVTIVGTYY  500

Query  582  LLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGI  403
            LLNAENYHWQWTSFFSAASTA+YVYLY+IYYY+ KT +SG  Q SFY GYTLMFCLG+GI
Sbjct  501  LLNAENYHWQWTSFFSAASTALYVYLYAIYYYHAKTSMSGLLQTSFYFGYTLMFCLGVGI  560

Query  402  LCGAVGFLGSNLFVRRIYRNIKCD  331
            LCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  561  LCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYY-VYGFMllvfliliivtvcvtiVGTYF  583
            S +SM+GGLLP GSIFIEMYF+F+SFW Y VYY VYGFMLLVF+ILIIVTVCVTIV TYF
Sbjct  440  SAISMVGGLLPFGSIFIEMYFIFSSFWTYMVYYHVYGFMLLVFIILIIVTVCVTIVATYF  499

Query  582  LLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGI  403
            LL+AENYHWQWTSF+SAASTA YVYLYSIYYYY KT++ G FQ S Y GYTLMFCLGLG 
Sbjct  500  LLSAENYHWQWTSFYSAASTACYVYLYSIYYYYAKTRMFGLFQTSVYFGYTLMFCLGLGT  559

Query  402  LCGAVGFLGSNLFVRRIYRNIKCD  331
            LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  560  LCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V++++GGLLP GSIFIEMYFVFTSFWNYKVYYVYGF LLVFLILIIVT+CVTIV +YFLL
Sbjct  450  VIALVGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFFLLVFLILIIVTICVTIVASYFLL  509

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHW WTSF + AST++YV+LYS++Y++ KTK++GFFQ +FY GYTLMFC+GL ++C
Sbjct  510  NAENYHWHWTSFGAGASTSLYVFLYSVHYFFWKTKMTGFFQTAFYFGYTLMFCVGLSVMC  569

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GAVG LG+ +FVRRIYRNIKCD
Sbjct  570  GAVGHLGAGVFVRRIYRNIKCD  591



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 1/143 (1%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKV-YYVYGFMllvfliliivtvcvtiVGTYFL  580
            V+S++GGLLP  SIF EMY++F SFW Y + YYVYGF+LLVF++LIIVT+CVTIVGTY+L
Sbjct  442  VISLVGGLLPFASIFTEMYYIFASFWTYMLHYYVYGFLLLVFIVLIIVTICVTIVGTYYL  501

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENY+WQWTSFFSAASTA+YVYLY+IYYY+ KTK+SG  Q SFY GYTLMFCLG+GIL
Sbjct  502  LNAENYNWQWTSFFSAASTALYVYLYAIYYYHSKTKMSGLLQTSFYFGYTLMFCLGVGIL  561

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG+LGSNLF+RRI+ NIKCD
Sbjct  562  CGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            +++++GGLLP GSIFIEMYF+FTSFWNYKVYYVYGF LLVFLIL+IVTVCVTIVGTYFLL
Sbjct  448  IIALVGGLLPFGSIFIEMYFIFTSFWNYKVYYVYGFFLLVFLILLIVTVCVTIVGTYFLL  507

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHW WT+F + AST++YV LYS++Y+ +KTK++GFFQ +FY GYTLMFCLGL I+C
Sbjct  508  NAENYHWHWTAFSAGASTSLYVMLYSVHYFVMKTKMTGFFQTAFYFGYTLMFCLGLSIMC  567

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GA+G+LGS  FVRRI+RN+K D
Sbjct  568  GAIGYLGSLAFVRRIFRNVKVD  589



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILIIVT+CVTIVGTYFL
Sbjct  445  SVISLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIIVTICVTIVGTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYSIYYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  505  LNAENYHWQWTSFFSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  564

Query  399  CGAV  388
            CG V
Sbjct  565  CGTV  568



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 118/122 (97%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL
Sbjct  440  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTVCVTIVGTYFL  499

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  500  LNAENYHWQWTSFFSAASTAVYVYLYSIYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  559

Query  399  CG  394
            CG
Sbjct  560  CG  561



>gb|KFO35950.1| Phosphoinositide 3-kinase adapter protein 1 [Fukomys damarensis]
Length=1303

 Score =   172 bits (436),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759   SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
             +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  1161  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  1220

Query  579   LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
             LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  1221  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  1280

Query  399   CGAVGFLGSNLFVRRIYRNIKCD  331
             CGA+G++G++ FVR+IY N+K D
Sbjct  1281  CGAIGYMGTSAFVRKIYTNVKID  1303



>gb|KDD76545.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=572

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
             V+ +GG+LP GSIFIEMYFVFTSFWNYKVYYVYGF LLVF+IL++VT+CVT+V TYFLL
Sbjct  431  AVAALGGVLPFGSIFIEMYFVFTSFWNYKVYYVYGFFLLVFIILLVVTLCVTVVATYFLL  490

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHW W SF + AST++YV+LYS++Y++VKTK++GFFQ +FY GYTLMFC+GL ++C
Sbjct  491  NAENYHWHWASFGAGASTSIYVWLYSVHYFFVKTKMTGFFQTTFYFGYTLMFCIGLSVMC  550

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G+VG+LG++ FVRRIY+NIKCD
Sbjct  551  GSVGYLGASAFVRRIYKNIKCD  572



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
             + M GGLLP GSIFIEMYFVFTSFWNYKVYY+YGF+LLV LIL++VTVCVTIVGTYFLL
Sbjct  455  AICMAGGLLPFGSIFIEMYFVFTSFWNYKVYYIYGFLLLVVLILLVVTVCVTIVGTYFLL  514

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAENYHWQWT+F  +AST+ YV+LYS++Y+  KTK++G FQ  FY GYT MFCLGL +LC
Sbjct  515  NAENYHWQWTAFGMSASTSFYVFLYSVHYFLFKTKMTGLFQTCFYFGYTSMFCLGLALLC  574

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            GAVG++ +  FVR IYRN+KCD
Sbjct  575  GAVGYMAAAAFVRTIYRNVKCD  596



>gb|KHG20579.1| Tm9sf3 [Gossypium arboreum]
Length=626

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  474  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  533

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYS+YYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  534  LNAENYHWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGIL  593

Query  399  C  397
            C
Sbjct  594  C  594



>gb|KHG20578.1| Tm9sf3 [Gossypium arboreum]
Length=639

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  474  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  533

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYS+YYY VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  534  LNAENYHWQWTSFFSAASTAIYVYLYSVYYYSVKTKMSGFFQTSFYFGYTLMFCLGLGIL  593

Query  399  C  397
            C
Sbjct  594  C  594



>gb|KJB47460.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=571

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY+YS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  567

Query  399  CGA  391
            CG 
Sbjct  568  CGE  570



>gb|KJB47461.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=576

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 114/122 (93%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVS+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLIL+IVTVCVTIVGTYFL
Sbjct  448  SVVSLMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILVIVTVCVTIVGTYFL  507

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTAVYVY+YS+YYYYVKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  508  LNAENYHWQWTSFFSAASTAVYVYMYSVYYYYVKTKMSGFFQTSFYFGYTLMFCLGLGIL  567

Query  399  CG  394
            CG
Sbjct  568  CG  569



>gb|ETN57960.1| hypothetical protein AND_010453 [Anopheles darlingi]
Length=1505

 Score =   168 bits (426),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  759   SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
             +V+ ++GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVFLILIIVTVCVTIV TYFL
Sbjct  1363  AVIILLGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFLILIIVTVCVTIVCTYFL  1422

Query  579   LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
             LNAE+Y WQWTSF SAASTA+YVY+YS YY++ KTK+ G FQ SFY GY  +F   LG++
Sbjct  1423  LNAEDYRWQWTSFMSAASTAIYVYMYSFYYFFFKTKMYGLFQTSFYFGYMALFSGALGMI  1482

Query  399   CGAVGFLGSNLFVRRIYRNIKCD  331
             CG VG+ G+N+FVR+IY N+K D
Sbjct  1483  CGTVGYFGTNIFVRKIYSNVKID  1505



>ref|XP_009511961.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phalacrocorax 
carbo]
 ref|XP_009806564.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Gavia stellata]
 ref|XP_010146260.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Eurypyga helias]
Length=194

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  52   AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  111

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  112  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  171

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  172  CGAIGYMGTSAFVRKIYTNVKID  194



>ref|XP_006385204.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
 gb|ERP63001.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
Length=113

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  669  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  490
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  1    VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  60

Query  489  yyVKTKVSGFFQVSFYXGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  331
            +YVKTK+SGFFQ SFY GYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  61   FYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  113



>gb|KJB77693.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=569

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SVVSMMGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVT+CVTIVGTYFL
Sbjct  450  SVVSMMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFLILIIVTICVTIVGTYFL  509

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YVYLYS+YYY+VKTK+SGFFQ SFY GYTLMFCLGLGIL
Sbjct  510  LNAENYHWQWTSFFSAASTAIYVYLYSVYYYHVKTKMSGFFQTSFYFGYTLMFCLGLGIL  569



>ref|XP_009976834.1| PREDICTED: transmembrane 9 superfamily member 3 [Tauraco erythrolophus]
Length=266

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  124  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  183

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  184  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  243

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  244  CGAIGYMGTSAFVRKIYTNVKID  266



>gb|EPS62158.1| hypothetical protein M569_12635, partial [Genlisea aurea]
Length=537

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            SV+S+MGGLLP GSIFIEMYFVFTSFWNYKVYYVYGFMLLVF+ILI+VT+CVTIVGTYFL
Sbjct  416  SVISIMGGLLPFGSIFIEMYFVFTSFWNYKVYYVYGFMLLVFVILIVVTICVTIVGTYFL  475

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAENYHWQWTSFFSAASTA+YV+LYSIYYY++KT++SGFFQ +FY GYT MFCLGLGIL
Sbjct  476  LNAENYHWQWTSFFSAASTALYVFLYSIYYYHLKTRMSGFFQTTFYFGYTSMFCLGLGIL  535

Query  399  CG  394
            CG
Sbjct  536  CG  537



>dbj|BAG60075.1| unnamed protein product [Homo sapiens]
Length=254

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  112  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  171

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  172  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  231

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  232  CGAIGYMGTSAFVRKIYTNVKID  254



>dbj|BAB55110.1| unnamed protein product [Homo sapiens]
 dbj|BAC11397.1| unnamed protein product [Homo sapiens]
Length=329

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  187  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  246

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  247  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  306

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  307  CGAIGYMGTSAFVRKIYTNVKID  329



>ref|XP_008057299.1| PREDICTED: transmembrane 9 superfamily member 3 [Tarsius syrichta]
Length=359

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  217  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  276

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  277  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  336

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  337  CGAIGYMGTSAFVRKIYTNVKID  359



>ref|XP_003061693.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54323.1| predicted protein [Micromonas pusilla CCMP1545]
Length=623

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  753  VSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLN  574
            +S++GG+LP GSIFIE YFVFTS WNYKVYYVYGF LLVF IL+IVT CVT+V TYFLLN
Sbjct  483  ISLLGGVLPFGSIFIETYFVFTSMWNYKVYYVYGFFLLVFAILLIVTACVTVVATYFLLN  542

Query  573  AENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCG  394
            AEN+ W WT+F +AAS ++YVY YS+YY+  KTK++GFFQ  FY GYT MFCL L ++CG
Sbjct  543  AENWRWHWTAFNAAASVSLYVYAYSVYYFVFKTKMTGFFQTCFYFGYTAMFCLVLALVCG  602

Query  393  AVGFLGSNLFVRRIYRNIKCD  331
            A G++ +N FVRRIYRNIKCD
Sbjct  603  ATGYVAANAFVRRIYRNIKCD  623



>ref|XP_009951614.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Leptosomus 
discolor]
 ref|XP_010281856.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phaethon 
lepturus]
Length=395

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  253  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  312

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  313  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  372

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  373  CGAIGYMGTSAFVRKIYTNVKID  395



>ref|XP_009478867.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pelecanus 
crispus]
Length=383

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  241  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  300

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  301  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  360

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  361  CGAIGYMGTSAFVRKIYTNVKID  383



>dbj|BAC11232.1| unnamed protein product [Homo sapiens]
Length=399

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  257  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  316

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  317  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  376

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  377  CGAIGYMGTSAFVRKIYTNVKID  399



>ref|XP_006756739.1| PREDICTED: transmembrane 9 superfamily member 3 [Myotis davidii]
Length=401

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  259  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  318

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  319  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  378

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  379  CGAIGYMGTSAFVRKIYTNVKID  401



>ref|XP_003399780.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
terrestris]
 ref|XP_003493708.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
impatiens]
Length=584

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  443  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  502

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF SAASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  503  NAEDYRWQWTSFLSAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  562

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  563  GTVGYVGTNAFVRKIYSTVKID  584



>ref|XP_008942019.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Merops 
nubicus]
 ref|XP_010161341.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Caprimulgus 
carolinensis]
 ref|XP_010075805.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pterocles 
gutturalis]
Length=448

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  306  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  365

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  366  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  425

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  426  CGAIGYMGTSAFVRKIYTNVKID  448



>ref|XP_003704134.1| PREDICTED: transmembrane 9 superfamily member 3 [Megachile rotundata]
Length=586

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  445  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  504

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  505  NAEDYRWQWTSFLAAASTAAYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  564

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  565  GTVGYVGTNAFVRKIYSTVKID  586



>gb|KFU99061.1| Transmembrane 9 superfamily member 3, partial [Pterocles gutturalis]
Length=449

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  307  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  366

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  367  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  426

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  427  CGAIGYMGTSAFVRKIYTNVKID  449



>ref|XP_011259429.1| PREDICTED: transmembrane 9 superfamily member 3 [Camponotus floridanus]
 gb|EFN66277.1| Transmembrane 9 superfamily member 3 [Camponotus floridanus]
Length=588

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  447  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  506

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  507  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  566

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  567  GTVGYIGTNAFVRKIYSTVKID  588



>ref|XP_011352435.1| PREDICTED: transmembrane 9 superfamily member 3 [Cerapachys biroi]
 gb|EZA60571.1| Transmembrane 9 superfamily member [Cerapachys biroi]
Length=588

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  447  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  506

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  507  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  566

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  567  GTVGYIGTNAFVRKIYSTVKID  588



>ref|XP_011155183.1| PREDICTED: transmembrane 9 superfamily member 3 [Harpegnathos 
saltator]
 ref|XP_011155184.1| PREDICTED: transmembrane 9 superfamily member 3 [Harpegnathos 
saltator]
 gb|EFN87604.1| Transmembrane 9 superfamily member 3 [Harpegnathos saltator]
Length=584

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  443  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  502

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  503  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  562

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  563  GTVGYIGTNAFVRKIYSTVKID  584



>ref|XP_011163701.1| PREDICTED: transmembrane 9 superfamily member 3 [Solenopsis invicta]
Length=584

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYFVFTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  443  VIIMLGGILPFGSIFIEMYFVFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  502

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  503  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  562

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  563  GTVGYIGTNAFVRKIYSTVKID  584



>dbj|BAE91187.1| unnamed protein product [Macaca fascicularis]
Length=487

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  345  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  404

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  405  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  464

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  465  CGAIGYMGTSAFVRKIYTNVKID  487



>ref|XP_011056752.1| PREDICTED: transmembrane 9 superfamily member 3 [Acromyrmex echinatior]
 gb|EGI63922.1| Transmembrane 9 superfamily member 3 [Acromyrmex echinatior]
Length=588

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            ++ M+GG+LP GSIFIEMYFVFTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  447  IIIMLGGILPFGSIFIEMYFVFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  506

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  507  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  566

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  567  GTVGYIGTNAFVRKIYSTVKID  588



>gb|AAQ89178.1| PATY245 [Homo sapiens]
Length=487

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  345  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  404

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  405  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  464

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  465  CGAIGYMGTSAFVRKIYTNVKID  487



>ref|XP_006263564.1| PREDICTED: transmembrane 9 superfamily member 3-like [Alligator 
mississippiensis]
Length=511

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  369  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  428

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  429  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  488

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  489  CGAIGYMGTSAFVRKIYTNVKID  511



>ref|XP_006610901.1| PREDICTED: transmembrane 9 superfamily member 3-like [Apis dorsata]
Length=586

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  445  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  504

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  505  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  564

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  565  GTVGYVGTNAFVRKIYSTVKID  586



>ref|XP_006572161.1| PREDICTED: transmembrane 9 superfamily member 3 [Apis mellifera]
Length=586

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  445  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  504

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  505  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  564

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  565  GTVGYVGTNAFVRKIYSTVKID  586



>ref|XP_003698368.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Apis florea]
Length=586

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  756  VVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLL  577
            V+ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF+IL+IVTVCVTIV TYFLL
Sbjct  445  VIIMLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFVILMIVTVCVTIVCTYFLL  504

Query  576  NAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILC  397
            NAE+Y WQWTSF +AASTA YVY+YS YY++ KTK+ G FQ +FY GY  +F L LGI+C
Sbjct  505  NAEDYRWQWTSFLAAASTAGYVYIYSFYYFFFKTKMYGLFQTAFYFGYMALFSLALGIMC  564

Query  396  GAVGFLGSNLFVRRIYRNIKCD  331
            G VG++G+N FVR+IY  +K D
Sbjct  565  GTVGYVGTNAFVRKIYSTVKID  586



>ref|XP_007441347.1| PREDICTED: transmembrane 9 superfamily member 3-like [Python 
bivittatus]
Length=487

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  345  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  404

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  405  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  464

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  465  CGAIGYMGTSAFVRKIYTNVKID  487



>ref|XP_007615223.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Cricetulus 
griseus]
Length=487

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  345  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  404

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  405  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  464

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  465  CGAIGYMGTSAFVRKIYTNVKID  487



>gb|AAH20959.2| TM9SF3 protein, partial [Homo sapiens]
Length=521

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  379  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  438

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  439  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  498

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  499  CGAIGYMGTSAFVRKIYTNVKID  521



>ref|XP_007258750.1| PREDICTED: transmembrane 9 superfamily member 3-like [Astyanax 
mexicanus]
Length=587

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  445  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  505  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  565  CGAVGYMGTSAFVRKIYTNVKID  587



>ref|XP_006630785.1| PREDICTED: transmembrane 9 superfamily member 3-like [Lepisosteus 
oculatus]
Length=586

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_003441118.1| PREDICTED: transmembrane 9 superfamily member 3 [Oreochromis 
niloticus]
Length=586

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_006799085.1| PREDICTED: transmembrane 9 superfamily member 3-like [Neolamprologus 
brichardi]
Length=624

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  482  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  541

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  542  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  601

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  602  CGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_010018436.1| PREDICTED: transmembrane 9 superfamily member 3 [Nestor notabilis]
Length=520

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  378  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  437

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  438  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  497

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  498  CGAIGYMGTSAFVRKIYTNVKID  520



>ref|XP_008282853.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Stegastes partitus]
Length=624

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  482  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  541

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  542  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  601

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  602  CGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_009916579.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_010566033.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
leucocephalus]
Length=519

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  377  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  436

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  437  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  496

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  497  CGAIGYMGTSAFVRKIYTNVKID  519



>ref|XP_005997314.1| PREDICTED: transmembrane 9 superfamily member 3 [Latimeria chalumnae]
Length=587

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  445  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  505  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  565  CGAIGYMGTSAFVRKIYTNVKID  587



>ref|XP_008428273.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Poecilia 
reticulata]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_007566966.1| PREDICTED: transmembrane 9 superfamily member 3 [Poecilia formosa]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_005795250.1| PREDICTED: transmembrane 9 superfamily member 3-like [Xiphophorus 
maculatus]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_006157459.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Tupaia 
chinensis]
Length=577

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  435  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  494

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  495  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  554

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  555  CGAIGYMGTSAFVRKIYTNVKID  577



>ref|NP_998554.1| transmembrane 9 superfamily member 3 precursor [Danio rerio]
 gb|AAH46021.1| Transmembrane 9 superfamily member 3 [Danio rerio]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>gb|AAH04799.2| Tm9sf3 protein, partial [Mus musculus]
Length=513

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  371  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  430

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  431  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  490

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  491  CGAIGYMGTSAFVRKIYTNVKID  513



>ref|XP_007902753.1| PREDICTED: transmembrane 9 superfamily member 3 [Callorhinchus 
milii]
Length=585

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  443  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  503  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  563  CGAVGYMGTSAFVRKIYTNVKID  585



>gb|ELK35693.1| Transmembrane 9 superfamily member 3 [Myotis davidii]
Length=513

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  371  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  430

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  431  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  490

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  491  CGAIGYMGTSAFVRKIYTNVKID  513



>ref|XP_005735123.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pundamilia 
nyererei]
 ref|XP_005927107.1| PREDICTED: transmembrane 9 superfamily member 3-like [Haplochromis 
burtoni]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_011182989.1| PREDICTED: transmembrane 9 superfamily member 3 [Bactrocera cucurbitae]
 ref|XP_011182998.1| PREDICTED: transmembrane 9 superfamily member 3 [Bactrocera cucurbitae]
Length=583

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            S++ M+GG+LP GSIFIEMYF+FTSFW YK+YYVYGFMLLVF IL+IVTVCVTIV TYFL
Sbjct  441  SIIIMLGGVLPFGSIFIEMYFIFTSFWAYKIYYVYGFMLLVFTILMIVTVCVTIVCTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAAST++YVY YS YY++ KTK+ G FQ +FY GY  +F   LGI+
Sbjct  501  LNAEDYRWQWTSFMSAASTSIYVYAYSFYYFFFKTKMYGLFQTAFYFGYMALFSGALGII  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CG VG+LG+++FVR+IY N+K D
Sbjct  561  CGTVGYLGTSVFVRKIYSNVKID  583



>ref|XP_003787418.1| PREDICTED: transmembrane 9 superfamily member 3 [Otolemur garnettii]
Length=541

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  399  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  458

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  459  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  518

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  519  CGAIGYMGTSAFVRKIYTNVKID  541



>ref|XP_010779545.1| PREDICTED: transmembrane 9 superfamily member 3 [Notothenia coriiceps]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTSLGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_004559661.1| PREDICTED: transmembrane 9 superfamily member 3-like [Maylandia 
zebra]
Length=624

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  482  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  541

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  542  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  601

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  602  CGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_008428274.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Poecilia 
reticulata]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  523  CGAVGYMGTSAFVRKIYTNVKID  545



>ref|XP_004616433.1| PREDICTED: transmembrane 9 superfamily member 3 [Sorex araneus]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_003963762.1| PREDICTED: transmembrane 9 superfamily member 3-like [Takifugu 
rubripes]
Length=586

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  444  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  503

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  504  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  563

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  564  CGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_008948979.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pan paniscus]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005153929.1| PREDICTED: transmembrane 9 superfamily member 3 [Melopsittacus 
undulatus]
 ref|XP_009887052.1| PREDICTED: transmembrane 9 superfamily member 3 [Charadrius vociferus]
 ref|XP_010142086.1| PREDICTED: transmembrane 9 superfamily member 3 [Buceros rhinoceros 
silvestris]
 ref|XP_010189169.1| PREDICTED: transmembrane 9 superfamily member 3 [Mesitornis unicolor]
 ref|XP_010202388.1| PREDICTED: transmembrane 9 superfamily member 3 [Colius striatus]
 ref|XP_010218523.1| PREDICTED: transmembrane 9 superfamily member 3 [Tinamus guttatus]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>gb|KFP32607.1| Transmembrane 9 superfamily member 3, partial [Colius striatus]
Length=555

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  413  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  472

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  473  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  532

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  533  CGAIGYMGTSAFVRKIYTNVKID  555



>ref|XP_006116276.1| PREDICTED: transmembrane 9 superfamily member 3 [Pelodiscus sinensis]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_007637675.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2, partial 
[Cricetulus griseus]
Length=568

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  426  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  485

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  486  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  545

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  546  CGAIGYMGTSAFVRKIYTNVKID  568



>ref|XP_004892237.1| PREDICTED: transmembrane 9 superfamily member 3 [Heterocephalus 
glaber]
Length=569

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  427  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  486

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  487  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  546

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  547  CGAIGYMGTSAFVRKIYTNVKID  569



>ref|XP_004580070.1| PREDICTED: transmembrane 9 superfamily member 3 [Ochotona princeps]
Length=587

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  445  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  504

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  505  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  564

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  565  CGAIGYMGTSAFVRKIYTNVKID  587



>ref|XP_009705892.1| PREDICTED: transmembrane 9 superfamily member 3 [Cariama cristata]
 ref|XP_010127919.1| PREDICTED: transmembrane 9 superfamily member 3 [Chlamydotis 
macqueenii]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_009574595.1| PREDICTED: transmembrane 9 superfamily member 3 [Fulmarus glacialis]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_011285801.1| PREDICTED: transmembrane 9 superfamily member 3 [Felis catus]
Length=561

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  419  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  478

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  479  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  538

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  539  CGAIGYMGTSAFVRKIYTNVKID  561



>ref|XP_010712722.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Meleagris 
gallopavo]
Length=556

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  414  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  473

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  474  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  533

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  534  CGAIGYMGTSAFVRKIYTNVKID  556



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  753  VSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFLLN  574
            +S+ GGLLP GSIFIE YFVFTS W+YKVYYVYGF LLVF IL+IVT+C+TIVGTYFLLN
Sbjct  473  ISVAGGLLPFGSIFIETYFVFTSIWSYKVYYVYGFFLLVFCILVIVTLCITIVGTYFLLN  532

Query  573  AENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGILCG  394
            AEN+ WQWT+F SAAS A YVYLYSIYY+  KTK++GFFQ  FY GYT MFCL LGI  G
Sbjct  533  AENHKWQWTAFNSAASVAGYVYLYSIYYFAFKTKMTGFFQTCFYFGYTAMFCLALGITTG  592

Query  393  AVGFLGSNLFVRRIYRNIKCD  331
            A+G+ G++ FVR+IYRNIK D
Sbjct  593  AIGYCGASAFVRKIYRNIKVD  613



>gb|AAF98159.1|AF269150_1 transmembrane protein TM9SF3 [Homo sapiens]
Length=589

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  447  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  507  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  567  CGAIGYMGTSAFVRKIYTNVKID  589



>ref|NP_064508.3| transmembrane 9 superfamily member 3 precursor [Homo sapiens]
 ref|XP_009457308.1| PREDICTED: transmembrane 9 superfamily member 3 [Pan troglodytes]
 sp|Q9HD45.2|TM9S3_HUMAN RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=EP70-P-iso; AltName: Full=SM-11044-binding protein; Flags: 
Precursor [Homo sapiens]
 gb|EAW49972.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|EAW49974.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|AAI36790.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 gb|AAI36789.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 tpg|DAA64544.1| TPA_exp: dinucleotide oxidase disulfide thiol exchanger 3 superfamily 
member 3 [Homo sapiens]
Length=589

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  447  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  506

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  507  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  566

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  567  CGAIGYMGTSAFVRKIYTNVKID  589



>ref|XP_005312131.1| PREDICTED: transmembrane 9 superfamily member 3 [Chrysemys picta 
bellii]
Length=583

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  441  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  500

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  501  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  560

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  561  CGAIGYMGTSAFVRKIYTNVKID  583



>emb|CDQ61092.1| unnamed protein product [Oncorhynchus mykiss]
Length=640

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  498  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  557

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  558  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTSLGIM  617

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  618  CGAVGYVGTSAFVRKIYTNVKID  640



>ref|XP_009669621.1| PREDICTED: transmembrane 9 superfamily member 3 [Struthio camelus 
australis]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYTYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005025241.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Anas 
platyrhynchos]
 ref|XP_005234638.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco peregrinus]
 ref|XP_005441661.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco cherrug]
 ref|XP_005500101.1| PREDICTED: transmembrane 9 superfamily member 3 [Columba livia]
 ref|XP_009075359.1| PREDICTED: transmembrane 9 superfamily member 3 [Acanthisitta 
chloris]
 ref|XP_009275969.1| PREDICTED: transmembrane 9 superfamily member 3 [Aptenodytes 
forsteri]
 ref|XP_009320681.1| PREDICTED: transmembrane 9 superfamily member 3 [Pygoscelis adeliae]
 ref|XP_009569010.1| PREDICTED: transmembrane 9 superfamily member 3 [Cuculus canorus]
 ref|XP_009640318.1| PREDICTED: transmembrane 9 superfamily member 3 [Egretta garzetta]
 ref|XP_009916578.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_009937749.1| PREDICTED: transmembrane 9 superfamily member 3 [Opisthocomus 
hoazin]
 ref|XP_009966565.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Tyto 
alba]
 ref|XP_009999091.1| PREDICTED: transmembrane 9 superfamily member 3 [Chaetura pelagica]
 ref|XP_010311939.1| PREDICTED: transmembrane 9 superfamily member 3 [Balearica regulorum 
gibbericeps]
 ref|XP_010566032.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
leucocephalus]
Length=545

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_008320400.1| PREDICTED: transmembrane 9 superfamily member 3 [Cynoglossus 
semilaevis]
Length=585

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  443  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  502

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTAVYVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  503  LNAEDYRWQWTSFLSAASTAVYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  562

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGAVG++G++ FVR+IY N+K D
Sbjct  563  CGAVGYVGTSAFVRKIYTNVKID  585



>ref|XP_008773120.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Rattus 
norvegicus]
Length=598

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  456  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  515

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  516  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  575

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  576  CGAIGYMGTSAFVRKIYTNVKID  598



>ref|XP_009470788.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Nipponia 
nippon]
Length=545

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_007080322.1| PREDICTED: transmembrane 9 superfamily member 3 [Panthera tigris 
altaica]
Length=608

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  466  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  525

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  526  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  585

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  586  CGAIGYMGTSAFVRKIYTNVKID  608



>ref|XP_008932762.1| PREDICTED: transmembrane 9 superfamily member 3 [Manacus vitellinus]
Length=545

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_007187499.1| PREDICTED: transmembrane 9 superfamily member 3 [Balaenoptera 
acutorostrata scammoni]
Length=545

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  759  SVVSMMGGLLPXGSIFIEMYFVFTSFWNYKVYYVYGFMllvfliliivtvcvtiVGTYFL  580
            +V+  +GG+LP GSIFIEMYF+FTSFW YK+YYVYGFM+LV +IL IVTVCVTIV TYFL
Sbjct  403  AVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYVYGFMMLVLVILCIVTVCVTIVCTYFL  462

Query  579  LNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKVSGFFQVSFYXGYTLMFCLGLGIL  400
            LNAE+Y WQWTSF SAASTA+YVY+YS YYY+ KTK+ G FQ SFY GY  +F   LGI+
Sbjct  463  LNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFKTKMYGLFQTSFYFGYMAVFSTALGIM  522

Query  399  CGAVGFLGSNLFVRRIYRNIKCD  331
            CGA+G++G++ FVR+IY N+K D
Sbjct  523  CGAIGYMGTSAFVRKIYTNVKID  545



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470