BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002J03

Length=734
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    263   2e-77   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    262   4e-77   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    259   6e-76   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    258   2e-75   Nicotiana tomentosiformis
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    256   4e-75   Solanum peruvianum [Peruvian tomato]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    256   7e-75   Nicotiana sylvestris
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    256   9e-75   Solanum pennellii
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    255   9e-75   Solanum lycopersicum
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    254   3e-74   Tarenaya hassleriana [spider flower]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           253   7e-74   Glycine max [soybeans]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    253   1e-73   Morus notabilis
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    252   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    252   1e-73   Solanum tuberosum [potatoes]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    251   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    251   2e-73   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    251   2e-73   
gb|KHN13035.1|  Leucine-rich repeat receptor-like serine/threonin...    248   3e-73   Glycine soja [wild soybean]
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    251   3e-73   
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    251   3e-73   
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           251   4e-73   
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    251   5e-73   Sesamum indicum [beniseed]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    250   5e-73   Gossypium arboreum [tree cotton]
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         249   1e-72   Jatropha curcas
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    249   1e-72   Sesamum indicum [beniseed]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    249   1e-72   Nicotiana tomentosiformis
gb|KHN42601.1|  Leucine-rich repeat receptor-like serine/threonin...    246   2e-72   Glycine soja [wild soybean]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    249   2e-72   
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    249   2e-72   Ricinus communis
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    249   2e-72   Fragaria vesca subsp. vesca
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    248   4e-72   Vitis vinifera
emb|CDP02660.1|  unnamed protein product                                248   5e-72   Coffea canephora [robusta coffee]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             248   5e-72   Phaseolus vulgaris [French bean]
gb|KJB43996.1|  hypothetical protein B456_007G228700                    246   9e-72   Gossypium raimondii
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    247   1e-71   Cicer arietinum [garbanzo]
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    247   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             247   1e-71   Prunus persica
gb|KJB18115.1|  hypothetical protein B456_003G034500                    246   1e-71   Gossypium raimondii
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   Citrus sinensis [apfelsine]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    246   2e-71   
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   246   2e-71   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             246   2e-71   Citrus clementina [clementine]
dbj|BAF01968.1|  receptor protein kinase like protein                   230   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    245   4e-71   
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    245   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    244   9e-71   Populus euphratica
gb|KJB48795.1|  hypothetical protein B456_008G087500                    244   1e-70   Gossypium raimondii
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             244   1e-70   Populus trichocarpa [western balsam poplar]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    244   1e-70   Dimocarpus longan [longan]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    244   1e-70   Gossypium arboreum [tree cotton]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    244   1e-70   Nelumbo nucifera [Indian lotus]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           243   2e-70   Glycine max [soybeans]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             243   3e-70   Capsella rubella
gb|AES94465.2|  LRR receptor-like kinase family protein                 243   4e-70   Medicago truncatula
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    242   4e-70   Cucumis sativus [cucumbers]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    241   6e-70   Cucumis melo [Oriental melon]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             241   9e-70   Phaseolus vulgaris [French bean]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    241   9e-70   Arabis alpina [alpine rockcress]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    241   1e-69   Phoenix dactylifera
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    241   1e-69   Camelina sativa [gold-of-pleasure]
emb|CBI35733.3|  unnamed protein product                                240   2e-69   Vitis vinifera
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    240   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             240   2e-69   
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          240   2e-69   
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             240   3e-69   
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    237   3e-69   Glycine soja [wild soybean]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    239   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    239   4e-69   Phoenix dactylifera
ref|NP_001237688.1|  receptor-like protein kinase precursor             239   6e-69   Glycine max [soybeans]
ref|XP_003608587.1|  Receptor-like protein kinase                       238   9e-69   Medicago truncatula
gb|KJB18113.1|  hypothetical protein B456_003G034400                    238   1e-68   Gossypium raimondii
ref|XP_003611507.1|  Receptor-like protein kinase                       239   1e-68   
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    238   1e-68   Camelina sativa [gold-of-pleasure]
emb|CDY45620.1|  BnaCnng13280D                                          238   1e-68   Brassica napus [oilseed rape]
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    237   1e-68   Glycine soja [wild soybean]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    238   2e-68   
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                238   2e-68   Erythranthe guttata [common monkey flower]
emb|CDY08759.1|  BnaA06g24650D                                          237   3e-68   Brassica napus [oilseed rape]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    237   3e-68   Brassica rapa
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...    234   6e-68   
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    235   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    235   1e-67   Elaeis guineensis
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    235   2e-67   
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    234   2e-67   
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    233   3e-67   Eucalyptus grandis [rose gum]
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         234   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             234   4e-67   Capsella rubella
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    234   5e-67   Oryza brachyantha
emb|CDY02112.1|  BnaA03g40550D                                          233   6e-67   
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    233   6e-67   
gb|EAZ02682.1|  hypothetical protein OsI_24796                          233   8e-67   Oryza sativa Indica Group [Indian rice]
emb|CDY23037.1|  BnaC07g31500D                                          233   8e-67   Brassica napus [oilseed rape]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    233   8e-67   Brassica rapa
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    233   8e-67   
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    233   1e-66   Arabis alpina [alpine rockcress]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          233   1e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92008.1|  hypothetical protein OsI_13698                          233   1e-66   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 233   1e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051418.1|  Os03g0773700                                       231   2e-66   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          232   2e-66   Sorghum bicolor [broomcorn]
dbj|BAJ84911.1|  predicted protein                                      232   2e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             232   2e-66   Arabidopsis lyrata subsp. lyrata
gb|EEE60014.1|  hypothetical protein OsJ_12761                          231   2e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    230   4e-66   Oryza brachyantha
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    231   6e-66   Setaria italica
gb|AAO26313.1|  receptor-like protein kinase                            223   7e-66   Elaeis guineensis
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    230   8e-66   Elaeis guineensis
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...    229   9e-66   Triticum urartu
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             230   9e-66   
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    230   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    229   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    229   3e-65   Brachypodium distachyon [annual false brome]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    228   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    228   5e-65   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    228   5e-65   Eucalyptus grandis [rose gum]
gb|ADB85328.1|  putative receptor protein kinase                        226   5e-65   Phyllostachys edulis [kikko-chiku]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    228   5e-65   Camelina sativa [gold-of-pleasure]
gb|EPS74129.1|  hypothetical protein M569_00625                         228   5e-65   Genlisea aurea
gb|AAY32333.1|  RLK1                                                    226   6e-65   Phyllostachys praecox [zaozhu]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    228   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                        227   7e-65   
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    227   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    225   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    223   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          224   2e-63   Sorghum bicolor [broomcorn]
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    223   3e-63   Triticum urartu
dbj|BAJ89729.1|  predicted protein                                      221   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        220   2e-62   
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    221   2e-62   Zea mays [maize]
gb|ACN35202.1|  unknown                                                 209   3e-62   Zea mays [maize]
ref|NP_001169902.1|  uncharacterized protein LOC100383797               210   5e-61   
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    213   8e-60   Nicotiana sylvestris
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    211   8e-59   
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    210   1e-58   Oryza brachyantha
gb|EMT21762.1|  Receptor protein kinase CLAVATA1                        199   2e-58   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    209   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    209   4e-58   Elaeis guineensis
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         209   4e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049453.1|  Os03g0228800                                       209   5e-58   
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    208   5e-58   Nicotiana tomentosiformis
gb|ACL54651.1|  unknown                                                 201   5e-58   Zea mays [maize]
ref|XP_006858565.1|  hypothetical protein AMTR_s00071p00176900          207   6e-58   
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    208   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    208   7e-58   Solanum lycopersicum
dbj|BAJ99137.1|  predicted protein                                      208   8e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC74807.1|  hypothetical protein OsI_10619                          208   9e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    207   2e-57   Elaeis guineensis
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    207   2e-57   
gb|EMT15500.1|  hypothetical protein F775_52402                         206   2e-57   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    206   3e-57   Solanum tuberosum [potatoes]
emb|CDO97616.1|  unnamed protein product                                206   3e-57   Coffea canephora [robusta coffee]
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             206   3e-57   
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    205   6e-57   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    205   6e-57   Setaria italica
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    205   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_006859064.1|  hypothetical protein AMTR_s00068p00198250          203   1e-56   
ref|NP_001145765.1|  uncharacterized protein LOC100279272               203   2e-56   
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                   198   2e-56   Citrus sinensis [apfelsine]
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                204   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_003592924.1|  Receptor-like protein kinase                       204   2e-56   Medicago truncatula
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   204   2e-56   Citrus sinensis [apfelsine]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    204   2e-56   Citrus sinensis [apfelsine]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    204   2e-56   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             204   3e-56   Prunus persica
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    203   4e-56   
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         203   4e-56   Jatropha curcas
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    203   4e-56   Pyrus x bretschneideri [bai li]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    203   4e-56   Fragaria vesca subsp. vesca
emb|CBI29704.3|  unnamed protein product                                202   6e-56   Vitis vinifera
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    202   7e-56   Tarenaya hassleriana [spider flower]
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    202   7e-56   Prunus mume [ume]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    202   9e-56   Pyrus x bretschneideri [bai li]
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    202   9e-56   Malus domestica [apple tree]
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    202   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    202   9e-56   
gb|AHJ14779.1|  CLAVATA1                                                202   1e-55   Rhododendron ovatum
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    202   1e-55   Vitis vinifera
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    201   1e-55   Citrus sinensis [apfelsine]
dbj|BAJ90459.1|  predicted protein                                      202   2e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   Phoenix dactylifera
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    201   2e-55   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   
emb|CAN71863.1|  hypothetical protein VITISV_023530                     201   3e-55   Vitis vinifera
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         201   3e-55   Jatropha curcas
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    201   3e-55   
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             200   4e-55   Citrus clementina [clementine]
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    200   4e-55   Populus trichocarpa [western balsam poplar]
emb|CDP04113.1|  unnamed protein product                                200   5e-55   Coffea canephora [robusta coffee]
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               201   5e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    200   5e-55   Populus trichocarpa [western balsam poplar]
gb|EEC67924.1|  hypothetical protein OsI_35629                          200   6e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             200   6e-55   Prunus persica
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    200   7e-55   Sesamum indicum [beniseed]
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    199   7e-55   Cicer arietinum [garbanzo]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    199   8e-55   Phoenix dactylifera
gb|KJB32855.1|  hypothetical protein B456_005G265400                    199   9e-55   Gossypium raimondii
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    199   9e-55   Gossypium arboreum [tree cotton]
gb|KCW57119.1|  hypothetical protein EUGRSUZ_I02765                     197   1e-54   Eucalyptus grandis [rose gum]
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    199   1e-54   Ricinus communis
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    199   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Populus euphratica
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Nelumbo nucifera [Indian lotus]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    199   2e-54   Gossypium arboreum [tree cotton]
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Nelumbo nucifera [Indian lotus]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    198   2e-54   Gossypium raimondii
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             198   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    198   3e-54   Populus euphratica
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    197   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE51888.1|  hypothetical protein OsJ_33462                          196   5e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    197   5e-54   Eucalyptus grandis [rose gum]
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    197   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    197   6e-54   Populus euphratica
gb|KJB16198.1|  hypothetical protein B456_002G217000                    195   7e-54   Gossypium raimondii
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    196   9e-54   Nicotiana tomentosiformis
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     196   9e-54   Eucalyptus grandis [rose gum]
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    195   1e-53   
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   Eucalyptus grandis [rose gum]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   Elaeis guineensis
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    196   2e-53   Prunus mume [ume]
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    196   2e-53   Morus notabilis
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    195   2e-53   Nicotiana sylvestris
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    195   3e-53   Gossypium arboreum [tree cotton]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    195   3e-53   Gossypium raimondii
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    194   5e-53   Vitis vinifera
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    194   9e-53   Morus notabilis
emb|CDX93999.1|  BnaC07g36330D                                          192   1e-52   
emb|CDX98665.1|  BnaA03g44500D                                          192   1e-52   
emb|CDY54567.1|  BnaA08g30460D                                          192   1e-52   Brassica napus [oilseed rape]
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    193   2e-52   Cicer arietinum [garbanzo]
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    192   2e-52   Brassica rapa
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    192   2e-52   Elaeis guineensis
emb|CDY31445.1|  BnaC03g63790D                                          191   3e-52   Brassica napus [oilseed rape]
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    192   3e-52   Brassica rapa
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             192   3e-52   Eutrema salsugineum [saltwater cress]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             192   3e-52   
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    192   3e-52   Solanum lycopersicum
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    192   4e-52   Ricinus communis
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    192   4e-52   Tarenaya hassleriana [spider flower]
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        191   5e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    192   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        191   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170600.1|  uncharacterized protein LOC100384637               179   7e-52   
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    191   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    191   1e-51   Camelina sativa [gold-of-pleasure]
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    190   1e-51   Glycine soja [wild soybean]
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             191   1e-51   Phaseolus vulgaris [French bean]
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    191   1e-51   Arabis alpina [alpine rockcress]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    191   1e-51   Glycine max [soybeans]
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             191   1e-51   Capsella rubella
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    191   1e-51   
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    189   3e-51   Glycine max [soybeans]
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    189   3e-51   Solanum tuberosum [potatoes]
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    189   3e-51   Glycine max [soybeans]
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...    187   5e-51   Glycine soja [wild soybean]
gb|KHM99687.1|  Leucine-rich repeat receptor-like serine/threonin...    187   5e-51   Glycine soja [wild soybean]
ref|XP_003617299.1|  Receptor-like protein kinase                       188   7e-51   Medicago truncatula
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        188   8e-51   Gossypium arboreum [tree cotton]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    188   1e-50   
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    188   1e-50   Fragaria vesca subsp. vesca
gb|KJB29653.1|  hypothetical protein B456_005G112100                    187   2e-50   Gossypium raimondii
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    187   3e-50   
gb|EPS62062.1|  protein kinase                                          187   3e-50   Genlisea aurea
emb|CBI27382.3|  unnamed protein product                                182   6e-50   Vitis vinifera
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    186   6e-50   Cucumis sativus [cucumbers]
gb|KEH33614.1|  LRR receptor-like kinase family protein                 186   7e-50   Medicago truncatula
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        185   7e-50   
emb|CBI19895.3|  unnamed protein product                                184   8e-50   Vitis vinifera
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    186   9e-50   Glycine soja [wild soybean]
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             185   1e-49   
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    185   1e-49   Brassica rapa
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    185   1e-49   Populus euphratica
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         184   2e-49   Jatropha curcas
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             184   2e-49   Citrus clementina [clementine]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   184   2e-49   Citrus sinensis [apfelsine]
ref|XP_002307734.1|  receptor protein kinase                            184   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    184   2e-49   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        184   3e-49   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        183   5e-49   
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          183   6e-49   
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...    183   1e-48   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    182   1e-48   
gb|KJB47871.1|  hypothetical protein B456_008G045400                    182   1e-48   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    182   1e-48   
gb|KJB58082.1|  hypothetical protein B456_009G193600                    182   1e-48   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    182   1e-48   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    182   2e-48   
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    182   2e-48   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    180   3e-48   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    181   4e-48   
ref|XP_002300697.2|  receptor protein kinase                            181   5e-48   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    180   7e-48   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    180   9e-48   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    180   9e-48   
emb|CDY62258.1|  BnaCnng39750D                                          179   1e-47   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        179   1e-47   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        179   2e-47   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        179   2e-47   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    179   2e-47   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             179   2e-47   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...    179   2e-47   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    178   3e-47   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    178   3e-47   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    178   4e-47   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        178   5e-47   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        178   5e-47   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        177   6e-47   
emb|CDX87661.1|  BnaA07g32120D                                          177   6e-47   
gb|ADD64789.1|  CLAVATA1                                                177   6e-47   
emb|CDX73202.1|  BnaC06g36500D                                          177   6e-47   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    177   7e-47   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        177   7e-47   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          177   7e-47
gb|AAB58929.1|  CLV1 receptor kinase                                    177   7e-47   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      177   7e-47   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...    177   9e-47   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        176   1e-46   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1        176   2e-46   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             176   2e-46   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             176   2e-46   
gb|AAP49010.1|  CLV1-like receptor kinase                               176   3e-46   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    175   3e-46   
gb|AAX94895.1|  Similar to receptor-like protein kinase                 161   7e-46   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    174   7e-46   
gb|AAD02501.1|  receptor kinase                                         174   8e-46   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    174   9e-46   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        174   1e-45   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     173   2e-45   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                173   2e-45   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        173   2e-45   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480          172   4e-45   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        172   7e-45   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        171   8e-45   
ref|NP_001140626.1|  uncharacterized LOC100272700                       163   9e-45   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        171   1e-44   
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   171   1e-44   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    169   6e-44   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    168   2e-43   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    167   2e-43   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          167   2e-43   
gb|EYU33270.1|  hypothetical protein MIMGU_mgv1a0010742mg               154   3e-43   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    167   4e-43   
gb|EEC79804.1|  hypothetical protein OsI_21242                          167   4e-43   
ref|NP_001174552.1|  Os05g0595950                                       167   4e-43   
emb|CAD42335.1|  hypernodulation aberrant root formation protein        166   5e-43   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    166   6e-43   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              166   7e-43   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              166   7e-43   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    166   8e-43   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    164   2e-42   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    164   4e-42   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    164   5e-42   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    164   5e-42   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    162   1e-41   
emb|CAD42181.1|  serine-threonine protein kinase                        162   1e-41   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     162   2e-41   
dbj|BAC41332.1|  LRR receptor-like kinase                               162   2e-41   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        161   3e-41   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          161   4e-41   
ref|NP_001058593.1|  Os06g0717200                                       161   4e-41   
gb|AAW71475.1|  CLV1-like receptor kinase                               161   4e-41   
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...    160   5e-41   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   160   5e-41   
emb|CAA61510.1|  leucine-rich repeat/receptor protein kinase            160   6e-41   
gb|KHN39812.1|  Receptor protein kinase CLAVATA1                        159   7e-41   
ref|XP_010941307.1|  PREDICTED: leucine-rich repeat receptor-like...    159   9e-41   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     160   9e-41   
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    160   1e-40   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             160   1e-40   
gb|EAZ02372.1|  hypothetical protein OsI_24476                          159   2e-40   
gb|EPS70741.1|  hypothetical protein M569_04011                         159   2e-40   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    158   5e-40   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...    157   7e-40   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             157   1e-39   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             157   1e-39   
gb|EMT07441.1|  Receptor protein kinase CLAVATA1                        154   1e-39   
gb|ABE79572.2|  Protein kinase                                          157   1e-39   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               155   3e-39   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                155   4e-39   
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270          155   4e-39   
gb|EMS49990.1|  Leucine-rich repeat receptor-like serine/threonin...    149   5e-39   
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    154   9e-39   
dbj|BAJ98758.1|  predicted protein                                      154   2e-38   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    152   5e-38   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    151   1e-37   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          147   2e-36   
ref|XP_008781646.1|  PREDICTED: probable LRR receptor-like serine...    139   3e-36   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             146   5e-36   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             146   6e-36   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                     145   1e-35   
gb|KHN07526.1|  Leucine-rich repeat receptor-like serine/threonin...    130   2e-34   
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    140   5e-34   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    140   5e-34   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    139   1e-33   
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561             138   4e-33   
gb|AGP76288.1|  floral organ number 1                                   127   6e-33   
gb|AGP76279.1|  floral organ number 1                                   126   1e-32   
gb|AGP76284.1|  floral organ number 1                                   126   2e-32   
gb|AGP76283.1|  floral organ number 1                                   125   2e-32   
ref|XP_004986996.1|  PREDICTED: leucine-rich repeat receptor-like...    135   3e-32   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315             135   3e-32   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             135   3e-32   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    134   1e-31   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    133   2e-31   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    133   2e-31   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    132   3e-31   
ref|XP_010941444.1|  PREDICTED: leucine-rich repeat receptor-like...    132   4e-31   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    132   5e-31   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    132   5e-31   
ref|XP_006837283.1|  hypothetical protein AMTR_s00111p00013770          132   6e-31   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             132   7e-31   
ref|XP_010264363.1|  PREDICTED: leucine-rich repeat receptor-like...    131   8e-31   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    131   8e-31   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    131   1e-30   
ref|XP_004166710.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_004146946.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
gb|KDP22440.1|  hypothetical protein JCGZ_26271                         130   2e-30   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    130   2e-30   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             130   3e-30   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    130   3e-30   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             129   3e-30   
ref|XP_008453906.1|  PREDICTED: leucine-rich repeat receptor-like...    129   4e-30   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             129   4e-30   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    129   4e-30   
ref|XP_010258856.1|  PREDICTED: leucine-rich repeat receptor-like...    129   4e-30   
ref|XP_010258857.1|  PREDICTED: leucine-rich repeat receptor-like...    129   5e-30   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    129   5e-30   
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...    129   6e-30   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390             129   6e-30   
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   7e-30   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    129   7e-30   
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...    128   8e-30   
gb|KJB29385.1|  hypothetical protein B456_005G097600                    127   1e-29   
ref|XP_008347571.1|  PREDICTED: receptor protein kinase CLAVATA1-...    127   2e-29   
ref|XP_010062386.1|  PREDICTED: leucine-rich repeat receptor-like...    127   2e-29   
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    127   2e-29   
gb|KHN15622.1|  Leucine-rich repeat receptor-like serine/threonin...    117   2e-29   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    127   3e-29   
emb|CBI38662.3|  unnamed protein product                                126   3e-29   
ref|XP_001754607.1|  CLL2 clavata1-like receptor S/T protein kina...    127   4e-29   
gb|KJB58765.1|  hypothetical protein B456_009G225300                    126   4e-29   
ref|XP_002970031.1|  hypothetical protein SELMODRAFT_171048             126   4e-29   
ref|XP_002993050.1|  hypothetical protein SELMODRAFT_136413             126   5e-29   
gb|KHG17335.1|  Receptor-like protein kinase HAIKU2                     126   5e-29   
ref|XP_006852580.1|  hypothetical protein AMTR_s00021p00211960          126   6e-29   
gb|ABF73316.1|  clavata-like receptor                                   126   6e-29   
ref|XP_011076386.1|  PREDICTED: leucine-rich repeat receptor-like...    126   7e-29   
ref|XP_004235172.1|  PREDICTED: leucine-rich repeat receptor-like...    125   7e-29   
emb|CDP05348.1|  unnamed protein product                                125   8e-29   
emb|CDP00968.1|  unnamed protein product                                125   1e-28   
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...    126   1e-28   
ref|XP_002971926.1|  hypothetical protein SELMODRAFT_96692              125   1e-28   
gb|ADU60070.2|  receptor-like kinase                                    120   1e-28   
ref|XP_006358242.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-28   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-28   
gb|KDP24078.1|  hypothetical protein JCGZ_25735                         125   1e-28   
ref|XP_009611681.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-28   
ref|XP_009768910.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-28   
ref|XP_002890213.1|  leucine-rich repeat family protein                 125   1e-28   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    125   2e-28   
gb|KDO81346.1|  hypothetical protein CISIN_1g047677mg                   118   2e-28   
gb|KHN09963.1|  Receptor-like protein kinase HSL1                       124   2e-28   
ref|XP_007036373.1|  Receptor protein kinase, putative                  125   2e-28   
gb|KDP23736.1|  hypothetical protein JCGZ_23569                         124   2e-28   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                     124   2e-28   
ref|NP_001239710.1|  receptor-like protein kinase HSL1-like             124   2e-28   
ref|NP_173166.2|  leucine-rich receptor-like protein kinase             124   2e-28   
gb|AAD50027.1|AC007651_22  Similar to leucine-rich receptor-like ...    124   3e-28   
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...    124   3e-28   
ref|XP_003528467.1|  PREDICTED: receptor-like protein kinase HSL1...    124   3e-28   
gb|KHN15495.1|  Receptor-like protein kinase HSL1                       124   3e-28   
gb|KEH29421.1|  LRR receptor-like kinase family protein                 124   3e-28   
gb|KHG23504.1|  Receptor-like protein kinase HAIKU2                     124   3e-28   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...    124   3e-28   
ref|XP_010553768.1|  PREDICTED: leucine-rich repeat receptor-like...    124   3e-28   
ref|XP_009333802.1|  PREDICTED: receptor protein kinase CLAVATA1-...    124   3e-28   
ref|XP_006306625.1|  hypothetical protein CARUB_v10008143mg             124   4e-28   
emb|CAN61920.1|  hypothetical protein VITISV_038730                     124   4e-28   
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...    124   4e-28   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g             124   4e-28   
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2     124   4e-28   
ref|XP_010550816.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    124   4e-28   
gb|KEH42461.1|  LRR receptor-like kinase family protein                 124   4e-28   
gb|AEP14546.1|  clavata 1-like protein                                  124   4e-28   
gb|KJB60035.1|  hypothetical protein B456_009G286600                    123   5e-28   
gb|KJB64050.1|  hypothetical protein B456_010G030600                    123   5e-28   
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2     123   5e-28   
ref|XP_010550315.1|  PREDICTED: leucine-rich repeat receptor-like...    123   5e-28   
ref|XP_009335176.1|  PREDICTED: probable LRR receptor-like serine...    123   6e-28   



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   263 bits (671),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 133/163 (82%), Positives = 139/163 (85%), Gaps = 8/163 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  845   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  904

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVR+MTDGKKEGV+KILD RLST P+HE MH+FYVA+LCVEEQAVERPKMREVVQM
Sbjct  905   DIVQWVRRMTDGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQM  964

Query  373   LTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD  260
             LTELPK P G K E +T  ES      ALE P  T T  D KD
Sbjct  965   LTELPK-PSGPKTEDSTITESPPSSGPALESP--TSTPGDTKD  1004



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   262 bits (670),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 125/156 (80%), Positives = 138/156 (88%), Gaps = 6/156 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  845  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  904

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR+MTDGKKEGV+KILD+RLST P+HE MH+FYVA+LCVEEQAVERPKMREVVQM
Sbjct  905  DIVQWVRRMTDGKKEGVLKILDARLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQM  964

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  266
            LTELP      KP G  + +S+  E PPS+G + ++
Sbjct  965  LTELP------KPSGPKSGDSTITESPPSSGPASES  994



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   259 bits (661),  Expect = 6e-76, Method: Composition-based stats.
 Identities = 133/180 (74%), Positives = 144/180 (80%), Gaps = 17/180 (9%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  842   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  901

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMT+GKKEGV+KILD RLST P+HE MH+FYVA+LCVEEQAVERPKMREVVQ+
Sbjct  902   DIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQI  961

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPST-----------GTSDDAKDqqqppPDLLSI  227
             LTELP       P GT + ES+  E PPS+           G + D      PPPDLLSI
Sbjct  962   LTELP------NPSGTKSGESTITESPPSSAPASELPTSAPGNTKDNHQPPSPPPDLLSI  1015



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   258 bits (658),  Expect = 2e-75, Method: Composition-based stats.
 Identities = 139/179 (78%), Positives = 148/179 (83%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  842   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  901

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  902   DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQI  961

Query  373   LTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKD-----qqqppPDLLSI  227
             LTELPK PPG+K   +T  ES     SALE P  T    D KD      Q PPPDLLSI
Sbjct  962   LTELPK-PPGSKSGDSTVTESPSPSASALESP--TSAPGDTKDHHQPTPQSPPPDLLSI  1017



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   256 bits (655),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 138/179 (77%), Positives = 148/179 (83%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVALLCVEEQAVERP MREVVQ+
Sbjct  900   DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  227
             LTELPK PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  960   LTELPK-PPGAKSDDSTGTDHSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1015



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   256 bits (653),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 134/178 (75%), Positives = 147/178 (83%), Gaps = 10/178 (6%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  843   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  902

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903   DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQI  962

Query  373   LTELPKQPPGTKPEGTTACE------SSALEPPPS-TGTSDDAKDqqqpp--PDLLSI  227
             LTELPK PPG+K   +T  E      +SALE P S +G ++D          PDLLSI
Sbjct  963   LTELPK-PPGSKSGDSTVTELPPPSVASALESPASASGDTNDHHQPTPQSPPPDLLSI  1019



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   256 bits (653),  Expect = 9e-75, Method: Composition-based stats.
 Identities = 138/179 (77%), Positives = 148/179 (83%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  841   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  900

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVALLCVEEQAVERP MREVVQ+
Sbjct  901   DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQI  960

Query  373   LTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  227
             LTELPK PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  961   LTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   255 bits (652),  Expect = 9e-75, Method: Composition-based stats.
 Identities = 138/179 (77%), Positives = 148/179 (83%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  841   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  900

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVALLCVEEQAVERP MREVVQ+
Sbjct  901   DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQI  960

Query  373   LTELPKQPPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  227
             LTELPK PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  961   LTELPK-PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   254 bits (649),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 125/169 (74%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  848   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  907

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE VVK++D RLS+ PI E  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  908   DIVQWVRKMTDSNKESVVKVIDPRLSSVPIQEVTHVFYVAMLCVEEQAVERPTMREVVQI  967

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             L E+PK PP +KP+ T   +S A E  P  G  DD  D  + PPDLLSI
Sbjct  968   LAEIPKMPP-SKPDPTAGEKSPAHESSPKGGRGDDGNDPGRVPPDLLSI  1015



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   253 bits (646),  Expect = 7e-74, Method: Composition-based stats.
 Identities = 131/174 (75%), Positives = 145/174 (83%), Gaps = 7/174 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  841   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  900

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  901   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  960

Query  373   LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  961   LTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   253 bits (645),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 125/152 (82%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  844  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  903

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + PIHE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  904  DIVQWVRKMTDSNKEGVLKILDPRLPSVPIHEVMHVFYVAMLCVEEQAVERPTMREVVQI  963

Query  373  LTELPKQPPGTKP-EGTTACESSALEPPPSTG  281
            LTELPK PPG+K  + TT  ESS   PPP  G
Sbjct  964  LTELPK-PPGSKQGDSTTITESS---PPPVGG  991



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   252 bits (644),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 124/169 (73%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVV+LEL++G+KPVGEFGDGV
Sbjct  844   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVILELITGRKPVGEFGDGV  903

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE VVK+LD RLS+ PI+E MH+FYVA+LCVEE AVERP MREVVQ+
Sbjct  904   DIVQWVRKMTDSNKESVVKVLDPRLSSVPINEVMHVFYVAMLCVEELAVERPTMREVVQI  963

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTE+PK  P  KPE   A +S A +  P  G+  D  D  + PPDLLSI
Sbjct  964   LTEIPKMRP-PKPEPNAAEDSPAYQSSPMAGSGKDGNDVSRDPPDLLSI  1011



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   252 bits (644),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 124/149 (83%), Positives = 133/149 (89%), Gaps = 4/149 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  841  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  900

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTDGKK+GV+KILD RLST P++E MH+FYVALLCVEEQAVERP MREVVQ+
Sbjct  901  DIVQWVRKMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQI  960

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPS  287
            LTELPK  PG K + +T  + S   PPPS
Sbjct  961  LTELPKS-PGAKSDDSTVTDQS---PPPS  985



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 134/179 (75%), Positives = 143/179 (80%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  839   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  898

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  899   DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHLFYVAMLCVEEQAVERPTMREVVQI  958

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKD---qqqppPDLLSI  227
             LTELPK P     E +   ESS   PPP+T        TS D KD    Q PPPDLLSI
Sbjct  959   LTELPKGPGSKLVEESAITESS---PPPATTASESQGTTSKDMKDQPPPQSPPPDLLSI  1014



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 134/179 (75%), Positives = 143/179 (80%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  900   DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  227
             LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q P PDLLSI
Sbjct  960   LTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPQPDLLSI  1015



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   251 bits (642),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 135/179 (75%), Positives = 144/179 (80%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  900   DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  227
             LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  960   LTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>gb|KHN13035.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 145/174 (83%), Gaps = 7/174 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  553  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  612

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  613  DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  672

Query  373  LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  227
            LTELPK PPG+K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  673  LTELPK-PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   251 bits (642),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 135/179 (75%), Positives = 144/179 (80%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  900   DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  227
             LTELPK P     E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  960   LTELPKAPGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   251 bits (641),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 132/179 (74%), Positives = 141/179 (79%), Gaps = 13/179 (7%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  839   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  898

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  899   DIVQWVRKMTDSNKEGVLKILDPRLXSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  958

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTG-------TSDDAKDqqqppP---DLLSI  227
             LTELPK P     E +   ESS   PPP+T        TS D KDQ  P     DLLSI
Sbjct  959   LTELPKGPGSKLVEESAITESS---PPPATXASESPGTTSKDTKDQPPPQSLPPDLLSI  1014



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   251 bits (641),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 130/174 (75%), Positives = 144/174 (83%), Gaps = 7/174 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  841   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  900

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  901   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  960

Query  373   LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  961   LTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   251 bits (640),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 128/169 (76%), Positives = 141/169 (83%), Gaps = 2/169 (1%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  842   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  901

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDG KEGV+K+LD RL T P+HE MH+FYVA+LCVEEQAVERP MREV+Q+
Sbjct  902   DIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQI  961

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK P   KP  +T  +SS   P   T T  + +  Q PPPDLLSI
Sbjct  962   LTELPK-PTAAKPGDSTITDSSVDSPATETKTH-NRQASQSPPPDLLSI  1008



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   250 bits (639),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 123/171 (72%), Positives = 135/171 (79%), Gaps = 4/171 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  227
             LTELPK P    P     C  + L+PP +T T D  +         DLLSI
Sbjct  966   LTELPKPPNSESPTSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   249 bits (637),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 128/175 (73%), Positives = 141/175 (81%), Gaps = 7/175 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQA+ERP MREVVQ+
Sbjct  900   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACESS----ALEPPPSTGTSDDAKDqqqppP--DLLSI  227
             LTELPK PP +K    T  ESS    A    P+  T+ D KD Q P    DLLSI
Sbjct  960   LTELPK-PPNSKQGDLTVTESSPQSAATLDSPNAATTRDQKDHQSPQSPPDLLSI  1013



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   249 bits (637),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 130/173 (75%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  844   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  903

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDG KEGV+K+LD RL T P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  904   DIVQWVRKMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  963

Query  373   LTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  227
             L+ELPK P G KP      ES    S LE P +   S      Q PPPDLLSI
Sbjct  964   LSELPK-PHGAKPGDPAPTESPPPASILESPATDPESHHPNPPQSPPPDLLSI  1015



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   249 bits (637),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 131/177 (74%), Positives = 142/177 (80%), Gaps = 9/177 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDG+
Sbjct  844   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGI  903

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMT+GKKEGV+KILD RLST P+HE +H+FYVA+LCVEEQAVERPKMREVVQ+
Sbjct  904   DIVQWVRKMTEGKKEGVLKILDPRLSTVPLHEVIHVFYVAMLCVEEQAVERPKMREVVQI  963

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPS---TGTSDDAKD-----qqqppPDLLSI  227
             LTELP  P  TK   +T  ES     P S   T    + KD      Q P PDLLSI
Sbjct  964   LTELP-TPSNTKSGDSTITESLPSSAPASESPTSAPGNTKDNHQPPPQSPQPDLLSI  1019



>gb|KHN42601.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 144/174 (83%), Gaps = 7/174 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  553  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  612

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  613  DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  672

Query  373  LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  227
            LTELPK PP +K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  673  LTELPK-PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   249 bits (636),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 123/158 (78%), Positives = 134/158 (85%), Gaps = 6/158 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  842  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  901

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  902  DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  961

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD  260
            LTELPK PP +K   +T  ES      PS GTS D+ +
Sbjct  962  LTELPK-PPNSKQGDSTVTESL-----PSPGTSLDSPN  993



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   249 bits (636),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 131/180 (73%), Positives = 146/180 (81%), Gaps = 14/180 (8%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  845   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  904

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQA+ERP MREVVQ+
Sbjct  905   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQI  964

Query  373   LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqpp------PDLLSI  227
             LTELPK PP +K   +T  ESS     +L+ P +  TS D KD QQP       PDLLSI
Sbjct  965   LTELPK-PPNSKQGDSTVTESSPQSATSLDSPKA--TSKDPKDNQQPALPQSPPPDLLSI  1021



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   249 bits (635),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 124/158 (78%), Positives = 135/158 (85%), Gaps = 9/158 (6%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  849   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  908

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+KILDSRL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  909   DIVQWVRKMTDSNKEGVLKILDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  968

Query  373   LTELPKQPPGTKP--EGTTACES------SALEPPPST  284
             LTELP  PPG+K   E TT  +S      +A+E P +T
Sbjct  969   LTELPI-PPGSKQVGETTTVTDSPQQSAITAIESPTTT  1005



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   248 bits (633),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 5/154 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  843  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  902

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD+RL T P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903  DIVQWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  962

Query  373  LTELPKQPPGTKPEGTTACESS----ALEPPPST  284
            LTELPK PP +K   +   ESS     LE P +T
Sbjct  963  LTELPK-PPSSKQGDSIVTESSPPSCTLESPTTT  995



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   248 bits (633),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 125/164 (76%), Positives = 135/164 (82%), Gaps = 11/164 (7%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  842  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  901

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTDG KEGV+KILD RL T P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  902  DIVQWVRKMTDGNKEGVLKILDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  961

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPS------TGTSDDAKD  260
            LTELPK P   K   +T  ES    PPP+      + T  D+KD
Sbjct  962  LTELPK-PANGKQGDSTDTES----PPPASTVESPSTTPVDSKD  1000



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   248 bits (632),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 128/172 (74%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  836   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  895

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQW RKMTD  KE V+K+LD RLS+ P+H+ MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  896   DIVQWARKMTDSNKEEVLKVLDPRLSSVPLHDVMHVFYVAMLCVEEQAVERPTMREVVQI  955

Query  373   LTELPKQPPGTKPEGTTA---CESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELP+ PPG+K E  T      S+ALE  PST + D     Q PPPDLLSI
Sbjct  956   LTELPR-PPGSKQEDLTESSLSSSNALE-SPSTASKDRQNPSQSPPPDLLSI  1005



>gb|KJB43996.1| hypothetical protein B456_007G228700 [Gossypium raimondii]
Length=866

 Score =   246 bits (628),  Expect = 9e-72, Method: Composition-based stats.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 6/175 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  692  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  751

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRK T+  KEGV+KILD RLS+ P++E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  752  DIVQWVRKTTNSNKEGVLKILDPRLSSVPLYEVMHVFYVAMLCVEEQAVERPTMREVVQI  811

Query  373  LTELPKQPPGTKPEG-TTACESSALEPP-----PSTGTSDDAKDqqqppPDLLSI  227
            LTE+PK P   + +G +T  ESS +  P     P    + + KDQ  PPPDLLSI
Sbjct  812  LTEVPKPPSSKQQQGDSTITESSPISQPTTLESPRDARTKEPKDQHTPPPDLLSI  866



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   247 bits (630),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 122/169 (72%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  841   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGRKPVGEFGDGV  900

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQM
Sbjct  901   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQM  960

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK P     E  T      +   PS  +S+  +   + P DLLSI
Sbjct  961   LTELPKPPTSKHVEDLTL----TITESPSLASSNSLESPSKEPKDLLSI  1005



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   247 bits (630),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 125/169 (74%), Positives = 139/169 (82%), Gaps = 4/169 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  845   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGV  904

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTDG KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  905   DIVQWVRKMTDGNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  964

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             L E+PK PPGT P+   A   S LE P     +      + PPPDLLSI
Sbjct  965   LLEIPK-PPGTTPKQGDA---SPLESPQRPTDAIVGSPTKSPPPDLLSI  1009



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   247 bits (630),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 119/154 (77%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  839  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  898

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  899  DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  958

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTELPK P   +  G +A   S   PP  T  S+
Sbjct  959  LTELPKAPGSKQGGGDSAITESF--PPSGTSASE  990



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   246 bits (629),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 123/171 (72%), Positives = 138/171 (81%), Gaps = 4/171 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  227
             LTELPK PP ++   T+    + L+PP +T T D  +         DLLSI
Sbjct  966   LTELPK-PPNSEST-TSPAPCTTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 8/148 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  837  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD KKEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  897  DIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  956

Query  373  LTELPKQPPGTK-------PEGTTACES  311
            LTELPK PP +K       P GTT+ +S
Sbjct  957  LTELPK-PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   246 bits (627),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 119/154 (77%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  790  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  849

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  850  DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  909

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTELPK P   +  G +A   S   PP  T  S+
Sbjct  910  LTELPKAPGSKQGGGDSAITESF--PPSGTSASE  941



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 8/148 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  837  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD KKEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  897  DIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  956

Query  373  LTELPKQPPGTK-------PEGTTACES  311
            LTELPK PP +K       P GTT+ +S
Sbjct  957  LTELPK-PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 118/148 (80%), Positives = 130/148 (88%), Gaps = 8/148 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  839  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  898

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD KKEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  899  DIVQWVRKMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  958

Query  373  LTELPKQPPGTK-------PEGTTACES  311
            LTELPK PP +K       P GTT+ +S
Sbjct  959  LTELPK-PPTSKQGEESLPPSGTTSLDS  985



>dbj|BAF01968.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=243

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  82   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  141

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  142  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  201

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            LTE+PK P   +     A ES   E  P+   S
Sbjct  202  LTEIPKIPLSKQ----QAAESDVTEKAPAINES  230



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   245 bits (626),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 124/171 (73%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  840   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  899

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RLS+ P+HE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  900   DIVQWVRKMTDSNKEGVLKVLDPRLSSVPLHEVTHVFYVAILCVEEQAVERPTMREVVQI  959

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPS--TGTSDDAKDqqqppPDLLSI  227
             LTELP  PP +K   +T  ESS      S    + D+      PPPDLLSI
Sbjct  960   LTELP-MPPESKQGDSTITESSLSNASESLTAASKDNQHPPPSPPPDLLSI  1009



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   245 bits (625),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 4/153 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            LTELPK PP +K   +T    + +E  PS   +
Sbjct  966  LTELPK-PPNSKQGDSTI---TTMESSPSLAAA  994



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   244 bits (623),  Expect = 9e-71, Method: Composition-based stats.
 Identities = 127/176 (72%), Positives = 141/176 (80%), Gaps = 8/176 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373   LTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK P         T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  966   LTELPKSPSSKQGDSIITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   244 bits (623),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 128/174 (74%), Positives = 138/174 (79%), Gaps = 8/174 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  843   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  902

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMT+ KKEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903   DIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  962

Query  373   LTELPKQPPGTKPEGTTACES-----SALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK    +K    T  ES     S LE P +  T D       P PDLLSI
Sbjct  963   LTELPK-ASDSKQRDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPDLLSI  1013



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 127/176 (72%), Positives = 141/176 (80%), Gaps = 8/176 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373   LTELPKQPPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK P         T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  966   LTELPKSPSSKQGDSVITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 4/152 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  838  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD   +GV+KILD RL T P++E MH+FYVALLCVEEQAVERP MREVVQ+
Sbjct  898  DIVQWVRKMTDSNVDGVLKILDPRLPTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQI  957

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGT  278
            LTELPK PP +KP  +   ESS   P P+T T
Sbjct  958  LTELPK-PPSSKPADSAIPESS---PSPATTT  985



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 126/173 (73%), Positives = 137/173 (79%), Gaps = 6/173 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  843   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  902

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMT+ KKEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903   DIVQWVRKMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  962

Query  373   LTELPKQPPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK     + + T    S    S LE P +  T D       P PDLLSI
Sbjct  963   LTELPKASDSKQGDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPDLLSI  1013



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   244 bits (622),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 116/153 (76%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  843  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  902

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+KILD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903  DIVQWVRKMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  962

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            LTELPK P     +G++A   S+     + G +
Sbjct  963  LTELPKAP--ISKQGSSAMTESSPSAAATAGET  993



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   243 bits (621),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 128/173 (74%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  837   LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  896

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LDSRL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  897   DIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  956

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDq----qqppPDLLSI  227
             LTELPK PP +K   T +  SS+      T  S + KD     Q PPPDLLSI
Sbjct  957   LTELPK-PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDLLSI  1008



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   243 bits (619),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            LTE+PK PP      T +   S L P
Sbjct  966  LTEIPKLPPSKDQTTTESTPESELSP  991



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   243 bits (619),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 128/174 (74%), Positives = 141/174 (81%), Gaps = 7/174 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  843   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  902

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RLS+ P+ E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903   DIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQI  962

Query  373   LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELPK    +K   +T  ESS     ALE  P+  + D     Q PPPDLLSI
Sbjct  963   LTELPKSTE-SKLGDSTITESSLSSSNALE-SPTAASKDHQHPPQSPPPDLLSI  1014



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   242 bits (618),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 129/178 (72%), Positives = 145/178 (81%), Gaps = 10/178 (6%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  843   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  902

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE VVKILD RLS+ P+HE MH+FYVA+LCVEEQAVERP MREV+Q+
Sbjct  903   DIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQI  962

Query  373   LTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  227
             L+E+P QPP +K  G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  963   LSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  1019



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   241 bits (616),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 129/178 (72%), Positives = 145/178 (81%), Gaps = 10/178 (6%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  801  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  860

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE VVKILD RLS+ P+HE MH+FYVA+LCVEEQAVERP MREV+Q+
Sbjct  861  DIVQWVRKMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQI  920

Query  373  LTELPKQPPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  227
            L+E+P QPP +K  G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  921  LSEIP-QPPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  977



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   241 bits (616),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 126/176 (72%), Positives = 139/176 (79%), Gaps = 8/176 (5%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  844   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  903

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  904   DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  963

Query  373   LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTS--DDAKDqqqppPDLLSI  227
             LTELPK    +K    T  ESS     +LE P +      D+    Q  PPDLLSI
Sbjct  964   LTELPKS-ASSKQGDLTITESSLPSSNSLESPTTASMEPKDNQHLPQSSPPDLLSI  1018



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   241 bits (615),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 115/154 (75%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD R+S+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKESVLKVLDPRMSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTE+PK PP +K + TT         P + G  D
Sbjct  966  LTEIPKMPP-SKEQSTTELTGVEKSTPENEGPPD  998



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   241 bits (615),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 5/169 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  856   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  915

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD KKEGVV +LD RL + P+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+
Sbjct  916   DIVQWVRKMTDSKKEGVVIVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQI  975

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LTELP+ PP  + EG    E S   PPP+ G +   + + QP PDLLSI
Sbjct  976   LTELPRPPP-NQGEG----EDSPPPPPPAGGETPMKESKPQPQPDLLSI  1019



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   241 bits (614),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            LTE+PK PP      T +   + L P
Sbjct  966  LTEIPKLPPSKDQPTTESTPENELSP  991



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   240 bits (613),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 129/151 (85%), Gaps = 5/151 (3%)
 Frame = -2

Query  724  SGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  545
            SGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIV
Sbjct  777  SGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIV  836

Query  544  QWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  365
            QWVRKMTD  KEGV+KILD+RL T P+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTE
Sbjct  837  QWVRKMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTE  896

Query  364  LPKQPPGTKPEGTTACESS----ALEPPPST  284
            LPK PP +K   +   ESS     LE P +T
Sbjct  897  LPK-PPSSKQGDSIVTESSPPSCTLESPTTT  926



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   240 bits (613),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  845  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  904

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  K+ V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  905  DIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  964

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDD  269
            LTE+PK PP      T +   S L P     +  D
Sbjct  965  LTEIPKLPPSKDQPMTESAPESELSPKSGVQSPPD  999



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   240 bits (613),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 119/159 (75%), Positives = 128/159 (81%), Gaps = 5/159 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  845   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  904

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  905   DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  964

Query  373   LTELPKQPPGTKPEGT--TACESSALE---PPPSTGTSD  272
             LTE+PK PP      T  T  E S  E    P S G  D
Sbjct  965   LTEIPKMPPLKDQPATELTGVEKSTAENELSPKSGGPPD  1003



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   240 bits (613),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 126/176 (72%), Positives = 141/176 (80%), Gaps = 7/176 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  842   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  901

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD KKEGV+ ILD RL T P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  902   DIVQWVRKMTDSKKEGVLNILDPRLPTVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQI  961

Query  373   LTELPKQP----PGTKPEGTTACESSALEPP-PSTGTSDDAKD--qqqppPDLLSI  227
             LT+LPK P    P T+  G      ++ EP  P+ G  +       Q PPPDLLSI
Sbjct  962   LTDLPKPPEQPSPTTQKHGGIGGGDASPEPNGPNVGVKEQQGQLPPQSPPPDLLSI  1017



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   240 bits (612),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  845  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  904

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  905  DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  964

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            LTE+PK PP      T +   + L P
Sbjct  965  LTEIPKLPPPKDQPTTESTPENELSP  990



>gb|KHN47566.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=725

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  554  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  613

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LDSRL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  614  DIVQWVRKMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  673

Query  373  LTELPKQPPGTK  338
            LTELPK PP +K
Sbjct  674  LTELPK-PPSSK  684



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   239 bits (611),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            LTE+PK PP      T +   + + P
Sbjct  966  LTEIPKLPPSKDQPTTESTPENEVSP  991



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   239 bits (611),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 122/172 (71%), Positives = 134/172 (78%), Gaps = 3/172 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  819  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  878

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW+RKMTD  KE V  ILD RLST P+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  879  DIVQWMRKMTDSNKEAVTNILDPRLSTVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQI  938

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP---DLLSI  227
            L+ELP+  P    + +   ES A  P PS  T    + Q  P     DLLSI
Sbjct  939  LSELPRPTPKPGEDSSNDEESEAPAPVPSAETPSKEQQQPAPRSPPPDLLSI  990



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   239 bits (610),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  837  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  897  DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  956

Query  373  LTELPKQPPGTK  338
            LTELPK PP +K
Sbjct  957  LTELPK-PPSSK  967



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   238 bits (608),  Expect = 9e-69, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  840  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGRKPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RL + P++E MH+FYVA+LCVEEQAVERP MREVVQM
Sbjct  900  DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQM  959

Query  373  LTELPKQPPGTK  338
            LTELPK PP +K
Sbjct  960  LTELPK-PPSSK  970



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   238 bits (608),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 127/182 (70%), Positives = 139/182 (76%), Gaps = 14/182 (8%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE V+K+LD RL + P+ E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSSKESVLKVLDPRLPSVPLQEVMHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSALEPP------PSTGTSDDAKDqq-------qppPDLL  233
             LTELPK PP +K   TT  E      P      P+T  + D KDQQ         PPDLL
Sbjct  966   LTELPK-PPNSKEGDTTINEPPTSPSPDTTLDSPTTTITKDPKDQQQQPPAPKSTPPDLL  1024

Query  232   SI  227
             SI
Sbjct  1025  SI  1026



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   239 bits (609),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 121/160 (76%), Positives = 132/160 (83%), Gaps = 8/160 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  843  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  902

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RLS+ P+ E MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  903  DIVQWVRKMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQI  962

Query  373  LTELPKQPPGTKPEGTTACESS-----ALEPPPSTGTSDD  269
            LTELPK    +K   +T  ESS     ALE P  T  S D
Sbjct  963  LTELPKSTE-SKLGDSTITESSLSSSNALESP--TAASKD  999



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   238 bits (607),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KE V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            LTE+PK  P      T +   + L P
Sbjct  966  LTEIPKSLPSKDQPTTESTPENELSP  991



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   238 bits (606),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  816  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  875

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  K+ V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  876  DIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  935

Query  373  LTELPKQPPGTKPEGT  326
            LTE+PK PP      T
Sbjct  936  LTEVPKMPPSKDQPAT  951



>gb|KHN01704.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=854

 Score =   237 bits (604),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  681  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  740

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEGV+K+LD RL + P+HE MH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  741  DIVQWVRKMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQI  800

Query  373  LTELPKQPPGTK  338
            LTELPK PP +K
Sbjct  801  LTELPK-PPSSK  811



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   238 bits (606),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 108/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  854  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  913

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD KKEGV+ +LD RL + P+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+
Sbjct  914  DIVQWVRKMTDSKKEGVLSVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQI  973

Query  373  LTELPKQP  350
            LTELP+ P
Sbjct  974  LTELPRPP  981



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   238 bits (606),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 112/148 (76%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  853  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  912

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMT+G K+G VK+LD RL   P+HE  H+FYVA+LCVEEQAVERP MREVVQM
Sbjct  913  DIVQWVRKMTEGNKQGAVKVLDPRLERVPLHEVTHVFYVAMLCVEEQAVERPTMREVVQM  972

Query  373  LTELPKQPPGTKPEGTTACESSALEPPP  290
            LTELP         G    E     PPP
Sbjct  973  LTELPGDSGSEVKLGHQEQEMPISSPPP  1000



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  814  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  873

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  K+ V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  874  DIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  933

Query  373  LTELPKQPPGTKPEGT  326
            LTE+PK PP      T
Sbjct  934  LTEVPKMPPSKDQPAT  949



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  840  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  K+ V+K+LD RLS+ PIHE  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  900  DIVQWVRKMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQI  959

Query  373  LTELPKQPPGTKPEGT  326
            LTE+PK PP      T
Sbjct  960  LTEVPKMPPSKDQAAT  975



>ref|XP_008785758.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Phoenix dactylifera]
Length=782

 Score =   234 bits (598),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  617  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  676

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR++TD  KEGV+KILD RLS+ P+HEAMH+FYVA+LCVEEQ+VERP  REVVQ+
Sbjct  677  DIVQWVREVTDSSKEGVLKILDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTTREVVQI  736

Query  373  LTELPKQPP  347
            LTELP  PP
Sbjct  737  LTELPGPPP  745



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   235 bits (600),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 116/154 (75%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  844  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  903

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMT   KE V KILD RL TAPIHE MH+FYVA+LCVEEQ+V RP MREVVQM
Sbjct  904  DIVQWVRKMTGSDKENVAKILDPRLPTAPIHEVMHVFYVAMLCVEEQSVGRPTMREVVQM  963

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTELP  P   + E +++   +A  PPP   + D
Sbjct  964  LTELPI-PSLKQGEDSSSGNVTAQPPPPIVASVD  996



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   235 bits (600),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 108/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  855  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  914

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRK+TD  KEG++KI+D RLS+ P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  915  DIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQI  974

Query  373  LTELPKQP  350
            LTELP  P
Sbjct  975  LTELPGTP  982



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   235 bits (599),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 114/162 (70%), Positives = 131/162 (81%), Gaps = 4/162 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSG S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGV
Sbjct  848   LQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGV  907

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWV+ MTD  KE V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQM
Sbjct  908   DIVQWVKTMTDSNKEQVIKIMDPRLSTVPVHEVMHIFYVALLCVEEQSVQRPTMREVVQM  967

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGT----SDDAKD  260
             L+ELPK       E  +  + +A  PP S  +    +D+AK+
Sbjct  968   LSELPKPTSRQGDELPSGDDGAAPNPPVSADSVEALNDEAKE  1009



>ref|XP_010023395.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Eucalyptus grandis]
Length=875

 Score =   234 bits (597),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 5/162 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  697  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  756

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW+RKMT+  KE V KILD RL   P+HEAMH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  757  DIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQI  816

Query  373  LTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  260
            LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  817  LTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  857



>gb|KCW59634.1| hypothetical protein EUGRSUZ_H023832 [Eucalyptus grandis]
Length=871

 Score =   233 bits (595),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 5/162 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGV
Sbjct  693  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGV  752

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW+RKMT+  KE V KILD RL   P+HEAMH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  753  DIVQWMRKMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQI  812

Query  373  LTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKD  260
            LTE P+ PPG+    +    + +L P      S  T+ D K+
Sbjct  813  LTERPR-PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  853



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   234 bits (596),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  841  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  900

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  901  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  960

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            LTE+PK P   +     A ES   E  P+   S
Sbjct  961  LTEIPKIPLSKQ----QAAESDVTEKAPAINES  989



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   234 bits (596),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 112/158 (71%), Positives = 127/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  836  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  895

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  896  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  955

Query  373  LTELPKQPPGTKPEGTTACESSAL---EPPPSTGTSDD  269
            LTE+PK P   + E  +     A    E  P +G+  D
Sbjct  956  LTEIPKLPLSKQQETESDVTEKAPRMNESSPDSGSPPD  993



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   234 bits (596),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 115/164 (70%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  839   LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  898

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIV WVR MTD  KE V+K+LD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  899   DIVHWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHIFYVALLCIEEQSVQRPTMREVVQI  958

Query  373   LTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  260
             L+ELPK  P      + A + SA  PP   PS      + DAKD
Sbjct  959   LSELPKLAPRQGEVLSHAVDGSASNPPAPVPSGSAKAPTGDAKD  1002



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   233 bits (594),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  816  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  875

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K++D RLS+ P+HE  H+FYVA+LCVEEQAV RP MREVVQ+
Sbjct  876  DIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPTMREVVQI  935

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTE+PK P   +     A ES   E  P+    D
Sbjct  936  LTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  965



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   233 bits (595),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 125/177 (71%), Positives = 140/177 (79%), Gaps = 8/177 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV
Sbjct  819  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  878

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW+RKMTD  K+ V  ILD RLS+ P+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  879  DIVQWMRKMTDSNKQAVTNILDPRLSSVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQI  938

Query  373  LTELPKQPPGTKPEGTTACESS-ALEPPPSTGT-SDDAKDqqqppP------DLLSI  227
            L+ELP+  P    E ++  E S A  P PS  T S + K+QQQ P       DLLSI
Sbjct  939  LSELPRPTPKPGEEDSSNNEESGAPAPVPSAETPSKETKEQQQQPARQSPPPDLLSI  995



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   233 bits (594),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 117/163 (72%), Positives = 133/163 (82%), Gaps = 9/163 (6%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWV+ MTD  KE V+KILD RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  906   DIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  965

Query  373   LTELPKQPPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  260
             L+ELPK  P +K     P G  A   S L  P  +  +++AK+
Sbjct  966   LSELPK--PTSKQGEEPPSGEGAV--SDLVVPAESAEANEAKE  1004



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   233 bits (594),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 111/149 (74%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  815  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  874

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K++D RLS+ P+HE  H+FYVALLCVEEQAV RP MREVVQ+
Sbjct  875  DIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVALLCVEEQAVARPTMREVVQI  934

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPS  287
            LTELPK P   +     A ES   E  P+
Sbjct  935  LTELPKIPLSKQ----LAVESDVTEKSPA  959



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   233 bits (594),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  840  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K++D RLS+ P+HE  H+FYVA+LCVEEQAV RP MREVVQ+
Sbjct  900  DIVQWVRSMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPMMREVVQI  959

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSD  272
            LTE+PK P   +     A ES   E  P+    D
Sbjct  960  LTEVPKIPLSEQ----LAVESDVTEKSPAVDEED  989



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   233 bits (594),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+KPVGEFGDGV
Sbjct  846  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  +E V +ILD RLST P+HE +H+F+VA+LCVEEQ+VERP MREVVQ+
Sbjct  906  DIVQWVRKMTDSNREAVTEILDPRLSTVPLHEVLHVFHVAMLCVEEQSVERPTMREVVQI  965

Query  373  LTELPKQPPG  344
            L E PK  PG
Sbjct  966  LAEFPKPKPG  975



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   233 bits (593),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 111/149 (74%), Positives = 124/149 (83%), Gaps = 4/149 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G+KPVGEFGDGV
Sbjct  837  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLMELITGRKPVGEFGDGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K++D RLS+ PIHE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  897  DIVQWVRSMTDSNKECVLKVIDLRLSSVPIHEVTHVFYVALLCVEEQAVERPTMREVVQI  956

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPS  287
            LTE+PK      P    A ES+  E  P+
Sbjct  957  LTEIPK----ILPTKQHAAESNVTEISPA  981



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   233 bits (593),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWV+ MTD  KE V+KILD RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  906   DIVQWVKTMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSALE--PPPSTGTSDDAKD  260
             L+ELPK P   + E   + E +  +   P  +  +++AK+
Sbjct  966   LSELPK-PTSKQGEEPPSGEGAVFDLVVPAESAEANEAKE  1004



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   233 bits (593),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 115/164 (70%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  847   LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  906

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVR MTD  KE V+K+LD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  907   DIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQI  966

Query  373   LTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  260
             L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  967   LSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   233 bits (593),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 115/164 (70%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  847   LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  906

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVR MTD  KE V+K+LD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  907   DIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQI  966

Query  373   LTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  260
             L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  967   LSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>ref|NP_001051418.1| Os03g0773700 [Oryza sativa Japonica Group]
 dbj|BAF13332.1| Os03g0773700, partial [Oryza sativa Japonica Group]
Length=885

 Score =   231 bits (590),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 115/164 (70%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  703  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  762

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K+LD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  763  DIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQI  822

Query  373  LTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  260
            L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  823  LSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  866



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   232 bits (592),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 110/145 (76%), Positives = 123/145 (85%), Gaps = 7/145 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGV
Sbjct  848  LQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGV  907

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ MTD  KE V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQM
Sbjct  908  DIVQWVKTMTDANKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQM  967

Query  373  LTELPK-------QPPGTKPEGTTA  320
            L+ELPK       +PP    +G+ A
Sbjct  968  LSELPKPAARQGDEPPSVDDDGSAA  992



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   232 bits (591),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  841  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  900

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W++  TD KKE V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  901  DIVHWIKMTTDSKKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  960

Query  373  LTELPK---QPPGTKPEGTTACESSALEPPPST  284
            L+ELPK   +  G +  G++  +   L  PP T
Sbjct  961  LSELPKPIAKQGGEQLTGSSDGDEPGLSGPPET  993



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   232 bits (591),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  840  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  900  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  959

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            LTE+PK P   +     A ES   E  P+   S
Sbjct  960  LTEIPKIPLLKQ----QAAESDVSEKAPAMNES  988



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   231 bits (590),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 115/164 (70%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  797  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  856

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+K+LD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  857  DIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQI  916

Query  373  LTELPKQPPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  260
            L+ELPK  P      + A +  A  PP   PS      + DAKD
Sbjct  917  LSELPKLAPRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  960



>ref|XP_006657429.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=864

 Score =   230 bits (587),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 3/160 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  682  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  741

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ MTD  KE V+KILD RLST P+HE MH+FYVALLCVEEQ+++RP MREVVQ+
Sbjct  742  DIVQWVKTMTDSNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSMQRPTMREVVQI  801

Query  373  LTELPKQPPGTKPEGTTACESSA--LEPPPSTGTSDDAKD  260
            L+ELPK P   + E   + E +   L  P  +  +++AK+
Sbjct  802  LSELPK-PASKQGEEPPSGEGAVPDLVVPAESAEANEAKE  840



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   231 bits (588),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 113/157 (72%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  847   LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  906

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQW + MTD  KE V+KILD RLST P+HE MH+FYVALLC EEQ+V+RP MREVVQ+
Sbjct  907   DIVQWAKMMTDSSKEQVMKILDPRLSTVPLHEIMHVFYVALLCTEEQSVQRPTMREVVQI  966

Query  373   LTELPKQPPGTKPEGTTACESSALEP-PPSTGTSDDA  266
             L+ELPK       E   AC+ SA  P  P+   S++A
Sbjct  967   LSELPKPSTKQGEEVPNACDGSASGPLHPAPAGSNEA  1003



>gb|AAO26313.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=481

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 1/128 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSEC+ AIAGSYGYIAPEYA TLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  317  LQDSGTSECISAIAGSYGYIAPEYA-TLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  375

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRK+TD  KEG++KI+D RLS+ P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  376  DIVQWVRKVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQI  435

Query  373  LTELPKQP  350
            LTELP  P
Sbjct  436  LTELPGTP  443



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   230 bits (587),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 112/158 (71%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVRKMTD  KE V +ILD RLST P+ E +H+F+VA+LCVEEQ+VERP MREVVQ+
Sbjct  906   DIVQWVRKMTDSNKEAVSEILDPRLSTVPLQEVIHVFHVAMLCVEEQSVERPTMREVVQI  965

Query  373   LTELPKQPPG---TKPEGTTACESSALEPPPSTGTSDD  269
             L E PK  PG   +  EG+       +E   S  T +D
Sbjct  966   LAEFPKPKPGEDSSANEGSVPPPPVPVEETSSKETKED  1003



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score =   229 bits (583),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 113/163 (69%), Positives = 131/163 (80%), Gaps = 5/163 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  606  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  665

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W++ MTD K+E V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  666  DIVHWIKMMTDSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  725

Query  373  LTELPKQPPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  260
            L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  726  LSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  768



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   230 bits (586),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 110/153 (72%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGV
Sbjct  853   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGV  912

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVR MTD  K+ V+K++D RLS+ PIHE  H+FYVA+LCVEE+AVERP MREVVQ+
Sbjct  913   DIVQWVRGMTDSNKDCVLKVIDLRLSSVPIHEVTHVFYVAMLCVEERAVERPTMREVVQI  972

Query  373   LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
             LTE+PK P   +     A ES   E  P+   S
Sbjct  973   LTEIPKIPISKQ---KAAAESDVTEKSPAMNES  1002



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   230 bits (586),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRK+T   KE V KILD RL T P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  906  DIVQWVRKVTGSNKEEVTKILDPRLPTLPVHEAMHVFYVAMLCVEEQSVERPTMREVVQI  965

Query  373  LTELPKQP  350
            LTELPK P
Sbjct  966  LTELPKPP  973



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   229 bits (583),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 109/156 (70%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GV
Sbjct  839  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGV  898

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  899  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  958

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDA  266
            L E+PK P   + E  +     A   PP   +S D+
Sbjct  959  LAEIPKMPLTKQLETESDVTEKA---PPMNDSSPDS  991



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   229 bits (583),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  841  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  900

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW++ MTD  KE V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  901  DIVQWIKMMTDSSKERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  960

Query  373  LTELPKQPPGTKPEGTTACESSALEP  296
            L+E PK  P    E   + E   L+P
Sbjct  961  LSEPPKLIPKQGEELPGSGEGDELDP  986



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   228 bits (581),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 109/153 (71%), Positives = 123/153 (80%), Gaps = 4/153 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GV
Sbjct  838  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  898  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  957

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTS  275
            L E+PK P   + E     ES   E  P+   S
Sbjct  958  LAEIPKMPLTKQLE----TESDVTEKAPAMNES  986



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   228 bits (581),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 4/145 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  851  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  910

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR+MTD  KEGV+KILD RL T P+ E MH+FYVA+LCVEEQ+V RP MREVVQ+
Sbjct  911  DIVQWVRRMTDSSKEGVLKILDHRLPTVPLDEVMHVFYVAMLCVEEQSVGRPTMREVVQI  970

Query  373  LTELPKQPPGTKPEGTTACESSALE  299
            LT+LP+ P  T+ +    CE+   E
Sbjct  971  LTDLPR-PATTQADD---CEAPIRE  991



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   228 bits (581),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 113/147 (77%), Positives = 122/147 (83%), Gaps = 4/147 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  855  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  914

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMT+  KE V  ILD RL+T P+HEAMH+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  915  DIVQWVRKMTNSNKEEVQLILDPRLNTVPLHEAMHLFYVAMLCVEEQAVERPTMREVVQI  974

Query  373  LTELPKQPPGTKPEGTTACESSALEPP  293
            LTE PK     + E  T    S LE P
Sbjct  975  LTEFPKPCNVKQDEPLT----SPLESP  997



>gb|ADB85328.1| putative receptor protein kinase [Phyllostachys edulis]
Length=743

 Score =   226 bits (576),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 110/157 (70%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  562  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  621

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  KE V+ I D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  622  DIVQWVRMMTDSNKEQVMMIRDPRLSTVPLHEVMHVFYVALLCVEEQSVQRPTMREVVQI  681

Query  373  LTELPKQPPGTKPEGTTACESSAL-EPPPSTGTSDDA  266
            L++LPK  P    + + + + SA   P P+   S +A
Sbjct  682  LSDLPKPAPKQGEDLSLSGDGSASNSPAPAPSGSAEA  718



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   228 bits (581),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 115/168 (68%), Positives = 131/168 (78%), Gaps = 7/168 (4%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GV
Sbjct  839  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGV  898

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR MTD  K+ V+K++D RLS+ P+HE  H+FYVALLCVEEQAVERP MREVVQ+
Sbjct  899  DIVQWVRSMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQI  958

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLS  230
            L E+PK P   + E     ES   E  P   T +++      PPDLLS
Sbjct  959  LAEIPKMPLTKQLE----TESDVTEKAP---TMNESSPDSGSPPDLLS  999



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   228 bits (580),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRK+T G KE V+KI+DSRLST PI E  H+FYVA+LCVEEQAVERP MREVVQ+
Sbjct  906  DIVQWVRKITGGNKEEVMKIVDSRLSTPPIEEVTHVFYVAMLCVEEQAVERPTMREVVQI  965

Query  373  LTELP  359
            LTELP
Sbjct  966  LTELP  970



>gb|AAY32333.1| RLK1 [Phyllostachys praecox]
Length=804

 Score =   226 bits (577),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 110/162 (68%), Positives = 129/162 (80%), Gaps = 4/162 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPV EFGDGV
Sbjct  625  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVWEFGDGV  684

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV WV+ MTD  KE V+KILD RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  685  DIVHWVKMMTDLNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  744

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPST----GTSDDAKD  260
            L+ELP        E  +  + +A +PP +       +++AK+
Sbjct  745  LSELPSPTSKQGEEFPSGGDGAASDPPAAAESVEAVTNEAKE  786



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   228 bits (580),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 2/150 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFG+GV
Sbjct  850  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGEGV  909

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR+MT   KEGV++I+D RL T P+ E MH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  910  DIVQWVRRMTGCNKEGVLEIVDPRLPTVPLDEVMHVFYVAMLCVEEQSVERPTMREVVQI  969

Query  373  LTELPK--QPPGTKPEGTTACESSALEPPP  290
            LT+LP   +  G   E  T  +  A E PP
Sbjct  970  LTDLPNPARKQGEDREAATKEQQQAAEKPP  999



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score =   227 bits (578),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 5/163 (3%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGV
Sbjct  713  LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV  772

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W++ MT  K+E V+KI+D RLST P+HE MH+FYVALLCVEEQ+V+RP MREVVQ+
Sbjct  773  DIVHWIKMMTGSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI  832

Query  373  LTELPKQPPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  260
            L+ELPK       E  T      ES  + PP +    +D+AK+
Sbjct  833  LSELPKPTTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  875



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   227 bits (578),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 118/173 (68%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSGTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846   LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWVR++T  KK  V KILD RL T P+HE MH+F VA+LCVEEQ+VERP MREVVQ+
Sbjct  906   DIVQWVREVTGLKKGEVTKILDPRLPTVPLHEVMHVFCVAMLCVEEQSVERPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSALEPP----PSTGTSDDAKDqqqppPDLLSI  227
             LTELPK PP  K  G T      +  P    P T            P DLLS+
Sbjct  966   LTELPKPPP--KQGGDTPTPRGDVSAPRYIIPETREQQQQPASDSLPSDLLSM  1016



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   226 bits (577),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ MTD  KE V+KILD RLST P+HE MH+FYVALLC+EEQ+V+RP MREVVQ+
Sbjct  906  DIVQWVKMMTDSNKEQVMKILDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQI  965

Query  373  LTELPK  356
            L+ELPK
Sbjct  966  LSELPK  971



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   225 bits (573),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 111/153 (73%), Positives = 125/153 (82%), Gaps = 8/153 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G+KPVGEFG+GV
Sbjct  850  LQDAGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRKPVGEFGEGV  909

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVRKMTD  KEG +KILD RL TAP  EAMH+FYVA LCV+EQ+VERP MREVVQ+
Sbjct  910  DIVQWVRKMTDSNKEGALKILDPRLPTAPPDEAMHVFYVATLCVQEQSVERPTMREVVQI  969

Query  373  LTELPKQ-----PPGTKPEGTTACESSALEPPP  290
            LT+ PKQ      P  + E   A +S+   PPP
Sbjct  970  LTDPPKQGEDRETPIKEAEQQQAAQST---PPP  999



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 112/154 (73%), Positives = 125/154 (81%), Gaps = 9/154 (6%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSGTSECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGE GDGV
Sbjct  848  LQDSGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGELGDGV  907

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR+ TD KKEGV++ILD RL T P+ EAMH+FYVA+LCVEEQ+VERP MREVVQ+
Sbjct  908  DIVQWVRETTDSKKEGVLQILDRRLPTVPLDEAMHVFYVAMLCVEEQSVERPTMREVVQI  967

Query  373  LTELPK----QPP--GTKPEGTTACESSALEPPP  290
            L + PK      P    K +   A E+S   PPP
Sbjct  968  LMDRPKGHGCDAPIKEVKEQQQRAAENS---PPP  998



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   224 bits (570),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 110/153 (72%), Positives = 121/153 (79%), Gaps = 7/153 (5%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  849  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  908

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW + MT+  KE V+KILD RLST P+ E MH+FYVALLC EEQ+V+RP MREVVQ+
Sbjct  909  DIVQWAKMMTNSSKEQVMKILDPRLSTVPLQEVMHVFYVALLCTEEQSVQRPTMREVVQI  968

Query  373  LTELPKQPPGTK-----PEGTTACESSALEPPP  290
            L+ELPK  P  K     P       SS L P P
Sbjct  969  LSELPK--PANKQGEDVPNSGDGSASSPLHPAP  999



>gb|EMS67650.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=868

 Score =   223 bits (567),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 112/170 (66%), Positives = 127/170 (75%), Gaps = 17/170 (10%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  682  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  741

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ MT   KE V+KILD RLST P+HE MH+FYVALLC EE +V+RP MREVVQ+
Sbjct  742  DIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQI  801

Query  373  LTELPKQP------------PGTKPEGTTACESSALEPPPSTGTSDDAKD  260
            L+ELPK               G  PE  T   +S+ + P     + DAKD
Sbjct  802  LSELPKPAANQGDGEEELPLSGEGPESNTPAPTSSTDAP-----TGDAKD  846



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   221 bits (564),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 110/160 (69%), Positives = 126/160 (79%), Gaps = 5/160 (3%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  846   LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  905

Query  553   DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
             DIVQWV+ MT   KE V+KILD RLST P+HE MH+FYVALLC EE +V+RP MREVVQ+
Sbjct  906   DIVQWVKMMTGPSKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQI  965

Query  373   LTELPKQPPGTKPEGTTACESSA----LEPPPSTGTSDDA  266
             L+ELPK P  ++ +G      S       PP  T +S +A
Sbjct  966   LSELPK-PAASQGDGEEELPLSGDGPESNPPAPTSSSTEA  1004



>gb|EMT20446.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=866

 Score =   220 bits (561),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 108/156 (69%), Positives = 124/156 (79%), Gaps = 2/156 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  682  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  741

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ MT   KE V+KILD RLST P+HE MH+FYVALLC EE +V+RP MREVVQ+
Sbjct  742  DIVQWVKMMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQI  801

Query  373  LTELPKQPP--GTKPEGTTACESSALEPPPSTGTSD  272
            L+ELPK     G + E   + E     PP  T +++
Sbjct  802  LSELPKPAANQGDEEELPLSGEGPESNPPAPTSSTE  837



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 108/149 (72%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGV
Sbjct  843  LQDSGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGV  902

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +  T+  KE V+K+LD RLST P+HE  H+FYVALLC EEQ+V+RP MREVVQ+
Sbjct  903  DIVQWAKMTTNSNKEQVMKVLDPRLSTVPLHEVTHVFYVALLCTEEQSVQRPTMREVVQI  962

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPS  287
            L+ELPK PP TK +G         E P S
Sbjct  963  LSELPK-PPSTK-QGEENSTKQGEEVPNS  989



>gb|ACN35202.1| unknown [Zea mays]
Length=320

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGV
Sbjct  133  LQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGV  192

Query  553  DIVQWVRKMTDG-KKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIV WVR  T G  KE VVK++D RLS+ P+HE  H+F VALLCVEEQ+V+RP MREVVQ
Sbjct  193  DIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQ  252

Query  376  MLTELPK  356
            ML ELPK
Sbjct  253  MLGELPK  259



>ref|NP_001169902.1| uncharacterized protein LOC100383797 [Zea mays]
 gb|ACN27138.1| unknown [Zea mays]
Length=459

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGV
Sbjct  272  LQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGV  331

Query  553  DIVQWVRKMTDG-KKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIV WVR  T G  KE VVK++D RLS+ P+HE  H+F VALLCVEEQ+V+RP MREVVQ
Sbjct  332  DIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQ  391

Query  376  MLTELPK  356
            ML ELPK
Sbjct  392  MLGELPK  398



>ref|XP_009787949.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=1000

 Score =   213 bits (543),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  840  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+ K+E V  I+D RL+T P  EAMH+F+VA+LC++E +VERP MREV+QM
Sbjct  900  DIVQWSKRVTNCKREQVTHIVDPRLTTVPEDEAMHLFFVAMLCIQENSVERPTMREVIQM  959

Query  373  LTELPKQPPGTKPEGTT  323
            L+E P+Q P  +P  ++
Sbjct  960  LSEFPRQSPEYQPSSSS  976



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   211 bits (537),  Expect = 8e-59, Method: Composition-based stats.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQDSG S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGV
Sbjct  850  LQDSGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGV  909

Query  553  DIVQWVRKMTDG-KKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIV WVR  T G  KE VVK++D RLS+ P+HE  H+F VALLCVEEQ+V+RP MREVVQ
Sbjct  910  DIVHWVRSTTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQ  969

Query  376  MLTELPK  356
            ML ELPK
Sbjct  970  MLGELPK  976



>ref|XP_006649672.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1001

 Score =   210 bits (535),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 111/177 (63%), Positives = 124/177 (70%), Gaps = 20/177 (11%)
 Frame = -2

Query  724   SGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  545
             +G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV
Sbjct  834   AGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIV  893

Query  544   QWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  365
             QWVR +T   KEGV KI D RLST P+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+
Sbjct  894   QWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTD  953

Query  364   LP-----------KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             LP              PG K +GTT          P      D   +  P  DLLSI
Sbjct  954   LPGTAATPMDDAASHGPG-KDQGTTT--------SPEKPQQQDGSRESPPQQDLLSI  1001



>gb|EMT21762.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=313

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDI
Sbjct  161  NAGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDI  220

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQW +++TDG++E V K++D RLST P+ E  H+F+V++LCV+E +VERP MREVVQML+
Sbjct  221  VQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLS  280

Query  367  ELPKQ  353
            E P+ 
Sbjct  281  EFPRH  285



>ref|XP_009403711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403712.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   209 bits (533),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD G SE M AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  834  LQDGGASESMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  893

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++TD  ++ V  I D RLST PI E MH+F+VA+LCV+E +VERP MREVVQM
Sbjct  894  DIVQWAKRVTDCSRDNVAAIADPRLSTVPIAEVMHVFFVAMLCVQENSVERPTMREVVQM  953

Query  373  LTELPKQPPGTKPEGTTAC---ESSA  305
            L+E P   P +    ++A    ESS+
Sbjct  954  LSEFPHHVPESHSPSSSATALKESSS  979



>ref|XP_010912647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=992

 Score =   209 bits (531),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 91/138 (66%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  833  LQDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGEGV  892

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+  K  V KI+DSRLST PI+E MH+F++ +LC+ E ++ERP MREVVQM
Sbjct  893  DIVQWAKRITNCDKNNVAKIVDSRLSTVPINEVMHVFFITMLCIHENSIERPTMREVVQM  952

Query  373  LTELPKQPPGTKPEGTTA  320
            L+E P      +   ++A
Sbjct  953  LSEFPHHASEDQSPSSSA  970



>gb|AAM27467.1|AC099732_4 Putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=1001

 Score =   209 bits (531),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 104/167 (62%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  727   DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
             ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  836   NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  895

Query  547   VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
             V WVR +T   KEGV KI D RLST P+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT
Sbjct  896   VHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILT  955

Query  367   ELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             +LP     T  +  +       +        D +++   P  DLLSI
Sbjct  956   DLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1001



>ref|NP_001049453.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|ABF94768.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11367.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|EEE58640.1| hypothetical protein OsJ_10012 [Oryza sativa Japonica Group]
Length=1007

 Score =   209 bits (531),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 104/167 (62%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -2

Query  727   DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
             ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  842   NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  901

Query  547   VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
             V WVR +T   KEGV KI D RLST P+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT
Sbjct  902   VHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILT  961

Query  367   ELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             +LP     T  +  +       +        D +++   P  DLLSI
Sbjct  962   DLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1007



>ref|XP_009603651.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=1000

 Score =   208 bits (530),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 91/137 (66%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  840  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+ K+E V  I+D RL+T P  EAMH+F+VA+L ++E +VERP MREV+QM
Sbjct  900  DIVQWSKRVTNCKREQVRHIVDPRLTTVPEDEAMHLFFVAMLSIQENSVERPTMREVIQM  959

Query  373  LTELPKQPPGTKPEGTT  323
            L+E P+Q P  +P  ++
Sbjct  960  LSEFPRQSPEYQPSSSS  976



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  273  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  332

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            V WVR +T   KEGV+KI D RLST P++E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  333  VHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILA  392

Query  367  ELP  359
            ++P
Sbjct  393  DMP  395



>ref|XP_006858565.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
 gb|ERN20032.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
Length=803

 Score =   207 bits (527),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 2/135 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD+G SECM  IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G +PVG+FGDGV
Sbjct  617  LQDTGGSECMSVIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGHRPVGDFGDGV  676

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T G +  V  ILDSRL+  P+ E+MH+F++A+LCV+E ++ERP MREVVQM
Sbjct  677  DIVQWAKRTTGGDRRKVTLILDSRLNQVPLEESMHLFFIAMLCVQENSIERPTMREVVQM  736

Query  373  LTEL--PKQPPGTKP  335
            L+E   PK P  T P
Sbjct  737  LSEFPNPKPPSQTSP  751



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   208 bits (530),  Expect = 6e-58, Method: Composition-based stats.
 Identities = 106/161 (66%), Positives = 123/161 (76%), Gaps = 17/161 (11%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
             LQDSG+SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFG+GV
Sbjct  848   LQDSGSSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGEGV  907

Query  553   DIVQWVRKMTD--GKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVV  380
             DIVQWVRKMT+    + GV +I+D RL T P+ EA+H+F+VA+LCVEEQ+VERP MREVV
Sbjct  908   DIVQWVRKMTECGSNRGGVPQIVDPRLPTVPMDEAVHVFHVAMLCVEEQSVERPTMREVV  967

Query  379   QMLTELPKQPPGTKPEGTTACESSALE-----------PPP  290
             Q+L + PK      PE    CE+   E           PPP
Sbjct  968   QILMDAPK----AAPEQGDDCEAPTKEAKEHQQPAQTSPPP  1004



>ref|XP_004230451.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=995

 Score =   208 bits (529),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  833  LVDGGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  892

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +K+T+ K+E V  I+D RL++ P  EAMH+F++++LC++E +VERP MREV+QM
Sbjct  893  DIVQWSKKVTNCKREQVTHIVDPRLTSVPQDEAMHLFFISMLCIQENSVERPTMREVIQM  952

Query  373  LTELPKQPP  347
            L+E P+Q P
Sbjct  953  LSEFPRQSP  961



>dbj|BAJ99137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   208 bits (529),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 109/170 (64%), Positives = 122/170 (72%), Gaps = 13/170 (8%)
 Frame = -2

Query  727   DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
             ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDI
Sbjct  845   NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDI  904

Query  547   VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
             VQWVR  T   KEGV+KI D RLST PI E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  905   VQWVRMATGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILA  964

Query  367   ELP---KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
             ++P       GT+ E T   E    +     GT D          DLLSI
Sbjct  965   DMPGATSMTVGTRSEATVEVEEEHQD-----GTQDSP-----AQQDLLSI  1004



>gb|EEC74807.1| hypothetical protein OsI_10619 [Oryza sativa Indica Group]
Length=1010

 Score =   208 bits (529),  Expect = 9e-58, Method: Composition-based stats.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  840  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  899

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            V WVR +T   KEGV KI D RLST P+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT
Sbjct  900  VHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILT  959

Query  367  ELP  359
            +LP
Sbjct  960  DLP  962



>ref|XP_010930574.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=994

 Score =   207 bits (526),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQD G SECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  834  LQDGGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGNGV  893

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+  ++ V  I+DSRLST PI+E MH+F+VA+LCV+E +VERP MREVVQM
Sbjct  894  DIVQWAKRITNCNRDNVATIIDSRLSTVPINEVMHVFFVAMLCVQENSVERPTMREVVQM  953

Query  373  LTEL  362
            L+E 
Sbjct  954  LSEF  957



>ref|XP_010228930.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1008

 Score =   207 bits (526),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 103/145 (71%), Positives = 116/145 (80%), Gaps = 11/145 (8%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  844  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  903

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQWVR +    KEGV+KI D RLST PI E  H+FYVA+LCV EQ+VERP MREVVQ+LT
Sbjct  904  VQWVRMVAGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILT  963

Query  367  ELPKQPPGTKPEGTTACESSALEPP  293
            +LP         GTT   S +L PP
Sbjct  964  DLP---------GTTT--SMSLPPP  977



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 108/170 (64%), Positives = 125/170 (74%), Gaps = 11/170 (6%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDI
Sbjct  650  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDI  709

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQWVR  T   KEGV+KI D RLST PI E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  710  VQWVRTATGSSKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILA  769

Query  367  ELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAKD---qqqppPDLLSI  227
            ++P     T   GTT  E++        G  ++ +D   +     DLLSI
Sbjct  770  DMPGATSMTA--GTTRVEATV------EGEDEEHQDGPQESPAQQDLLSI  811



>ref|XP_006349327.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=999

 Score =   206 bits (525),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  837  LVDGGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +K+T+ K+E V  I+D RL+T P  EAMH+F++++LC++E +VERP MREV+QM
Sbjct  897  DIVQWSKKVTNCKREQVTHIVDPRLTTVPEDEAMHLFFISMLCIQENSVERPTMREVIQM  956

Query  373  LTELPKQ  353
            L+E P+Q
Sbjct  957  LSEFPRQ  963



>emb|CDO97616.1| unnamed protein product [Coffea canephora]
Length=1001

 Score =   206 bits (525),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  835  LVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEGV  894

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTA-PIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW R+ T+ ++E V  I+D RLSTA P  EAMH+F++A+LCV+E +VERP MREVVQ
Sbjct  895  DIVQWARRATNCRREEVDGIVDPRLSTAVPKDEAMHLFFIAMLCVQENSVERPTMREVVQ  954

Query  376  MLTELPKQPPGTKPEGTT  323
            ML+E P+Q   T P+  T
Sbjct  955  MLSEFPRQFSSTPPDYRT  972



>ref|XP_006431638.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
 gb|ESR44878.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
Length=997

 Score =   206 bits (524),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  840  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  899

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+G+KE  + ILD RLST P  EAMH+ +VA+LC++E ++ERP+MREVVQM
Sbjct  900  DIVQWSKRATNGRKEEFLSILDPRLSTVPKEEAMHLLFVAMLCIQENSIERPRMREVVQM  959

Query  373  LTELPKQ  353
            L+E P+ 
Sbjct  960  LSEFPRH  966



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   205 bits (522),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  853  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  912

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW ++ T+  KEGVVKILD R S  P+ EAM +F+VA+LCVEE +VERP MREVVQ
Sbjct  913  LDIVQWTKRQTNWNKEGVVKILDQRASNIPVEEAMQVFFVAMLCVEEHSVERPTMREVVQ  972

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  973  MLAQ-AKQP  980



>ref|XP_004985112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Setaria italica]
Length=998

 Score =   205 bits (522),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 105/169 (62%), Positives = 124/169 (73%), Gaps = 5/169 (3%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  833  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDI  892

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQWVR +T   KEGV+KI D RLST P++E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  893  VQWVRMVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILA  952

Query  367  ELPKQPPGT--KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  227
            ++P     +   P      E ++ E PP      +      P  DLLSI
Sbjct  953  DMPGSTSTSIDAPLVIEPKEDASSEKPPR---QQEGPHDSPPQQDLLSI  998



>ref|XP_009355307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   205 bits (521),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  837  LMDGGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  EAMHMF++A+LC++E +VERP MREVVQ
Sbjct  897  DIVQWSKKATNCRKEDVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQ  956

Query  376  MLTELPKQPP  347
            ML+E P+  P
Sbjct  957  MLSEFPRHTP  966



>ref|XP_006859064.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
 gb|ERN20531.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
Length=737

 Score =   203 bits (516),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G++PVGEFGDGV
Sbjct  596  LLDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLVELITGRRPVGEFGDGV  655

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +  T   KEGV +ILDSRL   PI EA H+F+VA+LCV+EQ+VERP MREVV M
Sbjct  656  DIVQWAKSTTSACKEGVFEILDSRLKDIPIEEAKHVFFVAMLCVQEQSVERPTMREVVHM  715

Query  373  LTE  365
            L +
Sbjct  716  LQQ  718



>ref|NP_001145765.1| uncharacterized protein LOC100279272 [Zea mays]
 gb|ACL52548.1| unknown [Zea mays]
Length=771

 Score =   203 bits (516),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  603  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  662

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            V WVR +T   KEGV+KI D RLST P++E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  663  VHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILA  722

Query  367  ELP  359
            ++P
Sbjct  723  DMP  725



>gb|KDO77158.1| hypothetical protein CISIN_1g012213mg [Citrus sinensis]
Length=468

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  335  LQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  394

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQ
Sbjct  395  LDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQ  454

Query  376  MLTELPKQPPGT  341
            ML +   Q P T
Sbjct  455  MLAQ--AQKPNT  464



>gb|EYU26470.1| hypothetical protein MIMGU_mgv1a019834mg [Erythranthe guttata]
Length=1001

 Score =   204 bits (519),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 90/126 (71%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVGEFG+GV
Sbjct  839  LVDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGEFGEGV  898

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWVR  T+ ++E V +I+D R++ AP  EAMH+F+VA+LCV+E +VERP MREVVQM
Sbjct  899  DIVQWVRCSTNCRREDVTRIIDPRITVAPKDEAMHLFFVAMLCVQENSVERPTMREVVQM  958

Query  373  LTELPK  356
            L+E P+
Sbjct  959  LSEFPR  964



>ref|XP_003592924.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1007

 Score =   204 bits (519),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D   +ECM +IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG+GV
Sbjct  838  LVDGAAAECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRKPVGDFGEGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            D+VQW +K T+G++E VV I+DSRL   P  EAMHMF++A+LC+EE +V+RP MREVVQM
Sbjct  898  DLVQWCKKATNGRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEENSVQRPTMREVVQM  957

Query  373  LTELPKQ  353
            L+E P+Q
Sbjct  958  LSEFPRQ  964



>gb|KDO44093.1| hypothetical protein CISIN_1g001922mg [Citrus sinensis]
Length=995

 Score =   204 bits (519),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  838  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+G+KE  + ILD RLS  P  EAMH+ +VA+LC++E ++ERP+MREVVQM
Sbjct  898  DIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQM  957

Query  373  LTELPKQ  353
            L+E P+ 
Sbjct  958  LSEFPRH  964



>ref|XP_006492589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=995

 Score =   204 bits (519),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  838  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+G+KE  + ILD RLS  P  EAMH+ +VA+LC++E ++ERP+MREVVQM
Sbjct  898  DIVQWSKRATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQM  957

Query  373  LTELPKQ  353
            L+E P+ 
Sbjct  958  LSEFPRH  964



>ref|XP_008356104.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   204 bits (518),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  854  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+ +KEGV+KILD RL T P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  914  MDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEQSVERPTMREVVQ  973

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  974  MLAQ-AKQP  981



>ref|XP_007224667.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
 gb|EMJ25866.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
Length=998

 Score =   204 bits (518),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  836  LIDGGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  895

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  EAMH+F++A+LC++E +VERP MREVVQ
Sbjct  896  DIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIAMLCIQEHSVERPTMREVVQ  955

Query  376  MLTELPKQPP  347
            ML+E P+  P
Sbjct  956  MLSEFPRHSP  965



>tpg|DAA44225.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1002

 Score =   203 bits (517),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDI
Sbjct  834  NAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDI  893

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            V WVR +T   KEGV+KI D RLST P++E  H+FYVA+LCV EQ+VERP MREVVQ+L 
Sbjct  894  VHWVRTVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILA  953

Query  367  ELP  359
            ++P
Sbjct  954  DMP  956



>gb|KDP42443.1| hypothetical protein JCGZ_00240 [Jatropha curcas]
Length=995

 Score =   203 bits (517),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  835  LTDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGEGV  894

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW R++T  ++E V++++D RL+  P  EAMH+F++A+LC +E ++ERP MREVVQM
Sbjct  895  DIVQWSRRVTSNRREDVMQVVDRRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQM  954

Query  373  LTELPKQPP  347
            L+E P+  P
Sbjct  955  LSEFPRHSP  963



>ref|XP_009363288.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   203 bits (517),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  854  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+ +KEGV+KILD RL   P+ EAM +F+VA+LCVEEQ+VERP MREVVQ
Sbjct  914  MDIVQWTKIQTNSQKEGVIKILDKRLDAVPMDEAMQVFFVAVLCVEEQSVERPTMREVVQ  973

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  974  MLAQ-AKQP  981



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   203 bits (516),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  849  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  908

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  TD +KEGV+KILD RL + P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  909  MDIVQWTKLQTDSRKEGVIKILDQRLGSVPLDEAMQVFFVAVLCVQEHSVERPTMREVVQ  968

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  969  MLAQ-AKQP  976



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score =   202 bits (513),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 89/137 (65%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  756  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGV  815

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+  KE V++I+D RL+T P +EA H+F++ALLC+EE +VERP MREVVQM
Sbjct  816  DIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQM  875

Query  373  LTELPKQPPGTKPEGTT  323
            L+E  +  P  K   ++
Sbjct  876  LSESHRNSPDNKTSSSS  892



>ref|XP_010520784.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Tarenaya hassleriana]
Length=958

 Score =   202 bits (514),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 97/162 (60%), Positives = 119/162 (73%), Gaps = 18/162 (11%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GV
Sbjct  802  LTDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGV  861

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ +T  +KE V+ ++D RLS  P  EA H+ +VA+LCVEE +VERP MREVVQM
Sbjct  862  DIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQM  921

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  263
            L E P      +PE       +   PPP+      G ++DAK
Sbjct  922  LLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  950



>ref|XP_008218726.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=982

 Score =   202 bits (514),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  820  LIDGGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  879

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  EAMH+F++A LC++E +VERP MREVVQ
Sbjct  880  DIVQWSKKATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIATLCIQEHSVERPTMREVVQ  939

Query  376  MLTELPKQPP  347
            ML+E P+  P
Sbjct  940  MLSEFPRHSP  949



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   202 bits (514),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  854  LQDTGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+ +KEGV+KILD RL T P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  914  MDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQ  973

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  974  MLAQ-AKQP  981



>ref|XP_008349109.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   202 bits (514),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  854  LQDTGTSECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+ +KEGV+KILD RL T P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  914  MDIVQWTKIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQ  973

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  974  MLAQ-AKQP  981



>ref|XP_010520783.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Tarenaya hassleriana]
Length=994

 Score =   202 bits (514),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 97/162 (60%), Positives = 119/162 (73%), Gaps = 18/162 (11%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GV
Sbjct  838  LTDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGV  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQWV+ +T  +KE V+ ++D RLS  P  EA H+ +VA+LCVEE +VERP MREVVQM
Sbjct  898  DIVQWVKTVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQM  957

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPST-----GTSDDAK  263
            L E P      +PE       +   PPP+      G ++DAK
Sbjct  958  LLEFP------RPE-------TPFSPPPAVHSPCKGVTNDAK  986



>ref|XP_008786484.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Phoenix dactylifera]
Length=995

 Score =   202 bits (514),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 87/125 (70%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L+D G SECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  834  LRDGGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGNGV  893

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+  ++ V  I+DSRLST PI+E MH+F++A+LC+ E +VERP MREVV M
Sbjct  894  DIVQWAKRITNCSRDNVATIVDSRLSTMPINEVMHVFFIAMLCIXENSVERPTMREVVLM  953

Query  373  LTELP  359
            L+E P
Sbjct  954  LSEFP  958



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   202 bits (514),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQ+SGTSECM AIAGSYGYIAPEYAYTLKVDE+SDVYSFGVVLLEL++G++PVG+FG DG
Sbjct  859  LQNSGTSECMSAIAGSYGYIAPEYAYTLKVDERSDVYSFGVVLLELITGRRPVGDFGEDG  918

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGVVKILD RL   P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  919  MDIVQWTKIKTNWSKEGVVKILDERLKNVPVDEAMQVFFVAMLCVQEHSVERPTMREVVQ  978

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  979  MLAQ-AKQP  986



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score =   202 bits (513),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 89/137 (65%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  837  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+  KE V++I+D RL+T P +EA H+F++ALLC+EE +VERP MREVVQM
Sbjct  897  DIVQWAKRTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQM  956

Query  373  LTELPKQPPGTKPEGTT  323
            L+E  +  P  K   ++
Sbjct  957  LSESHRNSPDNKTSSSS  973



>ref|XP_006468612.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like isoform X1 [Citrus sinensis]
Length=987

 Score =   201 bits (512),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 3/132 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  854  LQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQ
Sbjct  914  LDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQ  973

Query  376  MLTELPKQPPGT  341
            ML +   Q P T
Sbjct  974  MLAQ--AQKPNT  983



>dbj|BAJ90459.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1024

 Score =   202 bits (513),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/125 (69%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            ++G SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDI
Sbjct  867  NAGASECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDI  926

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQW +++TDG++E V K++D RLST P+ E  H+F+V++LCV+E +VERP MREVVQML+
Sbjct  927  VQWAKRVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLS  986

Query  367  ELPKQ  353
            E P+ 
Sbjct  987  EFPRH  991



>ref|XP_008795253.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=992

 Score =   201 bits (512),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFGDGV
Sbjct  833  LHDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGDGV  892

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W +K+T+  K    +I+DSRL   PI+E MH+F++A+LC  E ++ERP MREVVQM
Sbjct  893  DIVHWAKKITNCDKNNASRIVDSRLGAVPINEVMHIFFIAMLCTHENSIERPTMREVVQM  952

Query  373  LTELPKQPPGTKPEGTTA  320
            L+E P      +   ++A
Sbjct  953  LSEFPHHASEDQSPSSSA  970



>ref|XP_011087678.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=992

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G +PVG FG+GV
Sbjct  835  LVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGHRPVGGFGEGV  894

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW+R  T+  +E V +I+D RL+  P  EAMH+F+VA+LCV+E  VERP MREVVQM
Sbjct  895  DIVQWIRCSTNCNREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQENCVERPTMREVVQM  954

Query  373  LTELPKQPP  347
            L+E P++ P
Sbjct  955  LSEFPRRSP  963



>ref|XP_007041221.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX97052.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=988

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 84/129 (65%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVV+LEL++G++PVG+FG+GV
Sbjct  834  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVILELITGRRPVGDFGEGV  893

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W +++T+ ++E V++I+D RL+T P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  894  DIVHWAKRVTNCRREEVMRIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  953

Query  373  LTELPKQPP  347
            L+E P+  P
Sbjct  954  LSEFPRHSP  962



>ref|XP_008347921.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 90/126 (71%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  837  LMDGGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  EAMHMF++A+LC++E +VERP MREVVQ
Sbjct  897  DIVQWSKKATNCRKEXVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQ  956

Query  376  MLTELP  359
            ML+E P
Sbjct  957  MLSEFP  962



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score =   201 bits (510),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 89/137 (65%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  815  LIDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGV  874

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+  KE V+ I+D RL+T P +EA H+F++ALLC+EE +VERP MREVVQM
Sbjct  875  DIVQWAKRTTNCCKENVIXIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQM  934

Query  373  LTELPKQPPGTKPEGTT  323
            L+E  +  P  K   ++
Sbjct  935  LSESHRNSPDNKTSSSS  951



>gb|KDP23869.1| hypothetical protein JCGZ_27138 [Jatropha curcas]
Length=989

 Score =   201 bits (510),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  856  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGGFGEEG  915

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KE VVKILD RLS  P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  916  LDIVQWTKIQTNSSKERVVKILDQRLSEIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQ  975

Query  376  MLTELPKQP  350
            ML E  KQP
Sbjct  976  MLAE-AKQP  983



>ref|XP_008339390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   201 bits (511),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 89/128 (70%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTS+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  837  LMDGGTSQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTA-PIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  EAMHMF++A+LC++E +VERP MREVVQ
Sbjct  897  DIVQWSKKATNCRKEDVTNIVDHRLTVSLPKDEAMHMFFIAMLCIQENSVERPTMREVVQ  956

Query  376  MLTELPKQ  353
            ML+E P+ 
Sbjct  957  MLSEFPRH  964



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score =   200 bits (509),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 3/132 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM A+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  854  LQDTGASECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGVVKILD RLS  P+ EAM +F+VA LCV+E  VERP MREVVQ
Sbjct  914  LDIVQWTKMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVATLCVQEHGVERPTMREVVQ  973

Query  376  MLTELPKQPPGT  341
            ML +   Q P T
Sbjct  974  MLAQ--AQKPNT  983



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   200 bits (509),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  855  LRDTGNSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T   KEGVVKILD RL+  P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  915  LDIVQWTKTQTKSSKEGVVKILDQRLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQ  974

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  975  MLAQ-AKQP  982



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   200 bits (509),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  854  LQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGNFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW    T+  KEGVVKILD RL   P++EAM +F+VA+LCV+E ++ERP MREVVQ
Sbjct  914  LDIVQWANIQTNWSKEGVVKILDERLKNVPLNEAMQVFFVAMLCVQEHSIERPTMREVVQ  973

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  974  MLAQ-AKQP  981



>gb|AAX96206.1| Similar to receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 gb|ABA92267.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=1061

 Score =   201 bits (510),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -2

Query  724   SGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  545
             + +SECM A+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIV
Sbjct  903   TASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIV  962

Query  544   QWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  365
             QW +++TDG++E V +I+D R+ST P+ E  H+F+V++LCV+E +VERP MREVVQML+E
Sbjct  963   QWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSE  1022

Query  364   LPK----QPPGTKPEGTTACESSALEPP  293
              P+    QP  +     T  ESS  + P
Sbjct  1023  FPRHGSDQPSPSSSAPETGEESSPEKEP  1050



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   200 bits (508),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  855  LQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T   KEGVVKILD  L+  P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  915  LDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQ  974

Query  376  MLTELPKQP  350
            ML E  KQP
Sbjct  975  MLAE-AKQP  982



>gb|EEC67924.1| hypothetical protein OsI_35629 [Oryza sativa Indica Group]
Length=1035

 Score =   200 bits (509),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -2

Query  724   SGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  545
             + +SECM A+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIV
Sbjct  877   TASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIV  936

Query  544   QWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  365
             QW +++TDG++E V +I+D R+ST P+ E  H+F+V++LCV+E +VERP MREVVQML+E
Sbjct  937   QWTKRVTDGRRESVHRIVDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSE  996

Query  364   LPK----QPPGTKPEGTTACESSALEPP  293
              P+    QP  +     T  ESS  + P
Sbjct  997   FPRHGSDQPSPSSSAPETGEESSPEKEP  1024



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   200 bits (508),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  853  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  912

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGV+KILD RL + P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  913  LDIVQWTKIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCVQEQSVERPTMREVVQ  972

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  973  MLAQ-AKQP  980



>ref|XP_011092305.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=1004

 Score =   200 bits (508),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 89/130 (68%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVG-EFGDG  557
            L D G S+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG EFG+G
Sbjct  847  LVDGGASQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGEFGEG  906

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            VDIVQW +  TD ++E V +ILD RL+  P  EAMH+F+VA+LC++E +VERP MREVVQ
Sbjct  907  VDIVQWTKCSTDCRREEVSRILDPRLAVVPKDEAMHLFFVAMLCIQENSVERPTMREVVQ  966

Query  376  MLTELPKQPP  347
            ML+E P++ P
Sbjct  967  MLSEFPRRSP  976



>ref|XP_004485432.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   199 bits (507),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM +IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++GKKPVG+FG+GV
Sbjct  840  LVDGGASECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGKKPVGDFGEGV  899

Query  553  DIVQWVRKMTD-GKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            D+VQW +K T+ G++E V  I+DSRL   P  E MHMF++A+LC+EE +V+RP MREVVQ
Sbjct  900  DLVQWCKKSTNGGRREDVFNIVDSRLVVVPKEEVMHMFFIAMLCLEENSVQRPTMREVVQ  959

Query  376  MLTELPKQ  353
            ML+E P Q
Sbjct  960  MLSEFPPQ  967



>ref|XP_008799579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Phoenix dactylifera]
Length=984

 Score =   199 bits (507),  Expect = 8e-55, Method: Composition-based stats.
 Identities = 95/131 (73%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  851  LRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  910

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+EQ+VERP MREVVQ
Sbjct  911  LDIVQWARMNTNWSKEGVVKILDPRLINFPLEEAMQVFFVGMLCVQEQSVERPTMREVVQ  970

Query  376  MLTELPKQPPG  344
            ML E  KQP G
Sbjct  971  ML-EQTKQPFG  980



>gb|KJB32855.1| hypothetical protein B456_005G265400 [Gossypium raimondii]
Length=992

 Score =   199 bits (507),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L   G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG+G+
Sbjct  838  LVGGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGEGI  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W + +T+ +K  V  I+D RL+T P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  898  DIVHWTKLVTNCRKAEVTSIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  957

Query  373  LTELPKQPP  347
            L+E P+Q P
Sbjct  958  LSEFPRQSP  966



>gb|KHG14208.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=992

 Score =   199 bits (507),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG+G+
Sbjct  838  LVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGEGI  897

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIV W + +T+ +   V  I+D RL+T P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  898  DIVHWTKLVTNCRIAEVTNIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  957

Query  373  LTELPKQPP  347
            L+E P+Q P
Sbjct  958  LSEFPRQSP  966



>gb|KCW57119.1| hypothetical protein EUGRSUZ_I02765 [Eucalyptus grandis]
Length=760

 Score =   197 bits (502),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  599  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGV  658

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +KMT  +KE V  I+D +L   P  EA H+F++A+LCV++ +VERP MREVVQM
Sbjct  659  DIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVERPTMREVVQM  718

Query  373  LTELPKQPP  347
            L+E P+  P
Sbjct  719  LSEYPRHSP  727



>ref|XP_002526451.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF35946.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   199 bits (506),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 87/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  836  LIDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  895

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +++T+ +KE V+ I+DSRL+  P  E MH+F++ALLC +E ++ERP MREVVQM
Sbjct  896  DIVQWSKRVTNNRKEDVLNIIDSRLTMVPKDEVMHLFFIALLCSQENSIERPTMREVVQM  955

Query  373  LTELPKQ  353
            L+E  + 
Sbjct  956  LSEFHRH  962



>ref|XP_009353760.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   199 bits (505),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/128 (69%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D GTS+CM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  837  LMDGGTSQCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  896

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTA-PIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +K T+ +KE V  I+D RL+ + P  E MHMF++A+LC++E +VERP MREVVQ
Sbjct  897  DIVQWSKKATNCRKEDVTNIVDHRLTISLPKDEVMHMFFIAMLCIQENSVERPTMREVVQ  956

Query  376  MLTELPKQ  353
            ML+E P+ 
Sbjct  957  MLSEFPRH  964



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  855  LRDTGNSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T   KEGVVKILD RL   P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  915  LDIVQWTKTQTKSSKEGVVKILDQRLIDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQ  974

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  975  MLAQ-AKQP  982



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 91/129 (71%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  873  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  932

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGV+KILD RL+  P+ EAM +F+V +LCV+E +VERP MREVVQ
Sbjct  933  LDIVQWTKMNTNWNKEGVMKILDERLTNVPLDEAMQVFFVGMLCVQEHSVERPTMREVVQ  992

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  993  MLVQ-AKQP  1000



>gb|KHG23359.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Gossypium arboreum]
Length=995

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 3/130 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  861  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  920

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVV  380
            +DIVQW ++ T  KKEGVVKILD R+S T P  E M +F+VA+LCVEE +VERP MREVV
Sbjct  921  LDIVQWSKRETKLKKEGVVKILDHRVSNTIPKEEVMQVFFVAMLCVEEHSVERPTMREVV  980

Query  379  QMLTELPKQP  350
            QML +  KQP
Sbjct  981  QMLAQ-AKQP  989



>ref|XP_010687839.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1010

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/130 (69%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  849  LADGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGV  908

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW R  T+ +KE V  ILDSRL+  P  EAMH+F+VA+LC +E ++ERP MREVVQM
Sbjct  909  DIVQWSRVQTNCRKETVPIILDSRLTAVPQDEAMHLFFVAMLCTQENSIERPTMREVVQM  968

Query  373  LTELPKQPPG  344
            L+E P    G
Sbjct  969  LSEYPYHAMG  978



>ref|XP_010243895.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Nelumbo nucifera]
 ref|XP_010243896.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Nelumbo nucifera]
 ref|XP_010243898.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X3 [Nelumbo nucifera]
Length=991

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+F +GV
Sbjct  833  LVDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFEEGV  892

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ +KE V++I+D RL+  PI EAMH+F++A+LCV+E +VERP MREVVQM
Sbjct  893  DIVQWAKRSTNCRKEEVIRIIDPRLTGVPIDEAMHVFFIAMLCVQENSVERPTMREVVQM  952

Query  373  LTEL  362
            L+E 
Sbjct  953  LSEF  956



>gb|KJB32927.1| hypothetical protein B456_005G268400 [Gossypium raimondii]
Length=995

 Score =   198 bits (504),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 3/130 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  861  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  920

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLS-TAPIHEAMHMFYVALLCVEEQAVERPKMREVV  380
            +DIVQW ++ T  KKEGVVKILD R+S T P  E M +F+VA+LCVEE +VERP MREVV
Sbjct  921  LDIVQWSKRETKLKKEGVVKILDHRVSNTIPEEEVMQVFFVAMLCVEEHSVERPTMREVV  980

Query  379  QMLTELPKQP  350
            QML +  KQP
Sbjct  981  QMLAQ-AKQP  989



>ref|XP_003576141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1043

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -2

Query  715   SECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWV  536
             SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQW 
Sbjct  890   SECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWA  949

Query  535   RKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  356
             +++TDG++EGV K++D RLST  + E  H+F+V++LCV+E +VERP MREVVQML+E P+
Sbjct  950   KRVTDGRREGVPKVVDRRLSTVAMDEVAHLFFVSMLCVQENSVERPTMREVVQMLSEFPR  1009

Query  355   Q  353
              
Sbjct  1010  H  1010



>ref|XP_006385034.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
 gb|ERP62831.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
Length=1001

 Score =   198 bits (504),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 87/134 (65%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  835  LVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  894

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ +KE  + I+D RL+  P  EAMH+F++A+LC +E ++ERP MREVVQM
Sbjct  895  DIVQWSKRATNSRKEDAMHIVDPRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQM  954

Query  373  LTELPKQPPGTKPE  332
            L+E P+    T P+
Sbjct  955  LSEFPRH---TSPD  965



>ref|XP_011028346.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1001

 Score =   198 bits (503),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 87/134 (65%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G S+CM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  835  LVDGGASQCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  894

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ +KE  + I+D RL+  P  EAMH+F++A+LC +E ++ERP MREVVQM
Sbjct  895  DIVQWSKRATNSRKEDAMHIVDPRLTMVPKAEAMHLFFIAMLCSQENSIERPTMREVVQM  954

Query  373  LTELPKQPPGTKPE  332
            L+E P+    T P+
Sbjct  955  LSEFPRH---TSPD  965



>ref|XP_009401113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=987

 Score =   197 bits (502),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 93/157 (59%), Positives = 112/157 (71%), Gaps = 13/157 (8%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            LQ  G SE M AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FGDGV
Sbjct  831  LQHGGASETMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGDGV  890

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW + +T   ++    I+D RLST P+ E MH+F+VA+LCV+E +VERP MREVVQM
Sbjct  891  DIVQWAKSVTSCSRDNAAAIVDPRLSTVPVDELMHVFFVAMLCVQENSVERPTMREVVQM  950

Query  373  LTELPKQPPGTKPEGTTACESSALEPPPSTGTSDDAK  263
            L+E P   P               + P S+ T+ D K
Sbjct  951  LSEFPHHVPEN-------------QSPSSSSTARDKK  974



>gb|EEE51888.1| hypothetical protein OsJ_33462 [Oryza sativa Japonica Group]
Length=881

 Score =   196 bits (499),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 89/148 (60%), Positives = 119/148 (80%), Gaps = 4/148 (3%)
 Frame = -2

Query  724  SGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIV  545
            + +SECM A+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIV
Sbjct  723  TASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIV  782

Query  544  QWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  365
            QW +++TDG++E V +I+D R+ST P+ E  H+F+V++LCV+E +VERP MREVVQML+E
Sbjct  783  QWTKRVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSE  842

Query  364  LPK----QPPGTKPEGTTACESSALEPP  293
             P+    QP  +     T  ESS  + P
Sbjct  843  FPRHGSDQPSPSSSAPETGEESSPEKEP  870



>ref|XP_010030176.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=994

 Score =   197 bits (502),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GV
Sbjct  833  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGV  892

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +KMT  +KE V  I+D +L   P  EA H+F++A+LCV++ +VERP MREVVQM
Sbjct  893  DIVQWSKKMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVERPTMREVVQM  952

Query  373  LTELPKQPP  347
            L+E P+  P
Sbjct  953  LSEYPRHSP  961



>ref|XP_009392568.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=1040

 Score =   197 bits (502),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  727  DSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDI  548
            D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGVDI
Sbjct  869  DNGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGDGVDI  928

Query  547  VQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLT  368
            VQWV++ T  ++E    I+D RLS+ P  E MH+F+V++LCV+E +VERP MREVVQML+
Sbjct  929  VQWVKRATACRRENAASIVDCRLSSVPTDEVMHVFFVSMLCVQENSVERPTMREVVQMLS  988

Query  367  ELP  359
            E P
Sbjct  989  EFP  991



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   197 bits (501),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQ +G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  855  LQGTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T   KEGVVKILD  L+  P+ EAM +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  915  LDIVQWTKTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQ  974

Query  376  MLTELPKQP  350
            ML E  KQP
Sbjct  975  MLAE-AKQP  982



>gb|KJB16198.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=770

 Score =   195 bits (496),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GV
Sbjct  626  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGV  685

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ ++E V  I+D RL++ P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  686  DIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  745

Query  373  LTELPKQ  353
            L+E  + 
Sbjct  746  LSEFARH  752



>ref|XP_009600411.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=964

 Score =   196 bits (499),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQ++GTSECM AIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G++PVG FG +G
Sbjct  831  LQNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGRRPVGNFGEEG  890

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            VDIVQW ++ T+  KEGVVKILD RL      EAM +F+VA+LCVEE +VERP MREVVQ
Sbjct  891  VDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQ  950

Query  376  MLTELPKQP  350
            ML++  KQP
Sbjct  951  MLSQ-AKQP  958



>gb|KCW62729.1| hypothetical protein EUGRSUZ_G00319 [Eucalyptus grandis]
Length=958

 Score =   196 bits (499),  Expect = 9e-54, Method: Composition-based stats.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L DSG SECM  IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  805  LVDSGGSECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  864

Query  553  DIVQWVR-KMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +   T+ ++E   +++D RLS  P  EA H+F+VA+LCV+E + ERP MREVVQ
Sbjct  865  DIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQ  924

Query  376  MLTELPKQPP  347
            ML+E P+ PP
Sbjct  925  MLSEFPRHPP  934



>ref|XP_008793131.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Phoenix dactylifera]
Length=813

 Score =   195 bits (496),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG +G
Sbjct  680  LRDTGVSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVGDFGEEG  739

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+EQ+VERP MREVVQ
Sbjct  740  LDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQ  799

Query  376  MLTE  365
            ML +
Sbjct  800  MLEQ  803



>ref|XP_010065309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=990

 Score =   196 bits (499),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L DSG SECM  IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGV
Sbjct  837  LVDSGGSECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGV  896

Query  553  DIVQWVR-KMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW +   T+ ++E   +++D RLS  P  EA H+F+VA+LCV+E + ERP MREVVQ
Sbjct  897  DIVQWTKIATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQ  956

Query  376  MLTELPKQPP  347
            ML+E P+ PP
Sbjct  957  MLSEFPRHPP  966



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG +G
Sbjct  855  LRDTGVSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVGDFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+EQ+VERP MREVVQ
Sbjct  915  LDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQ  974

Query  376  MLTE  365
            ML +
Sbjct  975  MLEQ  978



>ref|XP_010918071.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=984

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  851  LRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  910

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LC++EQ+VERP MREVVQ
Sbjct  911  LDIVQWARMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCIQEQSVERPTMREVVQ  970

Query  376  MLTE  365
            ML +
Sbjct  971  MLEQ  974



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score =   196 bits (497),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 89/124 (72%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  853  LQDTGTSECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  912

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGV+KILD RL + P+ EAM +F+VA+LC +EQ+VERP MREVVQ
Sbjct  913  LDIVQWTKIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCAQEQSVERPTMREVVQ  972

Query  376  MLTE  365
            ML +
Sbjct  973  MLAQ  976



>ref|XP_010094628.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
 gb|EXB56447.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
Length=998

 Score =   196 bits (497),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 13/140 (9%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVG+FG +G
Sbjct  854  LQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGDFGEEG  913

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLST-----------APIHEAMHMFYVALLCVEEQA  410
            +DIVQW +  T+  KEGVVKILD RL +            PI +AM +F+VA+LCV+EQ+
Sbjct  914  MDIVQWTKINTESSKEGVVKILDERLMSNNINNNNNNDDVPIEQAMQVFFVAMLCVQEQS  973

Query  409  VERPKMREVVQMLTELPKQP  350
            VERP MR+VVQML +  KQP
Sbjct  974  VERPTMRDVVQMLAQ-AKQP  992



>ref|XP_009763204.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=958

 Score =   195 bits (496),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 91/129 (71%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQ++GTSECM AIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G++PVG FG +G
Sbjct  825  LQNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGRRPVGNFGEEG  884

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW ++ T+  KEGVVKILD RL      EAM +F+VA+LCVEE +VERP MREVVQ
Sbjct  885  LDIVQWAKRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQ  944

Query  376  MLTELPKQP  350
            ML++  KQP
Sbjct  945  MLSQ-AKQP  952



>gb|KHG17337.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1006

 Score =   195 bits (496),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GV
Sbjct  862  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGV  921

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ ++E V  I+D RL++ P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  922  DIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  981

Query  373  LTELPKQ  353
            L+E  + 
Sbjct  982  LSEFARH  988



>gb|KJB16199.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=1007

 Score =   195 bits (496),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GV
Sbjct  863  LVDGGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGV  922

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW ++ T+ ++E V  I+D RL++ P  EAMH+ ++A+LCV+E ++ERP MREVVQM
Sbjct  923  DIVQWAKRSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQM  982

Query  373  LTELPKQ  353
            L+E  + 
Sbjct  983  LSEFARH  989



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score =   194 bits (494),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  855  LQDNGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEG  914

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KEGVVKILD RL   P  EA+  F+VA+LCV+E +VERP MREV+Q
Sbjct  915  LDIVQWSKIQTNWSKEGVVKILDERLRNVPEDEAIQTFFVAMLCVQEHSVERPTMREVIQ  974

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  975  MLAQ-AKQP  982



>ref|XP_010087435.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
 gb|EXB29045.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
Length=1014

 Score =   194 bits (493),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 90/135 (67%), Positives = 109/135 (81%), Gaps = 8/135 (6%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L D G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GV
Sbjct  846  LFDGGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGV  905

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTA--------PIHEAMHMFYVALLCVEEQAVERP  398
            DIVQW +K T+ ++E V++I+D RL T         P  EAMH+F++A LCV+E +VERP
Sbjct  906  DIVQWCKKATNCRREDVLQIVDRRLMTTSTTANYNVPKEEAMHLFFIATLCVQENSVERP  965

Query  397  KMREVVQMLTELPKQ  353
             MREVVQML+EL + 
Sbjct  966  TMREVVQMLSELTRH  980



>emb|CDX93999.1| BnaC07g36330D [Brassica napus]
Length=844

 Score =   192 bits (489),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  714  LQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  773

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  774  IDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  833

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  834  MISQ-AKQP  841



>emb|CDX98665.1| BnaA03g44500D [Brassica napus]
Length=844

 Score =   192 bits (489),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  714  LQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  773

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  774  IDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  833

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  834  MISQ-AKQP  841



>emb|CDY54567.1| BnaA08g30460D [Brassica napus]
Length=844

 Score =   192 bits (488),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  714  MQDDGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  773

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  K+GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  774  IDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  833

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  834  MISQ-AKQP  841



>ref|XP_004491265.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=976

 Score =   193 bits (490),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 4/131 (3%)
 Frame = -2

Query  733  LQDS--GTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-  563
            LQD+  GTSECM +I GSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG 
Sbjct  842  LQDAANGTSECMSSIVGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGE  901

Query  562  DGVDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREV  383
            +G+DIVQW +  TD  KE VVKILD RL   P+ EAM +F+VA+LCV+EQ+VERP MREV
Sbjct  902  EGIDIVQWTKLQTDWNKEKVVKILDGRLHHIPLDEAMQLFFVAMLCVQEQSVERPTMREV  961

Query  382  VQMLTELPKQP  350
            V+ML +  KQP
Sbjct  962  VEMLAQ-AKQP  971



>ref|XP_009137141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=967

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            LQD+G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  837  LQDNGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  896

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  897  IDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  956

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  957  MISQ-AKQP  964



>ref|XP_010924539.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=986

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/124 (70%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM A+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  853  LRDTGVSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  912

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+E +VERP MREVVQ
Sbjct  913  LDIVQWARMNTNWSKEGVVKILDPRLIDVPLEEAMQVFFVGMLCVQEHSVERPTMREVVQ  972

Query  376  MLTE  365
            ML +
Sbjct  973  MLEQ  976



>emb|CDY31445.1| BnaC03g63790D [Brassica napus]
Length=844

 Score =   191 bits (485),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  714  MQDDGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  773

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  K+GVVKI+D RLS  P+ EAM +F++A+LCV+E +VERP MREVVQ
Sbjct  774  IDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFLAMLCVQEHSVERPTMREVVQ  833

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  834  MISQ-AKQP  841



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   192 bits (488),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD G SECM ++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  865  MQDDGASECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  924

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  K+GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  925  IDIVQWSKIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  984

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  985  MISQ-AKQP  992



>ref|XP_006413888.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
 gb|ESQ55341.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
Length=996

 Score =   192 bits (488),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G
Sbjct  866  MQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEG  925

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  926  IDIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQ  985

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  986  MISQ-AKQP  993



>ref|XP_002869943.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46202.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   192 bits (488),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G
Sbjct  862  MQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEG  921

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  922  IDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLEEAMELFFVAMLCVQEHSVERPTMREVVQ  981

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  982  MISQ-AKQP  989



>ref|XP_004229499.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=960

 Score =   192 bits (487),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
             +++GTSECM AIAGSYGYIAPEYAYTLK+DEKSDVYSFGVVLLEL++G++PVG FG +G
Sbjct  827  FRNNGTSECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSFGVVLLELITGRRPVGNFGEEG  886

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T   KEGVVKILD RL    I EAM +F+VA+LCVEE ++ERP MREVVQ
Sbjct  887  MDIVQWAKTETKWSKEGVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSIERPTMREVVQ  946

Query  376  MLTELPKQP  350
            ML++  KQP
Sbjct  947  MLSQ-AKQP  954



>ref|XP_002532709.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF29676.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=991

 Score =   192 bits (488),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEF-GDG  557
            LQD+GTSECM AIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG F  +G
Sbjct  858  LQDTGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGAFEEEG  917

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KE V+KILD RLS  P++EA  +F+VA+LCV+E +VERP MREVVQ
Sbjct  918  LDIVQWTKIQTNSSKEKVIKILDQRLSDIPLNEATQVFFVAMLCVQEHSVERPTMREVVQ  977

Query  376  MLTE  365
            ML +
Sbjct  978  MLAQ  981



>ref|XP_010529317.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Tarenaya hassleriana]
Length=999

 Score =   192 bits (488),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +Q++G SECM AIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPV  FG +G
Sbjct  866  MQENGASECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVDNFGEEG  925

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  K+GVVKILD RLS  P+ EA  +F+VA+LCV+EQ+VERP MREVVQ
Sbjct  926  LDIVQWAKIQTNCDKQGVVKILDQRLSNPPLEEATQVFFVAMLCVQEQSVERPTMREVVQ  985

Query  376  MLTELPKQP  350
            M+++  +QP
Sbjct  986  MISQ-ARQP  993



>gb|ACN59341.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=963

 Score =   191 bits (486),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G
Sbjct  833  MQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEG  892

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  893  IDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQ  952

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  953  MISQ-AKQP  960



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   192 bits (487),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            L+D+G SECM AIAGSYGYIAPEYAYTLKVDEKSDVYS+GVVLLEL++GK+PVG+ G +G
Sbjct  845  LRDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSYGVVLLELITGKRPVGDLGEEG  904

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW R  T+  KEGVV I+D RL   P+ EAM +F+VA+LCV+E +VERPKMREVVQ
Sbjct  905  LDIVQWARMNTNWHKEGVVNIMDRRLIDVPMEEAMQVFFVAMLCVQEHSVERPKMREVVQ  964

Query  376  MLTE  365
            ML +
Sbjct  965  MLEQ  968



>ref|NP_193760.1| leucine-rich receptor-like protein kinase BAM3 [Arabidopsis thaliana]
 sp|O65440.3|BAME3_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3; AltName: Full=Protein BARELY ANY MERISTEM 
3; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA18252.1| CLV1 receptor kinase like protein [Arabidopsis thaliana]
 emb|CAB79027.1| CLV1 receptor kinase like protein [Arabidopsis thaliana]
 gb|AEE84297.1| leucine-rich receptor-like protein kinase BAM3 [Arabidopsis thaliana]
Length=992

 Score =   191 bits (486),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G
Sbjct  862  MQDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEG  921

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQ
Sbjct  922  IDIVQWSKIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQ  981

Query  376  MLTELPKQP  350
            M+++  KQP
Sbjct  982  MISQ-AKQP  989



>ref|NP_001170600.1| uncharacterized protein LOC100384637 [Zea mays]
 gb|ACR34174.1| unknown [Zea mays]
Length=206

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGV  554
            L+   TSE M A+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GV
Sbjct  31   LRCGATSESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGV  90

Query  553  DIVQWVRKMTDGKKEGVVKILDSRL-STAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            DIVQW ++ T G++E V  I+D RL   AP  E  H+F+V++LCV++ +VERP MREVVQ
Sbjct  91   DIVQWAKRATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQ  150

Query  376  MLTELPKQ  353
            ML ELP+ 
Sbjct  151  MLAELPRH  158



>ref|XP_010439602.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=997

 Score =   191 bits (485),  Expect = 9e-52, Method: Composition-based stats.
 Identities = 86/128 (67%), Positives = 109/128 (85%), Gaps = 2/128 (2%)
 Frame = -2

Query  730  QDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGV  554
            QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+
Sbjct  868  QDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGI  927

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQM
Sbjct  928  DIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQM  987

Query  373  LTELPKQP  350
            +++  KQP
Sbjct  988  ISQ-AKQP  994



>ref|XP_010449207.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=998

 Score =   191 bits (485),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 86/128 (67%), Positives = 109/128 (85%), Gaps = 2/128 (2%)
 Frame = -2

Query  730  QDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGV  554
            QD+G SECM +IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+
Sbjct  869  QDNGASECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGI  928

Query  553  DIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQM  374
            DIVQW +  T+  ++GVVKI+D RLS  P+ EAM +F+VA+LCV+E +VERP MREVVQM
Sbjct  929  DIVQWSKIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQM  988

Query  373  LTELPKQP  350
            +++  KQP
Sbjct  989  ISQ-AKQP  995



>gb|KHN28525.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Glycine soja]
Length=853

 Score =   190 bits (482),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -2

Query  733  LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
            +QD+G SECM +IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G
Sbjct  723  MQDNGGSECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEG  782

Query  556  VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
            +DIVQW +  T+  KE V+KILD RL   P+ EAM +F+VA+LCV E +VERP MREVV+
Sbjct  783  LDIVQWTKMQTNWNKEMVMKILDERLDDIPLAEAMQVFFVAMLCVHEHSVERPTMREVVE  842

Query  376  MLTELPKQP  350
            ML +  KQP
Sbjct  843  MLAQ-AKQP  850



>ref|XP_007146301.1| hypothetical protein PHAVU_006G029000g [Phaseolus vulgaris]
 gb|ESW18295.1| hypothetical protein PHAVU_006G029000g [Phaseolus vulgaris]
Length=1017

 Score =   191 bits (485),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -2

Query  733   LQDSGTSECMXAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DG  557
             +QD+G SECM +IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG DG
Sbjct  884   MQDNGASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGNFGEDG  943

Query  556   VDIVQWVRKMTDGKKEGVVKILDSRLSTAPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  377
             +DIVQW++  T+G KE V+KILD RL   P+ EA  +F+VA LCV E +VERP MREVV+
Sbjct  944   LDIVQWIKMQTNGNKEMVMKILDERLHQIPLAEAKQVFFVAKLCVHEHSVERPTMREVVE  1003

Query  376   MLTELPKQP  350
             ML +  KQP
Sbjct  1004  MLAQ-AKQP  1011



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485