BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002I20

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAL42332.1|  Heat shock protein 90                                  273   6e-82   Nicotiana tabacum [American tobacco]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     273   6e-82   Nicotiana sylvestris
gb|AAF64453.1|AF239931_1  putative heat-shock protein 90                259   6e-82   Euphorbia esula [wolf's milk]
gb|KJB63505.1|  hypothetical protein B456_010G0030001                   265   7e-82   Gossypium raimondii
gb|KHG15193.1|  Endoplasmin                                             270   2e-81   Gossypium arboreum [tree cotton]
gb|KJB63503.1|  hypothetical protein B456_010G0030001                   265   3e-81   Gossypium raimondii
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    268   5e-81   
gb|AAB63606.1|  HSP90 isolog                                            258   7e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAL42333.1|  Heat shock protein 90                                  269   1e-80   Nicotiana tabacum [American tobacco]
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     269   1e-80   Nicotiana tomentosiformis
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             268   5e-80   Prunus persica
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     268   5e-80   Nicotiana sylvestris
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     268   5e-80   Prunus mume [ume]
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    267   8e-80   
ref|XP_010109992.1|  Endoplasmin-like protein                           269   9e-80   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    267   9e-80   
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     267   1e-79   Fragaria vesca subsp. vesca
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   266   1e-79   Gossypium raimondii
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     266   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_002510550.1|  endoplasmin, putative                              265   4e-79   Ricinus communis
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   265   4e-79   Gossypium raimondii
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    265   4e-79   
gb|KDO84885.1|  hypothetical protein CISIN_1g003458mg                   262   5e-79   Citrus sinensis [apfelsine]
gb|ABK92622.1|  unknown                                                 249   5e-79   Populus trichocarpa [western balsam poplar]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     264   1e-78   
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             263   4e-78   Citrus clementina [clementine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   262   5e-78   Citrus sinensis [apfelsine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     262   5e-78   Citrus sinensis [apfelsine]
emb|CDP07384.1|  unnamed protein product                                262   8e-78   Coffea canephora [robusta coffee]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         261   2e-77   Jatropha curcas
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     260   4e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     259   8e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     259   9e-77   Camelina sativa [gold-of-pleasure]
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                259   2e-76   Erythranthe guttata [common monkey flower]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     258   2e-76   Nelumbo nucifera [Indian lotus]
ref|NP_974606.1|  HSP90-like protein GRP94                              258   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194150.1|  HSP90-like protein GRP94                              258   3e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB86368.1|  SHEPHERD                                               258   3e-76   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                258   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     258   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             257   4e-76   Capsella rubella
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     257   6e-76   Vitis vinifera
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    256   1e-75   Catharanthus roseus [chatas]
emb|CDX92620.1|  BnaC07g38780D                                          255   1e-75   
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     256   2e-75   Eucalyptus grandis [rose gum]
emb|CDY34264.1|  BnaA01g13670D                                          256   2e-75   Brassica napus [oilseed rape]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     256   2e-75   Brassica rapa
emb|CDY03477.1|  BnaC01g16050D                                          256   2e-75   
gb|KJB14397.1|  hypothetical protein B456_002G122800                    255   2e-75   Gossypium raimondii
ref|XP_003589505.1|  Endoplasmin-like protein                           255   2e-75   Medicago truncatula
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          254   4e-75   Glycine max [soybeans]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          254   4e-75   Glycine max [soybeans]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     257   4e-75   Vitis vinifera
gb|KHG17445.1|  Endoplasmin                                             254   6e-75   Gossypium arboreum [tree cotton]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          254   7e-75   
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          254   7e-75   Glycine max [soybeans]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     253   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             253   1e-74   Phaseolus vulgaris [French bean]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             253   1e-74   Arabidopsis lyrata subsp. lyrata
emb|CDY10992.1|  BnaA03g46510D                                          254   1e-74   Brassica napus [oilseed rape]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     252   2e-74   Solanum tuberosum [potatoes]
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     251   7e-74   Cucumis sativus [cucumbers]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          251   9e-74   Cicer arietinum [garbanzo]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     251   1e-73   Solanum lycopersicum
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          251   1e-73   Cicer arietinum [garbanzo]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     250   1e-73   Cucumis melo [Oriental melon]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             250   2e-73   Eutrema salsugineum [saltwater cress]
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     249   3e-73   Sesamum indicum [beniseed]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     249   4e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     249   4e-73   Populus euphratica
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             249   5e-73   Populus trichocarpa [western balsam poplar]
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    248   1e-72   Arabis alpina [alpine rockcress]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     247   2e-72   Phoenix dactylifera
emb|CDY24830.1|  BnaA08g14800D                                          247   2e-72   Brassica napus [oilseed rape]
gb|EPS69355.1|  hypothetical protein M569_05408                         247   2e-72   Genlisea aurea
gb|AIZ68158.1|  heat shock protein 90                                   245   9e-72   Ornithogalum longebracteatum [sea-onion]
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     245   2e-71   Elaeis guineensis
gb|AFW75769.1|  hypothetical protein ZEAMMB73_790349                    236   2e-71   
emb|CDY08910.1|  BnaC08g11400D                                          244   3e-71   Brassica napus [oilseed rape]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          243   9e-71   Amborella trichopoda
gb|AAN34791.1|  Grp94                                                   243   9e-71   Xerophyta viscosa
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     242   1e-70   Phoenix dactylifera
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     242   2e-70   Elaeis guineensis
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     241   2e-70   Oryza brachyantha
ref|NP_001058590.1|  Os06g0716700                                       240   9e-70   
gb|AAL79732.1|AC091774_23  heat shock protein 90                        240   9e-70   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          239   1e-69   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          239   1e-69   Oryza sativa Japonica Group [Japonica rice]
gb|AFW75768.1|  hypothetical protein ZEAMMB73_790349                    235   6e-69   
dbj|BAA90487.1|  heat shock protein 90                                  238   7e-69   Oryza sativa [red rice]
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     237   1e-68   Setaria italica
dbj|BAJ89816.1|  predicted protein                                      231   2e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24228.1|  unknown                                                 229   3e-68   Picea sitchensis
gb|AFW75767.1|  endoplasmin                                             236   3e-68   
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     235   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151475.1|  endoplasmin precursor                              234   1e-67   Zea mays [maize]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     234   1e-67   
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          233   2e-67   
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     233   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     233   4e-67   Brachypodium distachyon [annual false brome]
gb|ABV82432.1|  Hsp90-like protein                                      232   6e-67   Dactylis glomerata [cocksfoot]
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    232   8e-67   Hordeum vulgare [barley]
ref|NP_001146348.1|  shepherd-like1                                     230   1e-66   
gb|EMS56078.1|  Endoplasmin-like protein                                231   2e-66   Triticum urartu
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               230   4e-66   
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    230   8e-66   
gb|EMT19498.1|  Endoplasmin-like protein                                231   2e-65   
gb|ABV21762.1|  GRP94                                                   226   1e-64   Pinus taeda
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             214   2e-60   Selaginella moellendorffii
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             214   2e-60   Selaginella moellendorffii
ref|XP_001770511.1|  predicted protein                                  211   2e-59   
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   192   1e-52   Citrus sinensis [apfelsine]
ref|XP_003063917.1|  predicted protein                                  188   3e-51   Micromonas pusilla CCMP1545
gb|KJB14398.1|  hypothetical protein B456_002G122800                    180   1e-48   Gossypium raimondii
ref|XP_002508627.1|  predicted protein                                  180   2e-48   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       171   4e-45   Ostreococcus lucimarinus CCE9901
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       165   5e-43   Ostreococcus tauri
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        165   6e-43   
ref|XP_005842771.1|  hypothetical protein CHLNCDRAFT_59468              159   7e-43   Chlorella variabilis
gb|AFK40768.1|  unknown                                                 149   5e-42   Lotus japonicus
ref|XP_007512535.1|  predicted protein                                  164   6e-42   Bathycoccus prasinos
gb|ACN26939.1|  unknown                                                 148   4e-41   Zea mays [maize]
ref|XP_005651682.1|  heat shock protein Hsp90                           150   1e-37   Coccomyxa subellipsoidea C-169
ref|XP_001753222.1|  predicted protein                                  149   2e-37   
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900              147   3e-37   Batrachochytrium dendrobatidis JAM81
ref|XP_007515443.1|  predicted protein                                  147   1e-36   Bathycoccus prasinos
ref|XP_006220022.1|  PREDICTED: heat shock protein 90-like              139   1e-36   Vicugna pacos
ref|XP_308799.3|  AGAP006959-PA                                         144   1e-36   Anopheles gambiae str. PEST
gb|KHJ75602.1|  Hsp90 protein                                           139   2e-36   Oesophagostomum dentatum [nodule worm]
gb|AEG19531.1|  heat shock protein 90                                   146   2e-36   Glaciozyma antarctica
gb|KDE07091.1|  heat shock protein 90-1                                 145   3e-36   Microbotryum lychnidis-dioicae p1A1 Lamole
emb|CAG01829.1|  unnamed protein product                                137   7e-36   Tetraodon nigroviridis
ref|XP_005538149.1|  heat shock protein of Hsp90 family                 144   1e-35   Cyanidioschyzon merolae strain 10D
ref|XP_001740319.1|  heat shock protein                                 137   1e-35   Entamoeba dispar SAW760
gb|ACU45247.1|  HSP90                                                   140   3e-35   Karlodinium veneficum
ref|XP_010902983.1|  PREDICTED: heat shock protein HSP 90-alpha 1       143   3e-35   
gb|ABF61871.1|  chaperone                                               135   3e-35   Agave tequilana
ref|XP_308800.3|  AGAP006958-PA                                         142   4e-35   Anopheles gambiae str. PEST
ref|XP_007385736.1|  HSP90-domain-containing protein                    142   5e-35   Punctularia strigosozonata HHB-11173 SS5
ref|XP_001701885.1|  heat shock protein 90B                             142   5e-35   Chlamydomonas reinhardtii
gb|AGW82181.1|  heat shcok protein 90                                   134   6e-35   Corbicula fluminea [asian clam]
gb|ACO58580.1|  heat shock protein 90                                   139   6e-35   Apis mellifera [bee]
gb|EJT49886.1|  chaperone                                               142   6e-35   Trichosporon asahii var. asahii CBS 2479
gb|EPT06188.1|  hypothetical protein FOMPIDRAFT_1109676                 142   6e-35   Fomitopsis pinicola FP-58527 SS1
gb|AAB05638.1|  heat shock protein 82                                   142   7e-35   Anopheles albimanus
gb|ETN67039.1|  heat shock protein                                      142   9e-35   Anopheles darlingi [American malaria mosquito]
gb|EWM29604.1|  heat shock protein 90                                   141   9e-35   Nannochloropsis gaditana
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      140   9e-35   Anopheles sinensis
ref|XP_005855339.1|  molecular chaperone HtpG                           141   1e-34   Nannochloropsis gaditana CCMP526
ref|XP_002021279.1|  GL24896                                            138   1e-34   
ref|NP_999808.1|  heat shock protein gp96 precursor                     142   1e-34   Strongylocentrotus purpuratus [purple urchin]
gb|KDQ60746.1|  hypothetical protein JAAARDRAFT_172907                  141   1e-34   Jaapia argillacea MUCL 33604
emb|CDO69548.1|  hypothetical protein BN946_scf184785.g53               141   1e-34   Trametes cinnabarina
gb|KIL68560.1|  hypothetical protein M378DRAFT_184990                   141   1e-34   Amanita muscaria Koide BX008
ref|XP_011398501.1|  Heat shock protein 90-2                            139   2e-34   Auxenochlorella protothecoides
ref|XP_005843734.1|  hypothetical protein CHLNCDRAFT_140066             139   2e-34   Chlorella variabilis
ref|XP_007863437.1|  HSP90-domain-containing protein                    140   2e-34   Gloeophyllum trabeum ATCC 11539
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                         134   2e-34   Platichthys flesus
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              141   2e-34   Volvox carteri f. nagariensis
dbj|BAF92789.1|  cytosolic heat shock protein 90 alpha                  140   2e-34   Solea senegalensis
ref|XP_001649751.1|  AAEL014845-PA                                      139   2e-34   
emb|CAK22426.1|  heat shock protein 83                                  137   2e-34   Beta vulgaris [beet]
ref|XP_010736427.1|  PREDICTED: heat shock protein HSP 90-alpha i...    140   2e-34   Larimichthys crocea [croceine croaker]
gb|ACF95812.1|  heat shock protein 90                                   140   2e-34   Amphidinium carterae
gb|EXX78198.1|  Hsp90 family chaperone HSC82                            137   2e-34   Rhizophagus irregularis DAOM 197198w
ref|XP_007361188.1|  HSP90-domain-containing protein                    140   2e-34   Dichomitus squalens LYAD-421 SS1
gb|ADO30471.1|  heat shock protein 90                                   139   2e-34   Bactrocera dorsalis [papaya fruit fly]
gb|KIP09595.1|  hypothetical protein PHLGIDRAFT_126182                  140   2e-34   Phlebiopsis gigantea 11061_1 CR5-6
gb|ADV03069.1|  heat shock protein 90                                   140   2e-34   Amphidinium carterae
ref|XP_008551765.1|  PREDICTED: heat shock protein 83                   140   3e-34   Microplitis demolitor
gb|KFB48798.1|  heat shock protein 82                                   140   3e-34   Anopheles sinensis
ref|XP_308797.3|  AGAP006961-PA                                         137   3e-34   Anopheles gambiae str. PEST
sp|O61998.2|HSP90_BRUPA  RecName: Full=Heat shock protein 90            140   3e-34   Brugia pahangi
emb|CAY56585.1|  putative heat shock protein 83                         140   3e-34   Bactrocera oleae [olive fly]
gb|EJW88125.1|  heat shock protein 90                                   140   3e-34   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_006793113.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    140   3e-34   Neolamprologus brichardi [lyretail cichlid]
emb|CDP96098.1|  Protein BM-DAF-21, isoform a                           140   3e-34   
emb|CAA06694.1|  heat shock protein 90                                  140   3e-34   Brugia pahangi
gb|ACO55133.1|  heat shock protein 90                                   140   3e-34   Litomosoides sigmodontis
ref|XP_001901767.1|  heat shock protein 90                              140   3e-34   Brugia malayi [agent of lymphatic filariasis]
gb|AAW49252.2|  heat shock protein 90                                   140   3e-34   Liriomyza huidobrensis
gb|AAG22091.1|AF306643_1  90 kDa heat-shock protein                     130   4e-34   Scyliorhinus torazame
ref|XP_008297037.1|  PREDICTED: heat shock protein HSP 90-alpha 1       140   4e-34   Stegastes partitus
gb|ABA28987.1|  heat shock protein 90 3                                 137   4e-34   Symbiodinium sp. C3
gb|AGT57167.1|  heat shock protein 90-alpha 3                           140   4e-34   Salmo salar
gb|EMS22510.1|  molecular chaperone HtpG                                140   4e-34   Rhodotorula toruloides NP11
gb|AEH27540.1|  cytosolic heat shock protein 90-alpha                   140   4e-34   Lates calcarifer [Asian seabass]
gb|EMD38391.1|  hypothetical protein CERSUDRAFT_153213                  139   4e-34   Gelatoporia subvermispora B
emb|CAU15484.1|  heat shock protein 90                                  140   4e-34   Meloidogyne artiellia
emb|CDQ81678.1|  unnamed protein product                                140   4e-34   Oncorhynchus mykiss
gb|ACO57617.1|  heat shock protein 90                                   140   4e-34   Pteromalus puparum
ref|XP_005805663.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    139   4e-34   
gb|KIO34802.1|  hypothetical protein M407DRAFT_90187                    139   4e-34   Tulasnella calospora MUT 4182
ref|NP_001274755.1|  heat shock protein 83-like                         140   4e-34   Ceratitis capitata [medfly]
ref|XP_009542788.1|  hypothetical protein HETIRDRAFT_311260             139   4e-34   Heterobasidion irregulare TC 32-1
ref|XP_007577310.1|  PREDICTED: heat shock protein HSP 90-alpha 1       139   5e-34   Poecilia formosa
ref|XP_005805662.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    139   5e-34   Xiphophorus maculatus
gb|ABI14419.1|  heat shock protein 90                                   139   5e-34   Karlodinium veneficum
ref|XP_011182023.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    139   5e-34   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008045254.1|  heat shock protein 90                              139   6e-34   Trametes versicolor FP-101664 SS1
ref|XP_011203601.1|  PREDICTED: heat shock protein 83                   139   6e-34   Bactrocera dorsalis [papaya fruit fly]
gb|EAY92778.1|  hypothetical protein OsI_14582                          139   6e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_003424204.1|  PREDICTED: heat shock protein 83                   139   6e-34   Nasonia vitripennis
gb|KIP08934.1|  hypothetical protein PHLGIDRAFT_103566                  139   6e-34   Phlebiopsis gigantea 11061_1 CR5-6
gb|AGU42458.1|  heat shock protein 90                                   139   6e-34   Bactrocera correcta
gb|AAN39696.1|  heat shock protein                                      131   6e-34   Choristoneura parallela
emb|CAE02770.2|  OSJNBb0085F13.17                                       139   6e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011345590.1|  PREDICTED: heat shock protein 83                   139   6e-34   Ooceraea biroi
gb|ACO55134.1|  heat shock protein 90                                   139   6e-34   Ascaris suum
ref|XP_010788727.1|  PREDICTED: heat shock protein HSP 90-alpha 1       139   7e-34   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007300418.1|  HSP90-domain-containing protein                    139   7e-34   Stereum hirsutum FP-91666 SS1
ref|XP_002998541.1|  heat shock protein 90                              139   7e-34   Phytophthora infestans T30-4
gb|ABV55506.1|  heat shock protein 90                                   139   8e-34   Microplitis mediator
gb|AER28025.1|  heat shock protein 83S2                                 139   8e-34   Stratiomys singularior
gb|EPY32689.1|  heat shock protein 83-1                                 134   8e-34   Strigomonas culicis
gb|ETK95017.1|  heat shock protein 90-2                                 139   8e-34   Phytophthora parasitica
ref|XP_008915791.1|  heat shock protein 90-2                            139   8e-34   Phytophthora parasitica INRA-310
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817             139   8e-34   Phytophthora sojae
gb|KIJ44391.1|  hypothetical protein M422DRAFT_228502                   139   8e-34   Sphaerobolus stellatus SS14
ref|NP_001278186.1|  heat shock protein HSP 90-alpha 1-like             139   8e-34   Astyanax mexicanus [blind cave fish]
ref|XP_008311364.1|  PREDICTED: heat shock protein HSP 90-alpha 1       139   9e-34   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CCA68353.1|  related to HSP80 heat shock protein 80                 139   9e-34   Serendipita indica DSM 11827
gb|EYD92886.1|  hsp90 family protein                                    134   9e-34   Escherichia coli 1-176-05_S1_C1
gb|EKF32566.1|  heat shock protein 85, putative                         134   1e-33   Trypanosoma cruzi marinkellei
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like    130   1e-33   
gb|AIA62362.1|  hsp90                                                   136   1e-33   Bactrocera minax
ref|XP_001649752.1|  AAEL014843-PA                                      139   1e-33   Aedes aegypti
gb|ADD10372.1|  heat shock protein 90                                   139   1e-33   Meloidogyne incognita
gb|AEF33377.1|  heat shock protein 90                                   130   1e-33   Crassostrea ariakensis
ref|XP_002165028.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    139   1e-33   Hydra vulgaris
ref|XP_001655641.1|  AAEL011708-PA                                      139   1e-33   
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          138   1e-33   Sorghum bicolor [broomcorn]
gb|AAM02974.1|AF421541_1  Hsp90                                         138   1e-33   Crypthecodinium cohnii
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              138   1e-33   Setaria italica
dbj|BAH71458.1|  ACYPI002010                                            132   1e-33   Acyrthosiphon pisum
gb|AAB49983.1|  heat shock protein hsp90                                138   1e-33   Oncorhynchus tshawytscha [king salmon]
emb|CDQ59969.1|  unnamed protein product                                138   1e-33   Oncorhynchus mykiss
gb|AER28024.1|  heat shock protein 83S1                                 138   1e-33   Stratiomys singularior
gb|AIU38246.1|  heat shock protein 90                                   138   1e-33   Anisakis brevispiculata
ref|XP_003074078.1|  heat shock protein 90C (ISS)                       138   2e-33   
gb|AGT57168.1|  heat shock protein 90-alpha 4                           138   2e-33   Salmo salar
gb|AIU38242.1|  heat shock protein 90                                   138   2e-33   Anisakis pegreffii
gb|EJU00792.1|  heat shock protein 90                                   138   2e-33   Dacryopinax primogenitus
gb|AIU38245.1|  heat shock protein 90                                   138   2e-33   Anisakis physeteris
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              138   2e-33   Bombus terrestris [large earth bumblebee]
gb|AIU38244.1|  heat shock protein 90                                   138   2e-33   Anisakis paggiae
gb|KFD54842.1|  hypothetical protein M513_04276                         138   2e-33   Trichuris suis
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    138   2e-33   Apis dorsata [rock honeybee]
gb|AIU38243.1|  heat shock protein 90                                   138   2e-33   Anisakis typica
gb|ADM83426.1|  heat shock protein 90                                   138   2e-33   Panonychus citri [citrus fruit mite]
gb|EKG06682.1|  heat shock protein 85, putative                         134   2e-33   Trypanosoma cruzi
gb|ETN83529.1|  putative heat shock protein 90                          137   2e-33   Necator americanus
gb|AGI19327.1|  heat shock protein 90                                   138   2e-33   Liriomyza trifolii [American serpentine leafminer]
gb|AAB23704.1|  HSP90                                                   130   2e-33   Mus sp. [mice]
ref|XP_007764667.1|  heat-shock protein 90                              138   2e-33   Coniophora puteana RWD-64-598 SS2
ref|XP_005176932.1|  PREDICTED: heat shock protein 83                   138   2e-33   Musca domestica
gb|AFD34191.2|  HSP90                                                   138   2e-33   Prorocentrum minimum
gb|AAW49253.2|  heat shock protein 90                                   138   2e-33   Liriomyza sativae
emb|CAC29071.1|  heat shock protein 90                                  132   2e-33   Pelophylax esculentus
ref|XP_011154034.1|  PREDICTED: heat shock protein 83                   138   2e-33   Harpegnathos saltator
ref|NP_001153536.1|  heat shock protein 90                              138   2e-33   Apis mellifera [bee]
gb|KIH68348.1|  Hsp90 protein                                           138   2e-33   Ancylostoma duodenale
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                     138   2e-33   Ancylostoma ceylanicum
gb|ESA08764.1|  hypothetical protein GLOINDRAFT_348967                  137   2e-33   
gb|ACU00668.1|  heat shock protein 90                                   137   2e-33   Haemonchus contortus [red stomach worm]
ref|XP_007399693.1|  hypothetical protein PHACADRAFT_127903             137   2e-33   Phanerochaete carnosa HHB-10118-sp
ref|XP_011171324.1|  PREDICTED: heat shock protein 83                   138   2e-33   Solenopsis invicta [imported red fire ant]
gb|KHN76289.1|  Heat shock protein HSP 90-alpha                         137   2e-33   Toxocara canis
emb|CEF96474.1|  Histidine kinase-like ATPase, ATP-binding domain       138   2e-33   Ostreococcus tauri
gb|AFM73650.1|  heat shock protein 90                                   133   2e-33   Bicyclus anynana
sp|Q90474.3|H90A1_DANRE  RecName: Full=Heat shock protein HSP 90-...    138   2e-33   Danio rerio [leopard danio]
gb|AAH75757.1|  Hsp90a.1 protein                                        138   2e-33   Danio rerio [leopard danio]
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              137   2e-33   
ref|XP_002046978.1|  heat shock protein 83                              137   3e-33   Drosophila virilis
ref|XP_011310275.1|  PREDICTED: heat shock protein 83                   137   3e-33   Fopius arisanus
dbj|BAA13431.1|  heat shock protein 90                                  129   3e-33   Homo sapiens [man]
gb|ABK34943.1|  heat shock protein 83                                   137   3e-33   Drosophila buzzatii
ref|XP_002008178.1|  GI13350                                            137   3e-33   Drosophila mojavensis
gb|EPQ17302.1|  Heat shock protein HSP 90-beta                          130   3e-33   Myotis brandtii
gb|AAN76524.1|AF384807_1  heat-shock protein 90                         137   3e-33   
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 137   3e-33   
ref|XP_001984000.1|  GH16203                                            137   3e-33   
ref|XP_003197339.1|  cytoplasmic chaperone (Hsp90 family); Hsp82p       137   3e-33   
gb|KIR84754.1|  hsp90-like protein                                      137   3e-33   
dbj|BAF75058.1|  heat shock protein                                     129   3e-33   
gb|KJE05047.1|  hsp90-like protein                                      137   3e-33   
ref|XP_001353471.1|  Hsp83                                              137   3e-33   
gb|KIR45891.1|  hsp90-like protein                                      137   3e-33   
gb|KGB79019.1|  hsp90-like protein                                      137   3e-33   
ref|XP_011060405.1|  PREDICTED: heat shock protein 83                   137   3e-33   
gb|AER28022.1|  heat shock protein 83P1                                 137   3e-33   
ref|XP_008855466.1|  heat shock protein 90, putative                    137   3e-33   
ref|XP_653132.1|  heat shock protein 90                                 137   4e-33   
gb|ACO55135.1|  heat shock protein 90                                   137   4e-33   
ref|XP_653162.1|  heat shock protein 90                                 137   4e-33   
dbj|BAD83620.1|  cytosolic-type hsp90                                   137   4e-33   
gb|AFR98377.1|  hsp90-like protein                                      137   4e-33   
gb|EPY40503.1|  heat shock protein 83-1                                 132   4e-33   
gb|AAN76525.1|AF384808_1  heat-shock protein 90                         137   4e-33   
emb|CDW54307.1|  heat shock protein 90                                  137   4e-33   
gb|AGU42456.1|  heat shock protein 90                                   134   4e-33   
gb|ACE77780.1|  HSP90                                                   137   4e-33   
gb|AAO14563.2|AF461150_1  Hsp90                                         137   4e-33   
gb|ACU00686.1|  heat shock protein 90                                   133   5e-33   
gb|AFK31312.1|  heat shock protein 90                                   137   5e-33   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         137   5e-33   
gb|KIK94310.1|  hypothetical protein PAXRUDRAFT_143168                  137   5e-33   
gb|AAD52684.1|AF179480_1  90kDa heat-shock protein                      128   5e-33   
ref|XP_001735351.1|  heat shock protein 81-1                            137   5e-33   
gb|KIJ16896.1|  hypothetical protein PAXINDRAFT_162512                  136   5e-33   
dbj|BAE87688.1|  unnamed protein product                                133   6e-33   
ref|XP_002062325.1|  Hsp83                                              137   6e-33   
gb|AAH49951.1|  Hsp90ab1 protein                                        133   6e-33   
ref|XP_003102316.1|  CRE-DAF-21 protein                                 136   6e-33   
ref|NP_523899.1|  heat shock protein 83, isoform A                      136   6e-33   
gb|ERG82208.1|  heat shock protein hsp 90-alpha                         137   6e-33   
ref|XP_002637777.1|  C. briggsae CBR-DAF-21 protein                     136   6e-33   
ref|XP_001956817.1|  GF20110                                            136   6e-33   
dbj|BAB15121.1|  unnamed protein product                                133   6e-33   
dbj|BAF83423.1|  unnamed protein product                                133   6e-33   
gb|EGT39214.1|  CBN-DAF-21 protein                                      136   6e-33   
ref|XP_002093517.1|  GE21339                                            136   6e-33   
emb|CBJ23502.1|  heat shock protein 90                                  130   6e-33   
ref|XP_001971711.1|  GG15112                                            136   7e-33   
gb|ACM50884.1|  heat shock protein 90A                                  136   7e-33   
emb|CCM02389.1|  predicted protein                                      136   7e-33   
gb|ADZ13510.1|  HSP90-1                                                 136   7e-33   
ref|XP_002035159.1|  Hsp83                                              136   7e-33   
ref|XP_003704636.1|  PREDICTED: heat shock protein 83-like              136   7e-33   
gb|AAH44888.1|  Hsp90ab1 protein                                        133   7e-33   
ref|XP_011250812.1|  PREDICTED: heat shock protein 83                   136   7e-33   
gb|KDQ33187.1|  hypothetical protein PLEOSDRAFT_1052040                 136   8e-33   
gb|KFG42944.1|  heat shock protein HSP90                                131   8e-33   
gb|AAY67995.1|  HSP 90                                                  134   8e-33   
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   136   8e-33   
gb|KIM27867.1|  hypothetical protein M408DRAFT_70506                    136   9e-33   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              136   9e-33   
gb|ACF06184.1|  heat shock protein 90                                   134   9e-33   
emb|CCO26395.1|  Heat shock protein 81-2 Short=HSP81-2                  130   9e-33   
gb|EMS66149.1|  Heat shock protein 83                                   135   9e-33   
emb|CAI64494.1|  Hsp90 protein                                          136   1e-32   
ref|NP_571403.1|  heat shock protein HSP 90-alpha 1                     136   1e-32   
dbj|BAE48212.1|  heat shock protein 90 beta                             132   1e-32   
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            135   1e-32   
ref|XP_003135662.1|  heat shock protein 90                              135   1e-32   
ref|XP_008549803.1|  PREDICTED: heat shock protein 83-like              136   1e-32   
gb|AAM93928.1|  heat-shock protein 90                                   129   1e-32   
ref|XP_003971591.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   1e-32   
sp|O02192.1|HSP83_DROAV  RecName: Full=Heat shock protein 83; Alt...    135   1e-32   
ref|XP_006632301.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   1e-32   
ref|XP_952473.1|  heat shock protein 90                                 135   1e-32   
gb|EMT27103.1|  Heat shock protein 83                                   135   1e-32   
gb|ABH04243.1|  heat shock protein 90 kDa                               135   1e-32   
ref|XP_004542148.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   1e-32   
gb|ADF31778.1|  heat shock protein 90                                   135   1e-32   
ref|XP_006632300.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   2e-32   
gb|ABO93609.1|  heat shock protein 90                                   132   2e-32   
gb|AAA30132.1|  heat shock protein 90                                   135   2e-32   
ref|XP_006632299.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    135   2e-32   
ref|XP_001865484.1|  heat shock protein 83                              135   2e-32   
gb|AIU47031.1|  heat shock protein                                      135   2e-32   
gb|ADF31756.1|  heat shock protein 90                                   135   2e-32   
ref|XP_764810.1|  heat shock protein 90                                 135   2e-32   
gb|ESL09761.1|  heat shock protein 85                                   132   2e-32   
gb|ADF31754.1|  heat shock protein 90                                   135   2e-32   
gb|ADF31772.1|  heat shock protein 90                                   135   2e-32   
ref|XP_001415715.1|  Heat Shock Protein 90                              135   2e-32   
gb|ADF31775.1|  heat shock protein 90                                   135   2e-32   
ref|XP_001861926.1|  heat shock protein 83                              135   2e-32   
ref|XP_001861928.1|  heat shock protein 83                              135   2e-32   
emb|CBY17856.1|  unnamed protein product                                129   2e-32   
gb|ACD63052.1|  heat shock protein 90                                   135   2e-32   
ref|XP_003881046.1|  hsp90, related                                     135   2e-32   
gb|EGW01344.1|  Heat shock protein HSP 90-beta                          132   2e-32   
ref|XP_007338676.1|  heat shock protein 90                              135   2e-32   
ref|XP_007071733.1|  PREDICTED: heat shock protein HSP 90-beta is...    135   2e-32   
gb|ACR57215.1|  Hsp90                                                   135   2e-32   
ref|XP_001713499.1|  heat shock protein 82                              135   2e-32   
dbj|BAE87589.1|  unnamed protein product                                135   2e-32   
gb|ACZ13352.1|  HSP90 protein                                           133   2e-32   
ref|XP_011495774.1|  PREDICTED: heat shock protein 83                   135   2e-32   
gb|ADF31779.1|  heat shock protein 90                                   135   2e-32   
gb|ADF31755.1|  heat shock protein 90                                   135   2e-32   
ref|XP_005296381.1|  PREDICTED: heat shock protein HSP 90-beta          135   2e-32   
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         137   2e-32   
gb|EKG00457.1|  heat shock protein 85, putative                         133   2e-32   
gb|AFA25805.1|  heat shock protein 90 alpha                             132   2e-32   
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              135   2e-32   
ref|XP_007071731.1|  PREDICTED: heat shock protein HSP 90-beta is...    135   2e-32   
ref|XP_007071732.1|  PREDICTED: heat shock protein HSP 90-beta is...    135   2e-32   
ref|XP_006126585.1|  PREDICTED: heat shock protein HSP 90-beta          134   2e-32   
ref|XP_002063871.1|  GK15907                                            135   2e-32   
ref|XP_001445076.1|  hypothetical protein                               130   3e-32   
ref|XP_006149126.1|  PREDICTED: heat shock protein HSP 90-beta          135   3e-32   
ref|NP_506626.1|  Protein DAF-21                                        134   3e-32   
ref|XP_007263998.1|  HSP90-domain-containing protein                    134   3e-32   
gb|AAO46141.1|  heat shock protein 90                                   128   3e-32   
emb|CAA34748.1|  heat shock-like protein                                129   3e-32   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              134   3e-32   
ref|XP_007321864.1|  hypothetical protein SERLADRAFT_397816             134   3e-32   
ref|XP_814893.1|  heat shock protein 85                                 133   3e-32   
gb|AFZ62631.1|  HSP90-1                                                 134   3e-32   
ref|XP_006625988.1|  PREDICTED: heat shock protein HSP 90-beta-li...    134   3e-32   
dbj|BAJ85535.1|  predicted protein                                      134   3e-32   
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839             134   3e-32   
emb|CAG01828.1|  unnamed protein product                                132   3e-32   
ref|NP_001126444.1|  heat shock protein HSP 90-beta                     134   4e-32   
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              134   4e-32   
ref|NP_001274199.1|  heat shock protein 90kDa alpha (cytosolic), ...    134   4e-32   
gb|ACR57216.1|  Hsp90                                                   134   4e-32   
ref|XP_006625987.1|  PREDICTED: heat shock protein HSP 90-beta-li...    134   4e-32   
emb|CDS03201.1|  Putative Heat shock protein 90-1                       134   4e-32   
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              134   4e-32   
ref|XP_006018632.1|  PREDICTED: heat shock protein HSP 90-beta          134   4e-32   
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   134   4e-32   
ref|XP_004035743.1|  hypothetical protein IMG5_091060                   134   4e-32   
gb|KHJ75025.1|  Hsp90 protein                                           129   4e-32   
gb|AHE77376.1|  heat shock protein 90                                   134   4e-32   
ref|XP_003215948.2|  PREDICTED: heat shock protein HSP 90-beta          134   5e-32   
gb|ABG77328.1|  Hsp90                                                   133   5e-32   
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              134   5e-32   
gb|KHN09298.1|  Heat shock protein 83                                   134   5e-32   
gb|EMD43140.1|  Heat shock family 85 kDa protein                        133   5e-32   
emb|CAR63686.1|  putative abnormal DAuer Formation family member        132   5e-32   
ref|XP_004083818.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    134   5e-32   
gb|ELW65618.1|  Heat shock protein HSP 90-beta                          134   6e-32   
gb|AHW57925.1|  heat shock protein 90                                   134   6e-32   
gb|ABP93404.1|  heat shock protein 90                                   134   6e-32   
gb|AIC33004.1|  heat-shock protein 90                                   134   6e-32   
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like              134   6e-32   
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              134   6e-32   
ref|XP_005900148.1|  PREDICTED: heat shock protein HSP 90-beta is...    133   6e-32   
ref|XP_006458532.1|  hypothetical protein AGABI2DRAFT_190809            134   6e-32   
ref|XP_009791186.1|  PREDICTED: heat shock protein 83-like              133   6e-32   
ref|XP_005900147.1|  PREDICTED: heat shock protein HSP 90-beta is...    134   6e-32   
gb|EPY33491.1|  molecular chaperone HtpG                                130   7e-32   
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              133   7e-32   
ref|XP_003440693.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    134   7e-32   
ref|XP_811791.1|  heat shock protein 85                                 133   7e-32   
gb|EKF32565.1|  heat shock protein 85, putative                         133   7e-32   
gb|ERE80665.1|  heat shock protein HSP 90-alpha                         128   7e-32   
ref|XP_804480.1|  heat shock protein 85                                 133   7e-32   
ref|XP_005900146.1|  PREDICTED: heat shock protein HSP 90-beta is...    134   7e-32   
gb|ACY01918.1|  heat shock protein 90                                   133   7e-32   
sp|P06660.1|HSP85_TRYCR  RecName: Full=Heat shock-like 85 kDa pro...    133   7e-32   
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            133   7e-32   
dbj|BAK08743.1|  heat shock protein 90                                  133   8e-32   
dbj|BAJ34368.1|  unnamed protein product                                133   8e-32   
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084             134   8e-32   
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             133   8e-32   
gb|AAD30456.1|AF123259_1  heat shock protein 90                         130   8e-32   
gb|EDM18740.1|  rCG43497, isoform CRA_a                                 132   8e-32   
ref|XP_005072380.1|  PREDICTED: heat shock protein HSP 90-beta is...    132   8e-32   
gb|KIM62086.1|  hypothetical protein SCLCIDRAFT_120509                  133   9e-32   
ref|XP_005805661.1|  PREDICTED: heat shock protein HSP 90-alpha-like    133   9e-32   
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              133   9e-32   
gb|AAF82792.1|AF275719_1  chaperone protein HSP90 beta                  132   9e-32   
gb|EGW07657.1|  Heat shock protein HSP 90-alpha                         127   9e-32   
dbj|BAF01967.1|  HEAT SHOCK PROTEIN 81-2                                127   9e-32   
gb|AEY83982.1|  heat shock protein 80 KDa                               127   9e-32   
ref|XP_004083819.1|  PREDICTED: heat shock protein HSP 90-alpha         133   9e-32   
gb|KFM78806.1|  Heat shock protein 83                                   133   9e-32   
gb|ABW87791.1|  heat shock protein 90                                   133   9e-32   
ref|XP_008396615.1|  PREDICTED: heat shock protein HSP 90-alpha         133   1e-31   
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   133   1e-31   
gb|AEM76721.1|  heat shock protein 90                                   133   1e-31   
ref|XP_007577309.1|  PREDICTED: heat shock protein HSP 90-alpha         133   1e-31   
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   130   1e-31   
gb|AFO84300.1|  heat shock protein 90                                   133   1e-31   
ref|XP_007485246.1|  PREDICTED: heat shock protein HSP 90-beta          132   1e-31   
gb|EJK51577.1|  hypothetical protein THAOC_29237                        133   1e-31   
gb|AEM65180.1|  heat shock protein 90 alpha                             133   1e-31   
ref|XP_002509852.1|  heat shock protein, putative                       133   1e-31   
gb|EPY76710.1|  heat shock cognate protein HSP 90-beta-like isofo...    132   1e-31   
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              133   1e-31   
ref|XP_001833710.1|  heat shock protein 90                              133   1e-31   
gb|AAH09206.2|  HSP90AB1 protein                                        132   1e-31   
gb|ESS64949.1|  heat shock protein 85                                   133   1e-31   
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              132   1e-31   
dbj|BAG59814.1|  unnamed protein product                                132   1e-31   
ref|XP_007230794.1|  PREDICTED: heat shock protein HSP 90-alpha         133   1e-31   
emb|CDH51743.1|  heat shock protein 90                                  132   1e-31   
gb|ADM26741.1|  heat shock protein 90                                   133   1e-31   
ref|XP_004590467.1|  PREDICTED: heat shock protein HSP 90-beta is...    132   1e-31   
ref|XP_004408189.1|  PREDICTED: heat shock cognate protein HSP 90...    132   1e-31   
ref|XP_008151457.1|  PREDICTED: heat shock protein HSP 90-beta is...    132   1e-31   
gb|KIM89970.1|  hypothetical protein PILCRDRAFT_812762                  132   1e-31   
gb|AIL52741.1|  heat shock protein 90                                   132   1e-31   
ref|XP_009313908.1|  cytosolic HSP90-like protein                       132   1e-31   
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    132   1e-31   
ref|XP_003769134.1|  PREDICTED: heat shock cognate protein HSP 90...    132   1e-31   
ref|XP_011490267.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    132   1e-31   
ref|XP_004379569.1|  PREDICTED: heat shock cognate protein HSP 90...    132   1e-31   
emb|CAN70887.1|  hypothetical protein VITISV_005592                     132   1e-31   
ref|XP_005552917.1|  PREDICTED: uncharacterized LOC101926380 isof...    132   1e-31   
ref|XP_001518700.3|  PREDICTED: heat shock protein HSP 90-beta          132   1e-31   
ref|XP_004408188.1|  PREDICTED: heat shock cognate protein HSP 90...    132   1e-31   
ref|XP_004649510.1|  PREDICTED: heat shock protein HSP 90-beta is...    132   2e-31   
ref|NP_001258900.1|  heat shock protein HSP 90-beta isoform b           132   2e-31   
emb|CBK24402.2|  unnamed protein product                                133   2e-31   



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   273 bits (697),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL+Y+TAL+ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLN+SP
Sbjct  756  NDPKDFASRIYSSVKSSLNVSP  777



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   273 bits (697),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL+Y+TAL+ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLN+SP
Sbjct  756  NDPKDFASRIYSSVKSSLNVSP  777



>gb|AAF64453.1|AF239931_1 putative heat-shock protein 90 [Euphorbia esula]
Length=317

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKG+LAS+NVD+VKISNRL +TPCVVVTSKYGWS+NMERIMQ+QT
Sbjct  136  KDKELKESFKELTKWWKGSLASENVDDVKISNRLDNTPCVVVTSKYGWSSNMERIMQAQT  195

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA KQAYM+GKRVLEINPRHPIIKELRERVVKDPEDE+ K+TA LIY+TALMESGF +
Sbjct  196  LSDAKKQAYMKGKRVLEINPRHPIIKELRERVVKDPEDENVKQTAHLIYQTALMESGFML  255

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLNISP
Sbjct  256  SDPKDFASRIYSSVKSSLNISP  277



>gb|KJB63505.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=500

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  331  KNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  390

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQLIY+TALMESGFN+
Sbjct  391  LSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNL  450

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            P+PKDFASRIY+SVKSSLNISP
Sbjct  451  PEPKDFASRIYSSVKSSLNISP  472



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  549  KNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  608

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKR+LEINPRHPIIKELRERVVKD EDE  K+TAQLIY+TALMESGFN+
Sbjct  609  LSDSSKQAYMRGKRILEINPRHPIIKELRERVVKDSEDEGVKQTAQLIYQTALMESGFNL  668

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNISP
Sbjct  669  PDPKDFASRIYSSVKSSLNISP  690



>gb|KJB63503.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
 gb|KJB63504.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=540

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  371  KNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  430

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQLIY+TALMESGFN+
Sbjct  431  LSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNL  490

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            P+PKDFASRIY+SVKSSLNISP
Sbjct  491  PEPKDFASRIYSSVKSSLNISP  512



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  557  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQT  616

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQLIY+TALMESGF++
Sbjct  617  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSL  676

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNISP
Sbjct  677  PDPKDFASRIYSSVKSSLNISP  698



>gb|AAB63606.1| HSP90 isolog [Arabidopsis thaliana]
Length=335

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  145  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  204

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  205  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFIL  264

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  265  TDPKDFAARIYNSVKSGLNISP  286



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  637  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TAQL+Y+TAL+ESGF +
Sbjct  697  LSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLESGFLL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLN+SP
Sbjct  757  NDPKDFASRIYSSVKSSLNVSP  778



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALASDNVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  637  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPEDES K+TAQL+Y+TAL+ESGF +
Sbjct  697  LSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPEDESVKQTAQLMYQTALLESGFLL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLN+SP
Sbjct  757  NDPKDFASRIYSSVKSSLNVSP  778



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+KES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  637  KDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQLIY+TALMESGFN+
Sbjct  697  LSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALMESGFNL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNI+P
Sbjct  757  PDPKDFASRIYSSVKSSLNINP  778



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALASDN+D+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KAKELKESFKELTKWWKGALASDNIDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR+RV KDPEDES ++TAQL+Y+TAL+ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRDRVAKDPEDESVEQTAQLMYQTALLESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLN+SP
Sbjct  756  NDPKDFASRIYSSVKSSLNVSP  777



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+KES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  637  KDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQLIY+TALMESGFN+
Sbjct  697  LSDASKQAYMRGKRILEINPRHPIIKELRERVVKNAEDESVKQTAQLIYQTALMESGFNL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNI+P
Sbjct  757  PDPKDFASRIYSSVKSSLNINP  778



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  636  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQLIY+TALMESGF++
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNISP
Sbjct  756  PDPKDFASRIYSSVKSSLNISP  777



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   269 bits (688),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFKDLTKWWK ALASDNVD+VK+SNRL DTPCVVVTSKYGWSANMERIMQSQT
Sbjct  632  KAKELKESFKDLTKWWKSALASDNVDDVKVSNRLDDTPCVVVTSKYGWSANMERIMQSQT  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+T+QLIY+TALMESGF +
Sbjct  692  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTSQLIYQTALMESGFML  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIY+SVKSSLNI+P
Sbjct  752  TDPKDFANRIYSSVKSSLNINP  773



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   267 bits (683),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGAL S+NVD+VKI+NRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  652  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTPCVVVTSKFGWSANMERIMQSQT  711

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  K+TAQLIY+TALMESGF++
Sbjct  712  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFSL  771

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNISP
Sbjct  772  PDPKDFASRIYSSVKSSLNISP  793



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKES+K+LTKWWKGALASDNVD+VK+SNRLADTPCVVVTSK+GWSANME+IMQSQT
Sbjct  633  KDKELKESYKELTKWWKGALASDNVDDVKLSNRLADTPCVVVTSKFGWSANMEKIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD++KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K TAQLIY+TALMESGF +
Sbjct  693  LSDSAKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKHTAQLIYQTALMESGFVL  752

Query  376  PDPKDFASRIYNSVKSSLNISPdavveeddeve--eeaetsskeaeSNPENAEDGADGIK  203
            PDPKDFASRIY+SVKSSLNI+PDA VEE+D+ E   EAE  +   E+ PE     AD +K
Sbjct  753  PDPKDFASRIYSSVKSSLNINPDATVEEEDDTEDPAEAEAETPANEATPEAEAANADSLK  812

Query  202  DEL  194
            DEL
Sbjct  813  DEL  815



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  612  KNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  671

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQLIY+TALMESGFN+
Sbjct  672  LSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNL  731

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            P+PKDFASRIY+SVKSSLNISP
Sbjct  732  PEPKDFASRIYSSVKSSLNISP  753



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K+TAQLIY+TALMESGFN+
Sbjct  696  LSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKKTAQLIYQTALMESGFNL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNI+P
Sbjct  756  PDPKDFASRIYSSVKSSLNINP  777



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VKISNRL +TPCVVVTSKYGWSANMERIM SQT
Sbjct  635  KDKELKESFKELTKWWKGALASENVDDVKISNRLDNTPCVVVTSKYGWSANMERIMSSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S KETAQLIY+TALMESGF +
Sbjct  695  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKETAQLIYQTALMESGFML  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIYNSVKSSL+ISP
Sbjct  755  NDPKDFASRIYNSVKSSLDISP  776



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK ALASDNVDEVKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  654  KNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  713

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD EDE  K+TAQLIY+TALMESGFN+
Sbjct  714  LSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSEDEGVKQTAQLIYQTALMESGFNL  773

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            P+PKDFASRIY+SVKSSLNISP
Sbjct  774  PEPKDFASRIYSSVKSSLNISP  795



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQ YMRGKR+LEINPRHPI+KELRERVVK+ EDES K+TAQLIY+TALMESGFN+
Sbjct  696  LSDANKQGYMRGKRILEINPRHPIVKELRERVVKNAEDESVKKTAQLIYQTALMESGFNL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNI+P
Sbjct  756  PDPKDFASRIYSSVKSSLNINP  777



>gb|KDO84885.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=679

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  499  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  558

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQLIY+TALMESGF++
Sbjct  559  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSL  618

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY++VKSSLNISP
Sbjct  619  NDPKDFASRIYSTVKSSLNISP  640



>gb|ABK92622.1| unknown [Populus trichocarpa]
Length=214

 Score =   249 bits (635),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPC+VVTSKYGWSANMERIMQ+QT
Sbjct  27   KAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSKYGWSANMERIMQAQT  86

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L+Y+TALMESGF +
Sbjct  87   LSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFIL  146

Query  376  PDPKDFASRIY  344
             DPKDFASRIY
Sbjct  147  NDPKDFASRIY  157



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKES+K+LTKWWK ALASDNVD+VK+SNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQ YMRGKR+LEINPRHPIIKELRERVVK+ EDES K TAQLIY+TALMESGFN+
Sbjct  696  LSDANKQGYMRGKRILEINPRHPIIKELRERVVKNAEDESVKLTAQLIYQTALMESGFNL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFASRIY+SVKSSLNI+P
Sbjct  756  PDPKDFASRIYSSVKSSLNINP  777



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  640  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  699

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQLIY+TALMESGF++
Sbjct  700  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSL  759

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY++VKSSLNISP
Sbjct  760  NDPKDFASRIYSTVKSSLNISP  781



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  638  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  697

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQLIY+TALMESGF++
Sbjct  698  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSL  757

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY++VKSSLNISP
Sbjct  758  NDPKDFASRIYSTVKSSLNISP  779



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  642  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  701

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED   ++TAQLIY+TALMESGF++
Sbjct  702  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSL  761

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY++VKSSLNISP
Sbjct  762  NDPKDFASRIYSTVKSSLNISP  783



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   262 bits (669),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWKG LAS+NVD+VKISNRLA+TPCVVVTSKYGWSANMERIMQSQT
Sbjct  635  KDKELKESFKDLTKWWKGTLASENVDDVKISNRLANTPCVVVTSKYGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELRERVVKDPE ES K+TA L+Y+TALMESGF +
Sbjct  695  LSDSSKQAYMRGKRVLEINPRHPIIKELRERVVKDPEGESVKQTAHLMYQTALMESGFML  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSL+ISP
Sbjct  755  NDPKDFASRIYDSVKSSLHISP  776



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   261 bits (667),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA LIY+TALMESGF +
Sbjct  696  LTDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDASVKQTAHLIYQTALMESGFML  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLNISP
Sbjct  756  SDPKDFASRIYSSVKSSLNISP  777



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  753  NDPKDFAARIYNSVKSGLNISP  774



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKSSL+ISP
Sbjct  753  NDPKDFAARIYNSVKSSLSISP  774



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKSSL+ISP
Sbjct  753  NDPKDFAARIYNSVKSSLSISP  774



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK LTKWWKGALASDNVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  706  KDKELKESFKGLTKWWKGALASDNVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  765

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYM+GKRVLEINPRHPIIKELRERV+KDPEDES K+TAQL+Y+TALMESGF +
Sbjct  766  LSDANKQAYMKGKRVLEINPRHPIIKELRERVLKDPEDESIKQTAQLVYQTALMESGFVL  825

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK FAS+IY+SVK+SL ISP
Sbjct  826  TDPKSFASQIYSSVKNSLEISP  847



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LTKWWKG+L S+NVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  631  KDKDLKESFKELTKWWKGSLTSENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQ YMRGKRVLEINPRHPIIKELRERVV DPEDES K+TA+L+Y+TALMESGF +
Sbjct  691  LSDASKQGYMRGKRVLEINPRHPIIKELRERVVNDPEDESVKQTARLMYQTALMESGFML  750

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL ISP
Sbjct  751  NDPKDFASRIYDSVKASLKISP  772



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  753  TDPKDFAARIYNSVKSGLNISP  774



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  753  TDPKDFAARIYNSVKSGLNISP  774



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  753  TDPKDFAARIYNSVKSGLNISP  774



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS NVD+VKISNRLAD+PCVVVTSKYGW++NMERIMQSQT
Sbjct  636  KDKELKESFKELTKWWKGALASHNVDDVKISNRLADSPCVVVTSKYGWTSNMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELR+RVVKD EDES K+TAQLIY+TALMESGF +
Sbjct  696  LSDANKQAYMRGKRVLEINPRHPIIKELRDRVVKDSEDESVKQTAQLIYQTALMESGFML  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DP+DFASRIY+SVK+SL ISP
Sbjct  756  SDPQDFASRIYSSVKNSLKISP  777



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWK +LA++NVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  638  KDKELKESFKELTKWWKESLATENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  697

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKEL+ERV  DPE+ES KETA+L+Y+TAL+ESGF +
Sbjct  698  LSDASKQAYMRGKRVLEINPRHPIIKELKERVASDPEEESAKETAKLMYQTALLESGFIL  757

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIYNSVK+SLNISP
Sbjct  758  QDPKDFASRIYNSVKTSLNISP  779



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIYNSVKS LNISP
Sbjct  753  NDPKDFAARIYNSVKSGLNISP  774



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFKDLTKWWK ALAS+NVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  632  KDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TAQL+Y+TALMESGF +
Sbjct  692  LSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALMESGFLL  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK FAS IY+SVKSSLNISP
Sbjct  752  SDPKHFASNIYDSVKSSLNISP  773



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VKISNRLA+TPCVVVTSKYGWS+NMERIMQSQT
Sbjct  637  KDKELKESFKELTKWWKGALASENVDDVKISNRLANTPCVVVTSKYGWSSNMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD EDES K+TA+L+Y+TALMESGF +
Sbjct  697  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDAEDESVKQTARLMYQTALMESGFML  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY+SVKSSL ISP
Sbjct  757  NDPKEFASSIYDSVKSSLKISP  778



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  602  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  661

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  662  LSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFVL  721

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  722  NDPKDFAGRIYNSVKSSLKISP  743



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKES+K+LTKWWK ALASDNVD+VKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  640  KDKDLKESYKELTKWWKSALASDNVDDVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  699

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQ YMRGKRVLEINPRHPIIKELRERVVK+PEDES K TAQL+Y+TALMESGF +
Sbjct  700  LSDANKQGYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKNTAQLMYQTALMESGFTL  759

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRI++SVKS LNISP
Sbjct  760  SDPKDFASRIHDSVKSGLNISP  781



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  753  NDPKDFAGRIYNSVKSSLKISP  774



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  753  NDPKDFAGRIYNSVKSSLKISP  774



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  753  NDPKDFAGRIYNSVKSSLKISP  774



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K++ELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK+GWSANMER+MQ+QT
Sbjct  631  KSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPEDE  K+TAQLIY+TALMESGF +
Sbjct  691  LTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPEDEGVKQTAQLIYQTALMESGFIL  750

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLNISP
Sbjct  751  SDPKDFASRIYSSVKSSLNISP  772



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK +LA+DNVD+VKISNRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKNSLANDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA KQAYMRGKRVLEINPRHPIIKELRERVVK+PEDES K+TAQL+Y+TAL ESGF +
Sbjct  696  LSDAKKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDESVKQTAQLMYQTALFESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL+ISP
Sbjct  756  NDPKDFASRIYDSVKTSLDISP  777



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL+ISP
Sbjct  756  DDPKDFASRIYDSVKTSLDISP  777



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  635  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  695  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLL  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL+ISP
Sbjct  755  DDPKDFASRIYDSVKTSLDISP  776



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   257 bits (656),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736   KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
             K K+LKESFKDLTKWWK ALAS+NVD+VKISNRLADTPCVVVTSKYGWSANMERIMQSQT
Sbjct  898   KDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  957

Query  556   LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
             LSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD EDE  K+TAQL+Y+TALMESGF +
Sbjct  958   LSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSEDEGVKKTAQLMYQTALMESGFLL  1017

Query  376   PDPKDFASRIYNSVKSSLNISP  311
              DPK FAS IY+SVKSSLNISP
Sbjct  1018  SDPKHFASNIYDSVKSSLNISP  1039



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K+KELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK+GWSANMER+MQ+QT
Sbjct  634  KSKELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQT  693

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+DASKQAYMRG+R+LEINPRHPIIKELRERVVKDPEDE  K+TAQLIY+TALMESGF +
Sbjct  694  LTDASKQAYMRGRRILEINPRHPIIKELRERVVKDPEDEGVKQTAQLIYQTALMESGFIL  753

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLNI P
Sbjct  754  TDPKDFASRIYSSVKSSLNIGP  775



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL+ISP
Sbjct  756  DDPKDFASRIYDSVKTSLDISP  777



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VKISNRL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  635  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTPCVVVTSKFGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  695  LSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPEDEGVKHTAQLMYQTALFESGFLL  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL+ISP
Sbjct  755  DDPKDFASRIYDSVKTSLDISP  776



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGAL S+NVD+VKISNRL ++PCVVVTSKYGWSANMERIMQSQ+
Sbjct  632  KDKELKESFKELTKWWKGALTSENVDDVKISNRLDNSPCVVVTSKYGWSANMERIMQSQS  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD  KQAYMRGKRVLEINPRHPIIKELRERVVKDPED S K+TA+LIY+T+LMESGF +
Sbjct  692  LSDHRKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDNSVKQTARLIYQTSLMESGFML  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SLNISP
Sbjct  752  DDPKDFASRIYDSVKTSLNISP  773



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK +L+ DNVD+VKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  637  KNKELKESFKDLTKWWKSSLSKDNVDDVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  696

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K+TAQL+Y+TAL ESGF +
Sbjct  697  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKQTAQLMYQTALFESGFLL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDF SRIY+SVK+SL+ISP
Sbjct  757  DDPKDFTSRIYDSVKTSLDISP  778



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWKG LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPEDESVKETAQLMYQTALIESGFLL  752

Query  376  PDPKDFASRIYNSVKSSLNIS  314
             DPKDFA+RIYNSVKSSL IS
Sbjct  753  NDPKDFAARIYNSVKSSLKIS  773



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVV SK+GWSANMERIMQSQT
Sbjct  629  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVASKFGWSANMERIMQSQT  688

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPEDES KETAQL+Y+TAL+ESGF +
Sbjct  689  LSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPEDESVKETAQLMYQTALIESGFVL  748

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  749  NDPKDFAGRIYNSVKSSLKISP  770



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK LTKWWK  LASDNV++VKISNRLADTPCVVVTSKYGWSA ME+IM SQT
Sbjct  630  KTKELKESFKGLTKWWKTTLASDNVEDVKISNRLADTPCVVVTSKYGWSAYMEKIMHSQT  689

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+LIY+TALMESGF++
Sbjct  690  LSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALMESGFDL  749

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFAS IY+SVKSSLNISP
Sbjct  750  SDPKDFASHIYSSVKSSLNISP  771



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIK+LRER+VKDPEDE  K+ A+L+Y+TAL+ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKDLRERIVKDPEDEGAKQAAKLMYQTALLESGFIL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFAS+IY++VK+SLNISP
Sbjct  756  SDPKDFASQIYDTVKTSLNISP  777



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK +L+ DNVD+VKIS+RL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  635  KDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSKFGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  695  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFESGFLL  754

Query  376  PDPKDFASRIYNSVKSSLNISPda--vveeddeveeeaetsskeaeSNPENAEDGADGIK  203
             DPKDFASRIY+SVK+SL+ISP+A    E+D EVE E+ET  + + SNPE A++  D +K
Sbjct  755  NDPKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVESETKEETSTSNPE-ADEVNDDVK  813

Query  202  DEL  194
            DEL
Sbjct  814  DEL  816



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK LTKWWK  LASDNV++VKIS+RLADTPCVVVTSKYGWSA ME+IM SQT
Sbjct  636  KTKELKESFKGLTKWWKNTLASDNVEDVKISSRLADTPCVVVTSKYGWSAYMEKIMHSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIK LRERVV DPEDES K TA+LIY+TALMESGF++
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPEDESVKLTAKLIYQTALMESGFDL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFAS IY+SVKSSLNISP
Sbjct  756  SDPKDFASHIYSSVKSSLNISP  777



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK +L+ DNVD+VKIS+RL +TPCVVVTSK+GWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTPCVVVTSKFGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PEDE  K TAQL+Y+TAL ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPEDEGVKNTAQLMYQTALFESGFLL  755

Query  376  PDPKDFASRIYNSVKSSLNISPda--vveeddeveeeaetsskeaeSNPENAEDGADGIK  203
             DPKDFASRIY+SVK+SL+ISP+A    E+D EVE E+ET  + + SNPE A++  D +K
Sbjct  756  NDPKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVESETKEETSTSNPE-ADEVNDDVK  814

Query  202  DEL  194
            DEL
Sbjct  815  DEL  817



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFKDLTKWWK AL+ DNVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPI+K+LRER+VKDPEDE  K+ A+L+Y+TAL+ESGF +
Sbjct  696  LSDASKQAYMRGKRVLEINPRHPIVKDLRERIVKDPEDEGAKQAAKLMYQTALLESGFIL  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFAS+IY++VK+SLNISP
Sbjct  756  SDPKDFASQIYDTVKTSLNISP  777



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = -1

Query  733  AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTL  554
             KELKE+FK+LTKWWK +LAS+NVD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQTL
Sbjct  634  VKELKEAFKELTKWWKESLASENVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQTL  693

Query  553  SDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVP  374
            SDA+KQAYMRGKRVLEINPRHPIIKEL++RV  D EDES KETAQL+Y+TAL+ESGF + 
Sbjct  694  SDANKQAYMRGKRVLEINPRHPIIKELKDRVASDAEDESVKETAQLMYQTALIESGFILN  753

Query  373  DPKDFASRIYNSVKSSLNISP  311
            DPKDFA+RIYNSVKSSL ISP
Sbjct  754  DPKDFAARIYNSVKSSLKISP  774



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K LKESFK+LTKWWKGAL S+NVD+VKISNRL+ +PCVVVTSKYGWSANMERIMQSQT
Sbjct  633  KDKALKESFKELTKWWKGALVSENVDDVKISNRLSGSPCVVVTSKYGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA KQ+YMRGKRVLEIN RHPIIKELRERVVKDPEDES K+TAQL+Y+TAL+ESGF +
Sbjct  693  LSDARKQSYMRGKRVLEINARHPIIKELRERVVKDPEDESVKQTAQLMYQTALLESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVK+SL ISP
Sbjct  753  NDPKDFASRIYSSVKNSLRISP  774



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 5/181 (3%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+KES+K+LTKWWKGALA+D VD+VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  635  KDKEIKESYKELTKWWKGALATDKVDDVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DPED+  K+TA+L+Y+TAL ESGF +
Sbjct  695  LSDANKQAYMRGKRVLEINPRHPIIKELRERVATDPEDDGVKQTARLMYQTALFESGFLL  754

Query  376  PDPKDFASRIYNSVKSSLNISPdavveeddeveeeaetsskeaeSNPENAEDGADGIKDE  197
             DPKDFASR+Y+SVK+SL+I+PDA VEE+D+ EE       ++ SN E     AD +KDE
Sbjct  755  DDPKDFASRVYDSVKTSLSINPDAAVEEEDDTEEPEIEMKGDSSSNAE-----ADDVKDE  809

Query  196  L  194
            L
Sbjct  810  L  810



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPCVVVTSKYGWSANMERIMQ+QT
Sbjct  636  KAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCVVVTSKYGWSANMERIMQAQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L+Y+TALMESGF +
Sbjct  696  LSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFIL  755

Query  376  PDPKDFASRIY  344
             DPKDFASRIY
Sbjct  756  NDPKDFASRIY  766



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELKESFK+LTKWWKGALAS+NVD+VKISNRLADTPC+VVTSKYGWSANMERIMQ+QT
Sbjct  636  KAKELKESFKELTKWWKGALASENVDDVKISNRLADTPCIVVTSKYGWSANMERIMQAQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPED+S K+TA L+Y+TALMESGF +
Sbjct  696  LSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDDSVKQTAHLMYQTALMESGFIL  755

Query  376  PDPKDFASRIY  344
             DPKDFASRIY
Sbjct  756  NDPKDFASRIY  766



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LT WWKG LASDNVD VKISNRLADTPCVVVTSK+GWSANMERIMQSQT
Sbjct  633  KDKELKEAFKELTTWWKGILASDNVDSVKISNRLADTPCVVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  D EDES KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDSEDESVKETAQLMYQTALIESGFVL  752

Query  376  PDPKDFASRIYNSVKSSLNIS  314
             DPKDFA+RIYNSVKS L IS
Sbjct  753  NDPKDFAARIYNSVKSGLKIS  773



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  633  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERV +DPEDES K+TA+LIY+TALMESGFN+
Sbjct  693  LSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPEDESMKQTARLIYQTALMESGFNL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY SV  SL+ISP
Sbjct  753  NDPKEFASSIYKSVHKSLDISP  774



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK +LA +NVD+VKISNRLADTPC+VVTSK+GWSANMERIMQSQT
Sbjct  633  KVKELKEAFKELTKWWKESLAGENVDDVKISNRLADTPCIVVTSKFGWSANMERIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA KQAYMRGKRVLEINPRHPIIKEL++RV  D ED+S KETAQL+Y+TAL+ESGF +
Sbjct  693  LSDAKKQAYMRGKRVLEINPRHPIIKELKDRVASDQEDKSVKETAQLMYQTALIESGFIL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  753  NDPKDFAGRIYNSVKSSLKISP  774



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  733  AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTL  554
            +KE+KESFK+LTKWWKGALASDNVD+VKIS+RL+D+PCVVVTSKYGWSANMERIMQSQTL
Sbjct  637  SKEVKESFKELTKWWKGALASDNVDDVKISSRLSDSPCVVVTSKYGWSANMERIMQSQTL  696

Query  553  SDASKQ-AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            SD++KQ +YMRGKRVLEINPRHPIIKELR+RV  +PEDE  K+TAQL+Y+TALMESGF +
Sbjct  697  SDSNKQSSYMRGKRVLEINPRHPIIKELRDRVALNPEDEGVKQTAQLMYQTALMESGFVL  756

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY SVK+SLNISP
Sbjct  757  NDPKDFASRIYGSVKNSLNISP  778



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FK+LTKWWK AL+++NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  634  KGKELKETFKELTKWWKDALSAENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  693

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRER+  +P+DES K+TA+L+Y+TALMESGF +
Sbjct  694  LSDASKQAYMRGKRVLEINPRHPIIKELRERIAANPQDESIKQTARLMYQTALMESGFLL  753

Query  376  PDPKDFASRIYNSVKSSLNISPdavveeddeveeeaetsskeaeSNPENAEDGADGIKDE  197
             DPKDFA RIY+SVK+SL+ISPDA  EE+D++EE      + A ++ E  E+ +  +KDE
Sbjct  754  NDPKDFAERIYSSVKASLDISPDATAEEEDDIEETEAEEKESASADKEADEEDSSSLKDE  813

Query  196  L  194
            L
Sbjct  814  L  814



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   245 bits (625),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  638  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  697

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERV +DP+DES K+TAQLIY+TALMESGF +
Sbjct  698  LSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPKDESVKQTAQLIYQTALMESGFIL  757

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY SV+ SL+ISP
Sbjct  758  NDPKEFASSIYKSVQKSLDISP  779



>gb|AFW75769.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=429

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  256  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQT  315

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+TALMESGFN+
Sbjct  316  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNL  375

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+  L++SP
Sbjct  376  PDPKEFASSIYKSVQKGLDLSP  397



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKE+FKDLTKWWK +LA +NVD+VKISNRLADT CVVVTSK+GWSANMERIMQSQT
Sbjct  615  KVKELKEAFKDLTKWWKESLAGENVDDVKISNRLADTLCVVVTSKFGWSANMERIMQSQT  674

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA KQAYMRGKRVLEIN RHPIIKEL++RV  DPED S KETAQL+Y+TAL+ESGF +
Sbjct  675  LSDAKKQAYMRGKRVLEINLRHPIIKELKDRVASDPEDGSVKETAQLMYQTALIESGFIL  734

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA RIYNSVKSSL ISP
Sbjct  735  NDPKDFAGRIYNSVKSSLKISP  756



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE KESFK+LT WWK  L+SDNVD VKISNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  636  KIKETKESFKELTNWWKDVLSSDNVDSVKISNRLDNTPCVVVTSKYGWSANMERIMQSQT  695

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ KETA+L+Y+TALMESGF +
Sbjct  696  LSDANKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENVKETAKLMYQTALMESGFML  755

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             +PK+FAS IYNSVKSSL ISP
Sbjct  756  SEPKEFASSIYNSVKSSLKISP  777



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  633  KIKDLKESFKELTSWWKEALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELRERV  DP+DE+ K+TA+LIY+TALMESGF +
Sbjct  693  LSDASKQAYMRGKRVLEINPRHPIIKELRERVAVDPQDENIKQTAKLIYQTALMESGFLM  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FA+ IY+SVKSSLNISP
Sbjct  753  NDPKEFATSIYSSVKSSLNISP  774



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK +L+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  638  KLKELKESFKELTDWWKNSLSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  697

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYM GKRVLEINPRHPIIKELRERV +DP+DES K+TA+LIY+TALMESGF +
Sbjct  698  LSDASKQAYMHGKRVLEINPRHPIIKELRERVAQDPKDESVKQTARLIYQTALMESGFIL  757

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IYNSV+ SL+ISP
Sbjct  758  NDPKEFASSIYNSVQKSLDISP  779



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  654  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  713

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPI+KELRERV +DP+DES K+TA+LIY+TALMESGF +
Sbjct  714  LSDASKQAYMRGKRVLEINPRHPIVKELRERVAQDPKDESVKQTARLIYQTALMESGFIL  773

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY SV+ SL+ISP
Sbjct  774  NDPKEFASSIYKSVQKSLDISP  795



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  633  KLKDLKESFKELTDWWKKALDSENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQSQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  693  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAEDNESESLKQTAKLVYQTALMESGFNL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  753  PDPKDFASSIYKSVQKSLDLSP  774



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  632  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQT  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  692  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNL  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  752  PDPKDFASSIYRSVQKSLDLSP  773



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  634  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQT  693

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  694  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNL  753

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  754  PDPKDFASSIYRSVQKSLDLSP  775



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  659  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQT  718

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  719  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNL  778

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  779  PDPKDFASSIYRSVQKSLDLSP  800



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  660  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQT  719

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  720  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNL  779

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  780  PDPKDFASSIYRSVQKSLDLSP  801



>gb|AFW75768.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=667

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  494  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQT  553

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+TALMESGFN+
Sbjct  554  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNL  613

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+  L++SP
Sbjct  614  PDPKEFASSIYKSVQKGLDLSP  635



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   238 bits (606),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL +++VD VKISNRL+DTPCVVVTSKYGWSANME+IMQSQT
Sbjct  632  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTPCVVVTSKYGWSANMEKIMQSQT  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  692  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTAKLVYQTALMESGFNL  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFA  IY SV+ SL++SP
Sbjct  752  PDPKDFAFSIYRSVQKSLDLSP  773



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  630  KLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQT  689

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L+Y+TALMESGFN+
Sbjct  690  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDTESEGLKQTARLVYQTALMESGFNL  749

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+ SL++SP
Sbjct  750  PDPKEFASSIYKSVQKSLDLSP  771



>dbj|BAJ89816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  363  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  422

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L+Y+TALMESGFN+
Sbjct  423  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNL  482

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  483  PDPKDFASSIYRSVQKSLDLSP  504



>gb|ABK24228.1| unknown [Picea sitchensis]
Length=466

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+K+SFK+LT WWK  L+S+NVD VKISNRL +TP VVVTSKYGWSANMERIMQSQT
Sbjct  267  KDKEIKDSFKELTNWWKDILSSENVDSVKISNRLDNTPGVVVTSKYGWSANMERIMQSQT  326

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA++Q+YMRGKRVLEINPRHPIIKELRERV + PEDE+ K+TA+LIY+TALMESGF +
Sbjct  327  LSDANRQSYMRGKRVLEINPRHPIIKELRERVTQSPEDENIKQTARLIYQTALMESGFIL  386

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY+++K++LN++P
Sbjct  387  NDPKEFASSIYSTIKTTLNVNP  408



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  631  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+TALMESGFN+
Sbjct  691  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNL  750

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+  L++SP
Sbjct  751  PDPKEFASSIYKSVQKGLDLSP  772



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  635  KLKDLKESFKELTNWWKDALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA+KQAYMRGKRVLEINPRHPIIKELR+RV +D +DE  K TA+LIY+TALMESGF +
Sbjct  695  LSDATKQAYMRGKRVLEINPRHPIIKELRDRVAQDSKDEGLKHTARLIYQTALMESGFIL  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFAS IY SV+ SL+ISP
Sbjct  755  NDPKDFASSIYKSVQKSLDISP  776



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL S+NVD VKISNRL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  633  KLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTPCVVVTSKYGWSANMEKIMQAQT  692

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+TALMESGFN+
Sbjct  693  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNL  752

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+  L++SP
Sbjct  753  PDPKEFASSIYKSVQKGLDLSP  774



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 8/142 (6%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VKISNRL+D+PCVVVTSKYGWS+NMERIMQSQT
Sbjct  635  KDKELKESFKELTKWWKGALASENVDDVKISNRLSDSPCVVVTSKYGWSSNMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPII  +        +DES K+TAQL+Y+TALMESGF +
Sbjct  695  LSDASKQAYMRGKRVLEINPRHPIIFLV--------QDESVKQTAQLMYQTALMESGFLL  746

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFASRIY+SVKSSLNISP
Sbjct  747  NDPKDFASRIYSSVKSSLNISP  768



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+L+ WWK AL S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQ+QT
Sbjct  631  KLKELKESFKELSDWWKKALESENVDSVKISNRLHNTPCVVVTSKYGWSANMEKIMQAQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+TALMESGFN+
Sbjct  691  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQTALMESGFNL  750

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV+ SL++SP
Sbjct  751  PDPKEFASSIYKSVQKSLDLSP  772



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WW  AL+S+NVD VKISNRL +TPCVVVTSKYGWSANME+IMQSQT
Sbjct  632  KLKDLKESFKELTNWWNDALSSENVDSVKISNRLDNTPCVVVTSKYGWSANMEKIMQSQT  691

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHP+IKELR+RV +D +DES K TA+LIY+TALMESGF +
Sbjct  692  LSDASKQAYMRGKRVLEINPRHPVIKELRDRVAQDSKDESLKHTARLIYQTALMESGFIL  751

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FAS IY SV+ SL+ISP
Sbjct  752  NDPKEFASSIYKSVQKSLDISP  773



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL S+++D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  630  KLKDLKESFKELTDWWKKALESESIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  689

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E ES K+TA+L+Y+TALMESGFN+
Sbjct  690  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSESESLKQTARLVYQTALMESGFNL  749

Query  376  PDPKDFASRIYNSVKSSLNIS  314
            PDPKDFAS IY SV+ SL++S
Sbjct  750  PDPKDFASSIYRSVQKSLDLS  770



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  629  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  688

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D ED   K+TA+L+Y+TALMESGFN+
Sbjct  689  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDNEDVGLKQTARLVYQTALMESGFNL  748

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  749  PDPKDFASSIYRSVQKSLDLSP  770



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  630  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  689

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L+Y+TALMESGFN+
Sbjct  690  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNL  749

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  750  PDPKDFASSIYRSVQKSLDLSP  771



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  542  RLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQT  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L+Y+TALMESGFN+
Sbjct  602  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNL  661

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV  SL++SP
Sbjct  662  PDPKEFASSIYKSVHKSLDLSP  683



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  698  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  757

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L+Y+TALMESGFN+
Sbjct  758  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNL  817

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  818  PDPKDFASSIYRSVQKSLDLSP  839



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  631  RLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L+Y+TALMESGFN+
Sbjct  691  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNL  750

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV  SL++SP
Sbjct  751  PDPKEFASSIYKSVHKSLDLSP  772



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   230 bits (587),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + K+LKESFK+LT+WWK AL S++VD VK+S+RL DTPCVVVTSKYGWSANME+IMQ+QT
Sbjct  824  RLKDLKESFKELTEWWKKALESESVDSVKVSSRLHDTPCVVVTSKYGWSANMEKIMQAQT  883

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K+TA+L+Y+TALMESGFN+
Sbjct  884  LSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKQTARLVYQTALMESGFNL  943

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPK+FAS IY SV  SL++SP
Sbjct  944  PDPKEFASSIYKSVHKSLDLSP  965



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   231 bits (589),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+LKESFK+LT WWK AL ++ +D VKISNRL +TPCVVVTSKYGWS+NME+IMQ+QT
Sbjct  639  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQT  698

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDASKQAYMRGKRVLEINPRHPIIKELR++V +D + E  K+TA+L+Y+TALMESGFN+
Sbjct  699  LSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSDSEGLKQTARLVYQTALMESGFNL  758

Query  376  PDPKDFASRIYNSVKSSLNISP  311
            PDPKDFAS IY SV+ SL++SP
Sbjct  759  PDPKDFASSIYRSVQKSLDLSP  780



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+K+SFK+LT WWK  L+S+NVD VKISNRL +TP VVVTSKYGWSANMERIMQSQT
Sbjct  635  KDKEIKDSFKELTNWWKDVLSSENVDSVKISNRLDNTPGVVVTSKYGWSANMERIMQSQT  694

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSDA++Q+YMRGKRVLEINP+HPIIKELRERV ++PE+E+ K+TA+LIY+TALMESGF +
Sbjct  695  LSDANRQSYMRGKRVLEINPKHPIIKELRERVTQNPEEENIKQTARLIYQTALMESGFIL  754

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPK+FA+ IY+++K++LN++P
Sbjct  755  NDPKEFATSIYSTIKTTLNVNP  776



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELK+SFK L  WWK  L  + VD VKISNRLADTP VVVTS YGWSANMERIM++QT
Sbjct  655  KAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTSTYGWSANMERIMRAQT  714

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T +LIYKTAL++SGF V
Sbjct  715  LTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALIDSGFLV  774

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             D K+FAS+IY+ +KS+LNISP
Sbjct  775  DDSKEFASQIYSIIKSNLNISP  796



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            KAKELK+SFK L  WWK  L  + VD VKISNRLADTP VVVTS YGWSANMERIM++QT
Sbjct  655  KAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTPAVVVTSTYGWSANMERIMRAQT  714

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+D S+Q YMRGKRVLEINPRHPIIKELR +V + PEDESTK T +LIYKTAL++SGF V
Sbjct  715  LTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPEDESTKATGKLIYKTALIDSGFLV  774

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             D K+FAS+IY+ +KS+LNISP
Sbjct  775  DDSKEFASQIYSIIKSNLNISP  796



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KE+KES+K+LTKWWK  L+ + V+ VK+SNRLA+TP VVVTSKYGWSANMERIMQ+QT
Sbjct  640  KFKEIKESYKELTKWWKDLLSGEMVEAVKVSNRLANTPAVVVTSKYGWSANMERIMQAQT  699

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L+D SKQ+YMRGKR+LEINP+HPIIK+L+E++    ED+S K+ A+L+++TAL+ESGF +
Sbjct  700  LADPSKQSYMRGKRILEINPKHPIIKDLKEKISLSSEDDSAKQAAKLVFETALLESGFVL  759

Query  376  PDPKDFASRIYNSVKSSLNISP  311
             DPKDFA+RIY+ +KS+LN+SP
Sbjct  760  EDPKDFANRIYSVIKSNLNVSP  781



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K KELKESFK+LTKWWKGALAS+NVD+VK+SNRL +TPCVVVTSKYGWSANMERIMQSQT
Sbjct  638  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQT  697

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDE  440
            LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE E
Sbjct  698  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEVE  736



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            K+LKE FKD T+WWK  L +D V+ VKISNRL  TPC VVTSKYGWSANMERIM++Q LS
Sbjct  637  KKLKEQFKDFTRWWKDVLPADEVESVKISNRLVTTPCSVVTSKYGWSANMERIMKAQALS  696

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D S+ +YM+GK+ LEINPRHPIIK L+ER   D +DE TK  A+++++TA++ESGF   +
Sbjct  697  DESRLSYMKGKKTLEINPRHPIIKALKERAADDADDEETKTLAKVMFETAMLESGFTFEE  756

Query  370  PKDFASRIYNSVKSSLNIS  314
            P  FASR+++ V+S++ +S
Sbjct  757  PAGFASRLFDMVRSNMGVS  775



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K++ELK+SFK+LTKWWKG L +++VDEVKISNRL +TPCVVVTSK+GWSANMER+MQ+QT
Sbjct  631  KSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTPCVVVTSKFGWSANMERLMQAQT  690

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  446
            L+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPE
Sbjct  691  LTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + K++KE FKD TKWWK  L S+ V+ VKISNRL  TPC VVTSKYGWSANMERIM++Q 
Sbjct  611  RLKKVKEEFKDFTKWWKEILPSEEVEAVKISNRLVTTPCSVVTSKYGWSANMERIMKAQA  670

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            LSD  + AYMRG++ LEINP HPIIK L+E+   D  DE TK TA ++Y+TAL+ESGF  
Sbjct  671  LSDDGRMAYMRGRKTLEINPGHPIIKALKEKSEDDAGDEDTKRTALIMYETALLESGFMF  730

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +PK FA R+++ V+  L +
Sbjct  731  EEPKGFAGRLFDMVRRDLGV  750



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + K+ KE+FK  T WWK  L    ++ VK+SNRL+ TPCVVV+SKYGWSANMERIM++Q 
Sbjct  616  RFKKTKEAFKSFTTWWKSKLPDTMIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQA  675

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            + D S+  YMRGK+ LE+NPRHP+I  L+ER   DP+ E T+  A+L+++TA++ESGF+ 
Sbjct  676  MGDESRHEYMRGKKTLEVNPRHPMIAALKERAATDPDSEETETLAKLMFETAMLESGFSF  735

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+++ SR+++ +KS++ I
Sbjct  736  DKPQEYTSRVFDLLKSNMGI  755



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            K+ K++FK  T WWK  L  + ++ VK+SNRL+ TPCVVV+SKYGWSANMERIM++Q + 
Sbjct  616  KKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMG  675

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D S+  YMRGK+ LEINPRHP+I  L+ER   DP+    +  A+L+++TA++ESGF+   
Sbjct  676  DESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLESGFSFDK  735

Query  370  PKDFASRIYNSVKSSLNI  317
            P D+A R+++ +K ++ +
Sbjct  736  PGDYAGRVFDLLKMNMGV  753



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            K+ K++FK  T WWK  L  + ++ VK+SNRL+ TPCVVV+SKYGWSANMERIM++Q + 
Sbjct  615  KKTKDAFKTFTTWWKSKLPDNVIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMG  674

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D S+  YMRGK+ LEINPRHP+I  L+ER   DP+    +  A+L+++TA++ESGF+   
Sbjct  675  DESRHEYMRGKKTLEINPRHPMIAALKERAASDPDSTENEALAKLMFETAMLESGFSFDK  734

Query  370  PKDFASRIYNSVKSSLNI  317
            P D+A R+++ +K ++ +
Sbjct  735  PGDYAGRVFDLLKMNMGV  752



>ref|XP_005842771.1| hypothetical protein CHLNCDRAFT_59468, partial [Chlorella variabilis]
 gb|EFN50654.1| hypothetical protein CHLNCDRAFT_59468 [Chlorella variabilis]
Length=325

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            K+LKE FKDL KWWK +L    V+ VK+S RLA TPCVVV+SKYGWSA ME+I +SQTL 
Sbjct  200  KKLKEEFKDLAKWWKESLGP-AVESVKVSKRLATTPCVVVSSKYGWSATMEKIARSQTLG  258

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+ +  +MRG+R LEINPRHP+I+EL+ + + DPE  S K+ AQL+Y+T L+ESG  + D
Sbjct  259  DSERAKWMRGQRTLEINPRHPLIRELKAQHIADPESASVKDNAQLLYQTCLLESGCLLDD  318

Query  370  PKDFASR  350
             K+F SR
Sbjct  319  MKEFNSR  325



>gb|AFK40768.1| unknown [Lotus japonicus]
Length=82

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  583  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  404
            MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL+Y+T
Sbjct  1    MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQT  60

Query  403  ALMESGFNVPDPKDFASRI  347
            AL ESGF + DPKDFASRI
Sbjct  61   ALFESGFLLNDPKDFASRI  79



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   164 bits (415),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = -1

Query  730   KELKESFKDLTKWWKGALAS---DNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQ  560
             K+ KE FK  TKWWK AL +   D+++ VKISNRL+ TPCVVVTSKYGWSANMERIM++Q
Sbjct  1036  KKTKEHFKPFTKWWKDALLTSYPDSIENVKISNRLSTTPCVVVTSKYGWSANMERIMRAQ  1095

Query  559   TLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFN  380
              LSD S+  YM+GK+ LEIN +HP++  L+E+   D EDE++K  A ++++TAL+ESGF 
Sbjct  1096  ALSDDSRAQYMKGKKTLEINYKHPLVAALKEKYEADGEDETSKNLAVVMFETALIESGFV  1155

Query  379   VPDPKDFASRIYNSVKSSLNI  317
             + D K  ASR+++ +K  + +
Sbjct  1156  IDDSKSMASRVFDLLKDKMGV  1176



>gb|ACN26939.1| unknown [Zea mays]
Length=123

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -1

Query  583  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  404
            ME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+T
Sbjct  1    MEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQT  60

Query  403  ALMESGFNVPDPKDFASRIYNSVKSSLNISP  311
            ALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  61   ALMESGFNLPDPKEFASSIYKSVQKGLDLSP  91



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = -1

Query  718  ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASK  539
            E FKD+  WWK  L +  V +VK+S RLA +P +V+TSKYGWSANMERIM+SQ L D + 
Sbjct  606  EEFKDVLAWWKELLGA-AVGQVKVSTRLATSPAIVLTSKYGWSANMERIMKSQALGDTAD  664

Query  538  QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDF  359
            ++YM+G + LEINPRHP++ EL+ +  +D E +     A+L++ TAL+ESGF +  PK+F
Sbjct  665  RSYMKGMKTLEINPRHPLVLELKRQFEEDKESDKAAAYARLLWDTALLESGFEIEAPKEF  724

Query  358  ASRIYNSVKSSLNI  317
             SRIY  +  + NI
Sbjct  725  NSRIYGLLAQAYNI  738



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -1

Query  703  LTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMR  524
            LT+WWK  LA +++  VK+S RLA+TP VVVTS+ GWS+NMER++ +Q L D SK + M+
Sbjct  590  LTRWWKDLLAGESIGFVKVSARLANTPAVVVTSRTGWSSNMERVVLAQALVDPSKVSQMK  649

Query  523  GKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIY  344
             KR+LEINPRHPII+ L ++V +DP DE     A LIY+TAL+ESGF + + K FA +I+
Sbjct  650  SKRILEINPRHPIIRMLLQKVTEDPADEVAHRVAVLIYETALLESGFTLNNAKTFAEQIH  709

Query  343  NSVKSSLNISP  311
            + +K  L++ P
Sbjct  710  SLMKLVLDVDP  720



>ref|XP_006678605.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80649.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
Length=586

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K K+ KE+F+ LTK  K  L  D V++V ISNR+ ++PCV+VT++YGWSANMERIM++Q 
Sbjct  419  KLKQQKEAFEPLTKQIKEILG-DKVEKVTISNRIVNSPCVLVTNQYGWSANMERIMKAQA  477

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L DAS Q+YM GK+ LE+NP + I+K L+ +V +D  D++ K+  QL+Y+TAL+ SGF++
Sbjct  478  LRDASMQSYMLGKKTLELNPDNAIVKALKVKVDEDKNDKTVKDLTQLLYETALLSSGFSL  537

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  538  EEPSSFAGRIHRMIKLGLSI  557



>ref|XP_007515443.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14322.1| predicted protein [Bathycoccus prasinos]
Length=802

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +++ + FK +T+W K  L  + V++V++S+RL +TPC++VTSK+GWSANMERIM++Q 
Sbjct  650  KNEQIADEFKTVTEWLKKELVGE-VEKVEVSSRLTETPCILVTSKFGWSANMERIMKAQA  708

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            + DA  Q YM+GK+ LEINP  P+IK+L+ RV   P+ E TKE  +L++ TAL+ SGF++
Sbjct  709  MGDARAQDYMKGKKTLEINPFSPVIKQLKMRVESAPDAEETKEMCKLLFDTALLTSGFSI  768

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P +FA R++  +    N+
Sbjct  769  DQPAEFAERVFKLMTQEANL  788



>ref|XP_006220022.1| PREDICTED: heat shock protein 90-like, partial [Vicugna pacos]
Length=189

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  17   KFEEDKVKFENLCKVIKDILEK-KVEKVAVSNRLVHSPCCIVTSEYGWSANMERIMKAQA  75

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  76   LRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLSSGFTL  135

Query  376  PDPKDFASRIYNSVKSSLNIS  314
             +P+  ASRIY  +K  L+I 
Sbjct  136  EEPQSHASRIYRMIKLGLDIG  156



>ref|XP_308799.3| AGAP006959-PA [Anopheles gambiae str. PEST]
 gb|EAA04769.4| AGAP006959-PA [Anopheles gambiae str. PEST]
Length=393

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  213  KREEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  271

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  272  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSL  331

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   ASRIY  +K  L I
Sbjct  332  DEPGTHASRIYRMIKLGLGI  351



>gb|KHJ75602.1| Hsp90 protein [Oesophagostomum dentatum]
Length=212

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 97/141 (69%), Gaps = 1/141 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L    V++V +SNRL ++PC +VTS+YGWSANMERIM++Q 
Sbjct  40   KFEEDKVKFENLCKVIKDILEK-KVEKVVVSNRLVNSPCCIVTSEYGWSANMERIMKAQA  98

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H I+K LRERV  D  D++ K+   L+++TAL+ SGF++
Sbjct  99   LRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKNDKTVKDLVILLFETALLSSGFSL  158

Query  376  PDPKDFASRIYNSVKSSLNIS  314
             +P+  ASRIY  +K  L+I 
Sbjct  159  EEPQSHASRIYRMIKLGLDIG  179



>gb|AEG19531.1| heat shock protein 90 [Glaciozyma antarctica]
Length=707

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DLT+  K  L  D V++V ISNR+AD+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  546  FEDLTRTMKDILG-DKVEKVSISNRIADSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  604

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM+ K+ LEINP + IIKELR +V +D  D++ K    L+Y+TAL+ SGF +  P DFA+
Sbjct  605  YMQSKKTLEINPHNAIIKELRRKVQEDAADKTVKSLIVLLYETALLTSGFTLDAPVDFAN  664

Query  352  RIYNSVKSSLNI  317
            RI+N +   L+I
Sbjct  665  RIHNMISLGLSI  676



>gb|KDE07091.1| heat shock protein 90-1 [Microbotryum violaceum p1A1 Lamole]
Length=707

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + KE KE F+DLT+  K  L  D V++V ISNR++D+PCV+VT  +GWSANMERIM++Q 
Sbjct  535  REKETKE-FEDLTRTIKEILG-DKVEKVSISNRISDSPCVLVTGAFGWSANMERIMKAQA  592

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L DAS  +YM+ K+ LEINP + I+KELR +V +D  D++ ++   L+Y+TAL+ SGF +
Sbjct  593  LRDASMSSYMQSKKTLEINPHNAIVKELRSKVQEDAADKTVRDLVTLLYETALLTSGFTL  652

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P DFA+RI+  +   L+I
Sbjct  653  DAPTDFAARIHRMISLGLSI  672



>emb|CAG01829.1| unnamed protein product [Tetraodon nigroviridis]
Length=212

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ L D+S   
Sbjct  48   FENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQALRDSSTMG  106

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+Y+TAL+ SGF + DP+  A+
Sbjct  107  YMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLYETALLSSGFTLEDPQTHAN  166

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L I
Sbjct  167  RIYRMIKLGLGI  178



>ref|XP_005538149.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAC67671.2| heat shock 90kD protein [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82113.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
Length=706

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F +L K  K  L  D V++V +S RLAD+PC++VTS++GWSANMERIM++Q L D++   
Sbjct  542  FANLLKVMKDILG-DRVEKVILSERLADSPCILVTSEFGWSANMERIMKAQALRDSTMSM  600

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+++E+NP +PII+ELR+RV  DP D++ K+   L+Y TAL+ SGF++ +P  F+S
Sbjct  601  YMSAKKIMEVNPSNPIIRELRDRVEADPSDKTVKDLVNLLYDTALLASGFSLDEPNTFSS  660

Query  352  RIYNSVKSSLNI  317
            RI+  +K  L+I
Sbjct  661  RIHRMIKLGLSI  672



>ref|XP_001740319.1| heat shock protein [Entamoeba dispar SAW760]
 gb|EDR23250.1| heat shock protein, putative [Entamoeba dispar SAW760]
Length=207

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = -1

Query  709  KDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAY  530
            ++L+K  K  L  D +++V ISNRL ++PC +VT +YGWSANMERIM++Q L D S   Y
Sbjct  49   EELSKVVKEILG-DKIEKVVISNRLVNSPCALVTGEYGWSANMERIMKAQALRDNSMSTY  107

Query  529  MRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASR  350
            M  K+ LEINP HPI++ELR+RV  D  D++ K+   L+++TAL+ SGF++ +P  FA R
Sbjct  108  MVSKKTLEINPDHPIVQELRKRVHTDNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGR  167

Query  349  IYNSVKSSLNI  317
            IY  VK  L++
Sbjct  168  IYRMVKLGLSL  178



>gb|ACU45247.1| HSP90 [Karlodinium veneficum]
Length=373

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+ LTK  K  L  D V++V IS+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  202  KIEELKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQA  260

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L++ T+L+ SGFN+
Sbjct  261  LRDNSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNL  320

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  321  DEPTQFAGRIHRMIKLGLSI  340



>ref|XP_010902983.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Esox lucius]
Length=725

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK +F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  553  KQEELKTTFENLCKIMKDILDK-KIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  611

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TALM SGF +
Sbjct  612  LRDNSTMGYMTAKKHLEINPTHPIIETLREKAEADKNDKAVKDLVILLFETALMSSGFTL  671

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  672  DDPQTHANRIYRMIKLGLGI  691



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            +F++L K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L D +  
Sbjct  15   AFENLCKTMKEILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDNNMS  73

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ DP  FA
Sbjct  74   AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  133

Query  355  SRIYNSVKSSLNI  317
             RI+  +K  LNI
Sbjct  134  GRIHRMLKLGLNI  146



>ref|XP_308800.3| AGAP006958-PA [Anopheles gambiae str. PEST]
 sp|Q7PT10.3|HSP83_ANOGA RecName: Full=Heat shock protein 83 [Anopheles gambiae]
 gb|EAA04712.4| AGAP006958-PA [Anopheles gambiae str. PEST]
Length=720

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  540  KREEDKAKFENLCKVMKSVLES-KVEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  598

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  599  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSL  658

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   ASRIY  +K  L I
Sbjct  659  DEPGTHASRIYRMIKLGLGI  678



>ref|XP_007385736.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN07443.1| HSP90-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=697

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            SF DL    K AL  D V++V +SNR+ D+PCV+VT ++GWSANMERIM++Q L D+S  
Sbjct  536  SFADLCTAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSANMERIMKAQALRDSSMS  594

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            +YM  K+ LE+NP +PIIKELR++V +D  D+S ++   L+++TAL+ SGF + DP  FA
Sbjct  595  SYMASKKTLELNPHNPIIKELRKKVSEDKADKSVRDLTYLLFETALLTSGFTLDDPTSFA  654

Query  355  SRIYNSVKSSLNI  317
             RI+  +   L++
Sbjct  655  KRIHRMISLGLDV  667



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 97/143 (68%), Gaps = 4/143 (3%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELKE FKDLTKWWK  +    +  VK+SNRLA TPC+VVT KYG SANMERIM++Q 
Sbjct  582  KDEELKEQFKDLTKWWKKVVDDSKLQGVKVSNRLATTPCIVVTGKYGNSANMERIMRAQA  641

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE---DESTKETAQLIYKTALMESG  386
             S     ++   +R LEINPRHP+I  L++++    E   +ES   TA+L+Y+TAL+ESG
Sbjct  642  FSRPG-SSFTPTQRTLEINPRHPLIVALKDKLAAATEETVEESAVATARLLYETALLESG  700

Query  385  FNVPDPKDFASRIYNSVKSSLNI  317
            F   D K F+ R+Y  +K +L +
Sbjct  701  FVPDDAKAFSQRMYGVLKDTLGV  723



>gb|AGW82181.1| heat shcok protein 90, partial [Corbicula fluminea]
Length=190

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F+ L K  K  L    V++V +SNRL ++PC +VTS+YGWSANMERIM++Q 
Sbjct  50   KREEQKAEFEGLCKVMKEIL-DKKVEKVTVSNRLVNSPCCIVTSQYGWSANMERIMKAQA  108

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H IIK L+E+V  D  D+S K+   L+++TAL+ SGF +
Sbjct  109  LRDSSTMGYMAAKKHLEINPDHSIIKALKEKVSVDKNDKSVKDLVLLMFETALLASGFAL  168

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP   A+RI   +K  L I
Sbjct  169  EDPTTHANRINRMIKLGLGI  188



>gb|ACO58580.1| heat shock protein 90 [Apis mellifera]
Length=362

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  198  FENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  256

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L+++TAL+ SGF + DP+  AS
Sbjct  257  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  316

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L  
Sbjct  317  RIYRMIKLGLGF  328



>gb|EJT49886.1| chaperone [Trichosporon asahii var. asahii CBS 2479]
 gb|EKC98967.1| chaperone [Trichosporon asahii var. asahii CBS 8904]
Length=691

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            KE KE F+DL K  K  L  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L 
Sbjct  527  KEQKE-FEDLCKNIKETLG-DRVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALR  584

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  +YM  K+ LEINP+HPIIKEL+++  +D  D++ K+   L+Y+T+L+ SGF + +
Sbjct  585  DSSMSSYMASKKTLEINPQHPIIKELKKKSDEDKGDKTVKDLTTLLYETSLLTSGFTLNN  644

Query  370  PKDFASRIYNSVKSSLNI  317
            P+DFASRI   +   L+I
Sbjct  645  PQDFASRINRMISLGLSI  662



>gb|EPT06188.1| hypothetical protein FOMPIDRAFT_1109676 [Fomitopsis pinicola 
FP-58527 SS1]
Length=702

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  541  FEDLCKAVKDALG-DKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  599

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PI+KELR++V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  600  YMASKKTLELNPHNPIVKELRKKVAEDKADKSVRDLTFLLFETALLTSGFSLDDPTSFAK  659

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  660  RIHRMISLGLDV  671



>gb|AAB05638.1| heat shock protein 82 [Anopheles albimanus]
 gb|AAB05639.1| heat shock protein 82 [Anopheles albimanus]
Length=721

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  542  KREEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  600

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  601  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSL  660

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   A+RIY  VK  L I
Sbjct  661  DEPGTHAARIYRMVKLGLGI  680



>gb|ETN67039.1| heat shock protein [Anopheles darlingi]
Length=721

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  542  KREEDKAKFENLCKVMKSVLES-KVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  600

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  601  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDLVILLFETALLSSGFSL  660

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   A+RIY  VK  L I
Sbjct  661  DEPGTHAARIYRMVKLGLGI  680



>gb|EWM29604.1| heat shock protein 90 [Nannochloropsis gaditana]
Length=713

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT +YGWSANMERIM++Q L 
Sbjct  543  EELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVTGEYGWSANMERIMKAQALR  601

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+   L+Y T+L+ SGF++ D
Sbjct  602  DSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLTSGFSLDD  661

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FASRI+  +K  L+I
Sbjct  662  PNTFASRIHRLIKLGLSI  679



>gb|KFB48797.1| hypothetical protein ZHAS_00016808 [Anopheles sinensis]
Length=573

 Score =   140 bits (353),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  394  KREEDKAKFENLCKVMKSVL-ENKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  452

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H I++ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  453  LRDSSAMGYMAGKKHLEINPDHAIVETLRQRADADKNDKAVKDLVILLFETALLSSGFSL  512

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   ASRIY  +K  L I
Sbjct  513  DEPGTHASRIYRMIKLGLGI  532



>ref|XP_005855339.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
 gb|EKU21014.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
Length=712

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +ELK   + L K  K  L  + VD+V +S RLAD+PCV+VT +YGWSANMERIM++Q L 
Sbjct  543  EELKAKTEGLCKLMKEVL-DEKVDKVVVSPRLADSPCVLVTGEYGWSANMERIMKAQALR  601

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP+HPI+K LRE+   +  D++ K+   L+Y T+L+ SGF++ D
Sbjct  602  DSSTSAYMTSKKTMEINPKHPIVKALREKAEANQTDKTLKDLTWLLYDTSLLTSGFSLDD  661

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FASRI+  +K  L+I
Sbjct  662  PNTFASRIHRLIKLGLSI  679



>ref|XP_002021279.1| GL24896 [Drosophila persimilis]
 gb|EDW40435.1| GL24896 [Drosophila persimilis]
Length=362

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F+ L K  K  L S  V++V +SNRL D+PC +VTS++GWSANMERIM++Q 
Sbjct  190  KREEDKAKFEGLCKLMKSILDS-KVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQA  248

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D +   YM GK+ LEINP HPI++ LR++   D  D++ K+   L+++T+L+ SGF++
Sbjct  249  LRDTATMGYMAGKKQLEINPDHPIVEALRQKADADKNDKAVKDLVILLFETSLLSSGFSL  308

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  309  DSPQVHASRIYRMIKLGLGI  328



>ref|NP_999808.1| heat shock protein gp96 precursor [Strongylocentrotus purpuratus]
 gb|AAO21341.1| heat shock protein gp96 [Strongylocentrotus purpuratus]
Length=806

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            + +EL+  F+ L KW K A   D + + K+SNRL+D+PC +V S+YGWS NMERIM++Q 
Sbjct  609  RKEELEAKFEPLLKWLKDAALGDEIKDAKLSNRLSDSPCALVASQYGWSGNMERIMKAQA  668

Query  556  LSDASK---QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESG  386
             + A+    + Y   K+ LE+NPRHP+IK L E+V  D EDE+ K+ A ++++TA + SG
Sbjct  669  YAQANNPNTEYYASQKKTLEVNPRHPLIKTLLEKVEADAEDETAKDLAVVMFETATLRSG  728

Query  385  FNVPDPKDFASRIYNSVKSSLNISP  311
            F +PD   FA RI   +K S+N+ P
Sbjct  729  FALPDSAAFAGRIERMLKISMNLDP  753



>gb|KDQ60746.1| hypothetical protein JAAARDRAFT_172907 [Jaapia argillacea MUCL 
33604]
Length=703

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F DL    K AL  D V++V ISNR+AD+PCV+VT ++GWSANMERIM++Q L D+S  +
Sbjct  540  FNDLCSAVKEALG-DKVEKVVISNRIADSPCVLVTGQFGWSANMERIMKAQALRDSSMSS  598

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP++P+IKEL+++V +D  D+S ++   L+++TAL+ SGF + DP  FA 
Sbjct  599  YMASKKTLELNPKNPVIKELKKKVAEDRADKSVRDLTFLLFETALLTSGFTLDDPTSFAK  658

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  659  RIHRMIALGLDV  670



>emb|CDO69548.1| hypothetical protein BN946_scf184785.g53 [Trametes cinnabarina]
Length=698

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  536  FEDLCKAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  594

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  595  YMASKKTLELNPHNPIIKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  654

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  655  RIHRMIALGLDV  666



>gb|KIL68560.1| hypothetical protein M378DRAFT_184990 [Amanita muscaria Koide 
BX008]
Length=705

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            +F DL    K AL  D V++V ISNR+AD+PCV+VT ++GWS+NMERIM++Q L D S  
Sbjct  543  AFNDLCSVVKDALG-DKVEKVVISNRIADSPCVLVTGQFGWSSNMERIMKAQALRDTSMS  601

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            +YM  K+ LE+NP +PI+KEL+++V +D  D+S ++   L+Y TAL+ SGF + +P  FA
Sbjct  602  SYMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDLTYLLYDTALLTSGFALDEPTSFA  661

Query  355  SRIYNSVKSSLNI  317
             RIY  +   L++
Sbjct  662  KRIYRMISLGLDV  674



>ref|XP_011398501.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
 gb|KFM25605.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
Length=432

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K  E K +F+ L +  K  L  D V++V +  R+ D+PCV+VT +YGWSANMERIM++Q 
Sbjct  263  KDYETKAAFEPLCRLMKDVLG-DRVEKVVVGERIVDSPCVLVTGEYGWSANMERIMKAQA  321

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEIN  +P+I ELR R   D  D++ ++  QL+++TAL+ SGF++
Sbjct  322  LRDSSMAGYMSSKKTLEINAANPVIAELRTRAEADKGDKTVRDLVQLLFETALLASGFSL  381

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP  FASRI+  VK  L+I
Sbjct  382  DDPNTFASRIHRMVKLGLSI  401



>ref|XP_005843734.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
 gb|EFN51632.1| hypothetical protein CHLNCDRAFT_140066 [Chlorella variabilis]
Length=574

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = -1

Query  718  ESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASK  539
            E  K LT + K  L  D V++V +++RL D+P VVV SK+GWSANMERIM+SQ + DA  
Sbjct  406  EELKGLTAYMKKVLG-DKVEKVAVTSRLTDSPAVVVASKFGWSANMERIMRSQAMGDARS  464

Query  538  QAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDF  359
              YMRG+R++E+NP+HPII+ L+ +V  + E    KE  QL+Y+ AL+  GF +  PKDF
Sbjct  465  AEYMRGRRIMELNPQHPIIRTLKSKV--ELESREAKEQVQLLYEAALLAGGFMIESPKDF  522

Query  358  ASRIYN  341
            A+RIY+
Sbjct  523  AARIYS  528



>ref|XP_007863437.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58188.1| HSP90-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=701

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F DL    K AL  D V++V +SNR++D+PCV+VT ++GWSANMERIM++Q L D+S  +
Sbjct  539  FNDLCSAVKEALG-DKVEKVVVSNRISDSPCVLVTGQFGWSANMERIMKAQALRDSSMSS  597

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP++PIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  598  YMASKKTLELNPKNPIIKELKNKVAQDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  657

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  658  RIHRMIALGLDV  669



>gb|AAQ63041.1| heat shock protein HSP 90 alpha, partial [Platichthys flesus]
Length=207

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K  F++L K  K  L    V++V +SNRL  +PC +VTS YGW+ANMERIM++Q L 
Sbjct  36   EEKKSKFENLCKIMKDILEK-KVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALR  94

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D S   YM  K+ LEINP HPI++ LR++   D  D+S K+   L+++TAL+ SGF + D
Sbjct  95   DNSTMGYMAAKKHLEINPDHPIVETLRQKAEADKNDKSVKDLVILLFETALLSSGFTLDD  154

Query  370  PKDFASRIYNSVKSSLNI  317
            P+  ++RIY  +K  L I
Sbjct  155  PQTHSNRIYRMIKLGLGI  172



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = -1

Query  706  DLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYM  527
            DLTKWWK  +    +  VK+SNRLA TPCVVV+ KYG SANMERIM++Q  S  S  ++ 
Sbjct  646  DLTKWWKKVIEDSRLQTVKVSNRLATTPCVVVSGKYGQSANMERIMRAQAFS-RSAGSFT  704

Query  526  RGKRVLEINPRHPIIKELRERVV---KDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
             G+RVLEINPRHP+I  L++++    +D  DE+T  TA+++Y+TAL+ESGF   D K F+
Sbjct  705  PGQRVLEINPRHPLIVALKDKLAAASEDTVDETTVATARILYETALLESGFIPDDAKSFS  764

Query  355  SRIYNSVKSSLNI  317
             R+Y+ +K +L +
Sbjct  765  QRVYSVLKGNLGV  777



>dbj|BAF92789.1| cytosolic heat shock protein 90 alpha [Solea senegalensis]
Length=724

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KQEELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>ref|XP_001649751.1| AAEL014845-PA [Aedes aegypti]
 gb|EAT32918.1| AAEL014845-PA [Aedes aegypti]
Length=560

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  394  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  452

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++ +P   AS
Sbjct  453  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  512

Query  352  RIYNSVKSSLNI  317
            RIY  VK  L I
Sbjct  513  RIYRMVKLGLGI  524



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            SF++L K  K  L  D V++V +S+R+ D+PC +VT +YGWSANMERIM++Q L D+S  
Sbjct  191  SFENLCKVIKDVLG-DKVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMG  249

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ DP  FA
Sbjct  250  AYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLEDPNTFA  309

Query  355  SRIYNSVKSSLNI  317
            +RI+  +K  L+I
Sbjct  310  ARIHRMLKLGLSI  322



>ref|XP_010736427.1| PREDICTED: heat shock protein HSP 90-alpha isoform X3 [Larimichthys 
crocea]
 ref|XP_010736428.1| PREDICTED: heat shock protein HSP 90-alpha isoform X4 [Larimichthys 
crocea]
Length=727

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  555  KQEELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQA  613

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  614  LRDNSTMGYMTAKKHLEINPMHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  673

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  674  EDPQTHANRIYRMIKLGLGI  693



>gb|ACF95812.1| heat shock protein 90 [Amphidinium carterae]
Length=682

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E+K  F+ LTK  K  L  D V++V IS+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  511  KLEEMKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQA  569

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L++ TAL+ SGFN+
Sbjct  570  LRDSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVKDLIWLLFDTALLTSGFNL  629

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  630  DEPTQFAGRIHRMIKLGLSI  649



>gb|EXX78198.1| Hsp90 family chaperone HSC82 [Rhizophagus irregularis DAOM 197198w]
Length=359

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F DL K  K  L  D V++V +SNR++++PCV+VT +YGW+AN ERIM++Q L D+S  +
Sbjct  198  FDDLCKQIKEILG-DKVEKVLVSNRISESPCVLVTGQYGWAANFERIMKAQALRDSSMAS  256

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+++EINP HPI+K L+ +V  D  D++ K+   L+++T+L++SGF + +P  FA 
Sbjct  257  YMASKKIMEINPNHPIVKSLKSKVEADKNDKTVKDLTWLLFETSLLQSGFTLEEPSSFAG  316

Query  352  RIYNSVKSSLNIS  314
            RI+  +K  L+I 
Sbjct  317  RIFKMIKLGLDIG  329



>ref|XP_007361188.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF65926.1| HSP90-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=703

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  542  FEDLCKAVKDALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  600

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  601  YMASKKTLELNPHNPIVKELKRKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  660

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  661  RIHRMIALGLDV  672



>gb|ADO30471.1| heat shock protein 90 [Bactrocera dorsalis]
Length=516

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  344  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  402

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L+++TAL+ SGF++
Sbjct  403  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDLCILLFETALLSSGFSL  462

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  463  DSPQVHASRIYRMIKLGLGI  482



>gb|KIP09595.1| hypothetical protein PHLGIDRAFT_126182 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=697

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  537  FEDLCKAVKEALG-DKVEKVIVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  595

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PI+KEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  596  YMASKKTLELNPHNPIVKELKSKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  655

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  656  RIHRMIALGLDV  667



>gb|ADV03069.1| heat shock protein 90 [Amphidinium carterae]
Length=710

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 99/140 (71%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E+K  F+ LTK  K  L  D V++V IS+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  539  KLEEMKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQA  597

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L++ TAL+ SGFN+
Sbjct  598  LRDSSMTSYMVSKKTMEVNPKHSIMSELKKKASADKSDKTVKDLIWLLFDTALLTSGFNL  657

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  658  DEPTQFAGRIHRMIKLGLSI  677



>ref|XP_008551765.1| PREDICTED: heat shock protein 83 [Microplitis demolitor]
Length=723

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q 
Sbjct  552  KREEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+   L+++TAL+ SGF++
Sbjct  611  LRDTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDLVVLLFETALLSSGFSL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  DDPQVHAARIYRMIKLGLGI  690



>gb|KFB48798.1| heat shock protein 82 [Anopheles sinensis]
Length=717

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  538  KREEDKAKFENLCKVIKTVL-ENKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  596

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM GK+ LEINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++
Sbjct  597  LRDSSAMGYMAGKKHLEINPDHAIIETLRQRADADKNDKAVKDLVILLFETALLSSGFSL  656

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P   ASRIY  +K  L I
Sbjct  657  DEPGTHASRIYRMIKLGLGI  676



>ref|XP_308797.3| AGAP006961-PA [Anopheles gambiae str. PEST]
 gb|EAA45456.3| AGAP006961-PA [Anopheles gambiae str. PEST]
Length=369

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  664  VDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPI  485
            V++V +SNRL D+PC +VTS+YGWSANMERIM++Q L D+S   YM GK+ LEINP H I
Sbjct  212  VEKVMVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAI  271

Query  484  IKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  317
            I+ LR+R   D  D++ K+   L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  272  IETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  327



>sp|O61998.2|HSP90_BRUPA RecName: Full=Heat shock protein 90 [Brugia pahangi]
 emb|CAA06695.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>emb|CAY56585.1| putative heat shock protein 83 [Bactrocera oleae]
Length=666

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  502  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  560

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D +D++ K+   L+++TAL+ SGF++
Sbjct  561  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKDDKAVKDLCILLFETALLSSGFSL  620

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  621  DSPQVHASRIYRMIKLGLGI  640



>gb|EJW88125.1| heat shock protein 90 [Wuchereria bancrofti]
Length=717

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>ref|XP_006793113.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006793114.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Neolamprologus brichardi]
Length=724

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+DL K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KQEELKTKFEDLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTLGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>emb|CDP96098.1| Protein BM-DAF-21, isoform a [Brugia malayi]
Length=717

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>emb|CAA06694.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  550  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  608

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  609  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  668

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  669  RIYRMIKLGLDIT  681



>gb|ACO55133.1| heat shock protein 90 [Litomosoides sigmodontis]
Length=718

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  551  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  609

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  610  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLDDPQLHAS  669

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  670  RIYRMIKLGLDIT  682



>ref|XP_001901767.1| heat shock protein 90 [Brugia malayi]
Length=699

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  532  FENLCKVMKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  590

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  591  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLEDPQLHAS  650

Query  352  RIYNSVKSSLNIS  314
            RIY  +K  L+I+
Sbjct  651  RIYRMIKLGLDIT  663



>gb|AAW49252.2| heat shock protein 90 [Liriomyza huidobrensis]
Length=714

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  541  KREEDKAKFENLCKLIKSIL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKTQA  599

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D++   YM GK+ LEINP HPII+ LRE+   D  D++ K+   L+++T+L+ SGF++
Sbjct  600  LRDSNTMGYMSGKKHLEINPDHPIIETLREKSEADKNDKAVKDLVILLFETSLLSSGFSL  659

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  660  DSPQVHASRIYRMIKLGLGI  679



>gb|AAG22091.1|AF306643_1 90 kDa heat-shock protein [Scyliorhinus torazame]
Length=138

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            + DL K  K  L    V++V +SNRL  +PC +VTS YGW+ANMERIM++Q L D S   
Sbjct  5    YDDLCKLMKEIL-DKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMG  63

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPI+  LR++   D  D++ K+   L+++TAL+ SGF++ DP+  ++
Sbjct  64   YMMAKKHLEINPDHPIVDTLRQKADVDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSN  123

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L I
Sbjct  124  RIYRMIKLGLGI  135



>ref|XP_008297037.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Stegastes partitus]
Length=724

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K  ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KQDELKNKFENLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPMHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>gb|ABA28987.1| heat shock protein 90 3 [Symbiodinium sp. C3]
Length=441

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+ LTK  K  L  D V++V +S+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  288  KIEELKAEFEPLTKLMKEVLG-DKVEKVLVSSRMADSPCVLTTSEYGWSANMERIMKAQA  346

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L++ T+L+ SGFN+
Sbjct  347  LRDNSMTSYMVSKKTMEVNPKHSIMVELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNL  406

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  407  DEPTQFAGRIHRMIKLGLSI  426



>gb|AGT57167.1| heat shock protein 90-alpha 3 [Salmo salar]
Length=727

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  555  KQEELNSKFENLCKIMKDILDK-KIEKVSVSNRLVSSPCCIVTSNYGWTANMERIMKSQA  613

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TALM SGF +
Sbjct  614  LRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMSSGFTL  673

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  674  DDPQTHANRIYRMIKLGLGI  693



>gb|EMS22510.1| molecular chaperone HtpG [Rhodosporidium toruloides NP11]
 emb|CDR46785.1| RHTO0S13e01772g1_1 [Rhodosporidium toruloides]
Length=697

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DLT+  K  L  D V++V ISNR+AD+PC++VT ++GWSANMERIM++Q L DAS  +
Sbjct  535  FEDLTRTMKEVLG-DRVEKVTISNRIADSPCILVTGQFGWSANMERIMKAQALRDASMSS  593

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP + II+EL+ +V  D  D++ ++   L+Y+TAL+ SGF + +P  FA 
Sbjct  594  YMMSKKTLEINPNNAIIRELKNKVQADSADKAVRDLVVLLYETALLTSGFTLDEPHHFAE  653

Query  352  RIYNSVKSSLNI  317
            RI+  +   L+I
Sbjct  654  RIHAMISLGLSI  665



>gb|AEH27540.1| cytosolic heat shock protein 90-alpha [Lates calcarifer]
Length=724

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KQEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>gb|EMD38391.1| hypothetical protein CERSUDRAFT_153213 [Ceriporiopsis subvermispora 
B]
Length=698

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +P++KEL+++V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPVVKELKKKVAEDSADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  657  RIHRMIALGLDV  668



>emb|CAU15484.1| heat shock protein 90 [Meloidogyne artiellia]
Length=723

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+ L K  K  L    V +V ISNRL  +PC +VT +YGW+ANMERIM++Q L D+S   
Sbjct  557  FEKLCKVIKDIL-DKKVQKVSISNRLVSSPCCIVTGEYGWTANMERIMKAQALRDSSTMG  615

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H IIK LRERV  D +D++ K+   L+Y+TAL+ SGF++ DP+  AS
Sbjct  616  YMASKKNLEINPDHSIIKSLRERVDSDQDDKTAKDLVVLLYETALLTSGFSLEDPQQHAS  675

Query  352  RIYNSVKSSLNIS  314
            RIY  VK  L+I+
Sbjct  676  RIYRMVKLGLDIT  688



>emb|CDQ81678.1| unnamed protein product [Oncorhynchus mykiss]
Length=725

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  553  KQEELNSKFENLCKIMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  611

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TALM SGF +
Sbjct  612  LRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALMSSGFTL  671

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  672  DDPQTHANRIYRMIKLGLGI  691



>gb|ACO57617.1| heat shock protein 90 [Pteromalus puparum]
Length=715

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L S  V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  552  FENLCKVMKNILDS-KVEKVLVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  610

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HP+I  LRE+   D  D+S K+   L+++TAL+ SGF++ +P+  A+
Sbjct  611  YMAAKKHLEINPDHPVINTLREKAEADKNDKSVKDLVVLLFETALLSSGFSLDEPQVHAA  670

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L I
Sbjct  671  RIYRMIKLGLGI  682



>ref|XP_005805663.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X2 
[Xiphophorus maculatus]
Length=676

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  504  KHEELKNKFENLCKIMKDILDK-KIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQA  562

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  563  LRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  622

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  623  EDPQTHANRIYRMIKLGLGI  642



>gb|KIO34802.1| hypothetical protein M407DRAFT_90187 [Tulasnella calospora MUT 
4182]
Length=697

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKTIKDALG-DKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PI+KEL+++V +D  D+S ++   L+++TAL+ SGF + DP  FA 
Sbjct  597  YMASKKTLELNPHNPIVKELKKKVAEDKADKSVRDLTFLLFETALLTSGFVLDDPTSFAK  656

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  657  RIHRMISLGLDV  668



>ref|NP_001274755.1| heat shock protein 83-like [Ceratitis capitata]
 emb|CAJ28987.1| heat shock protein 83 [Ceratitis capitata]
Length=715

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  543  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF++
Sbjct  602  LRDTSTMGYMAGKKHLEINPEHPIIETLREKADVDKNDKAVKDLCILLFETALLSSGFSL  661

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  662  DSPQVHASRIYRMIKLGLGI  681



>ref|XP_009542788.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW85997.1| hypothetical protein HETIRDRAFT_311260 [Heterobasidion irregulare 
TC 32-1]
Length=701

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  + V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  540  FEDLCKVIKDALG-EKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  598

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP HPIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ +P  FA 
Sbjct  599  YMASKKTLELNPTHPIIKELKRKVSEDKADKSVRDLTYLLFETALLTSGFSLEEPTSFAK  658

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  659  RIHRMISLGLDV  670



>ref|XP_007577310.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Poecilia formosa]
Length=724

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KHEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>ref|XP_005805662.1| PREDICTED: heat shock protein HSP 90-alpha 1-like isoform X1 
[Xiphophorus maculatus]
Length=724

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KHEELKNKFENLCKIMKDIL-DKKIEKVVVSNRLVASPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPII+ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPLHPIIETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>gb|ABI14419.1| heat shock protein 90 [Karlodinium veneficum]
Length=709

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+ LTK  K  L  D V++V IS+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  538  KIEELKAEFEPLTKLMKEVLG-DKVEKVLISSRMADSPCVLTTSEYGWSANMERIMKAQA  596

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S  +YM  K+ +E+NP+H I+ EL+++   D  D++ K+   L++ T+L+ SGFN+
Sbjct  597  LRDNSMTSYMVSKKTMEVNPKHSIMTELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNL  656

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  657  DEPTQFAGRIHRMIKLGLSI  676



>ref|XP_011182023.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83 [Bactrocera 
cucurbitae]
Length=715

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  543  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L+++TAL+ SGF++
Sbjct  602  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDLCILLFETALLSSGFSL  661

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  662  DSPQVHASRIYRMIKLGLGI  681



>ref|XP_008045254.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
 gb|EIW51690.1| heat shock protein 90 [Trametes versicolor FP-101664 SS1]
Length=700

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEALG-DKVEKVVVSNRITDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +P+IKEL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPVIKELKRKVSEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  657  RIHRMIALGLDV  668



>ref|XP_011203601.1| PREDICTED: heat shock protein 83 [Bactrocera dorsalis]
Length=715

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  543  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L+++TAL+ SGF++
Sbjct  602  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDLCILLFETALLSSGFSL  661

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  662  DSPQVHASRIYRMIKLGLGI  681



>gb|EAY92778.1| hypothetical protein OsI_14582 [Oryza sativa Indica Group]
Length=703

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = -1

Query  733  AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTL  554
            AKE K SF+ L K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L
Sbjct  535  AKERKRSFEPLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQAL  593

Query  553  SDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVP  374
             D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L+++TAL+ SGF++ 
Sbjct  594  RDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLD  653

Query  373  DPKDFASRIYNSVKSSLNI  317
            DP  FA+RI+  +K  LNI
Sbjct  654  DPNTFAARIHRMLKLGLNI  672



>ref|XP_003424204.1| PREDICTED: heat shock protein 83 [Nasonia vitripennis]
Length=723

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L  + V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  560  FENLCKVMKNIL-DNKVEKVLVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  618

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HP+I  LRE+   D  D+S K+   L+++TAL+ SGF++ +P+  A+
Sbjct  619  YMAAKKHLEINPDHPVIDTLREKAEADKNDKSVKDLVVLLFETALLSSGFSLDEPQVHAA  678

Query  352  RIYNSVKSSLNI  317
            RIY  VK  L I
Sbjct  679  RIYRMVKLGLGI  690



>gb|KIP08934.1| hypothetical protein PHLGIDRAFT_103566 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=698

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V +SNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  538  FEDLCKAVKEALG-DKVEKVVVSNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  596

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PI++EL+ +V +D  D+S ++   L+++TAL+ SGF++ DP  FA 
Sbjct  597  YMASKKTLELNPHNPIVRELKSKVAEDKADKSVRDLTYLLFETALLTSGFSLDDPTSFAK  656

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  657  RIHRMIALGLDV  668



>gb|AGU42458.1| heat shock protein 90 [Bactrocera correcta]
Length=715

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  543  KREEDKAKFENLCKLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L+++TAL+ SGF++
Sbjct  602  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKNDKAVKDLCILLFETALLSSGFSL  661

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  662  DSPQVHASRIYRMIKLGLGI  681



>gb|AAN39696.1| heat shock protein [Choristoneura parallela]
Length=171

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K  F+ L K  K  L  + V++V +SNRL ++PC +VT++YGWSANMERIM++Q L 
Sbjct  2    EEDKVKFEGLCKVMKNIL-DNKVEKVVVSNRLVESPCCIVTAQYGWSANMERIMKAQALR  60

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D S   YM  K+ LEINP H I++ LR++   D  D++ K+   L+Y+TAL+ SGF + +
Sbjct  61   DTSTMGYMAAKKHLEINPDHSIVETLRQKADADKNDKAVKDLVILLYETALLSSGFALDE  120

Query  370  PKDFASRIYNSVKSSLNI  317
            P+  ASRIY  +K  L I
Sbjct  121  PQVHASRIYRMIKLGLGI  138



>emb|CAE02770.2| OSJNBb0085F13.17 [Oryza sativa Japonica Group]
 emb|CAD39419.2| OSJNBa0027H06.1 [Oryza sativa Japonica Group]
Length=703

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = -1

Query  733  AKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTL  554
            AKE K SF+ L K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L
Sbjct  535  AKERKRSFEPLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQAL  593

Query  553  SDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVP  374
             D+S  AYM  K+ +EINP + I++ELR+R   D  D+S ++   L+++TAL+ SGF++ 
Sbjct  594  RDSSMGAYMSSKKTMEINPENGIMEELRKRADADANDKSVRDLVLLLFETALLTSGFSLD  653

Query  373  DPKDFASRIYNSVKSSLNI  317
            DP  FA+RI+  +K  LNI
Sbjct  654  DPNTFAARIHRMLKLGLNI  672



>ref|XP_011345590.1| PREDICTED: heat shock protein 83 [Cerapachys biroi]
 gb|EZA50089.1| Heat shock protein HSP 90-alpha [Cerapachys biroi]
Length=722

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L    V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q 
Sbjct  550  KREEDKTKFENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQA  608

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LR++V  D  D+S K+   L+++TAL+ SGF +
Sbjct  609  LRDTSTMGYMAAKKHLEINPDHPIMENLRQKVEADKHDKSVKDLVMLLFETALLSSGFVL  668

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L  
Sbjct  669  EDPQVHASRIYRMIKLGLGF  688



>gb|ACO55134.1| heat shock protein 90 [Ascaris suum]
Length=721

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            +++L K  K  L   NV++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  554  YENLCKVIKDILEK-NVEKVVVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMG  612

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF++ DP+  AS
Sbjct  613  YMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLDDPQLHAS  672

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L+I
Sbjct  673  RIYRMIKLGLDI  684



>ref|XP_010788727.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Notothenia coriiceps]
Length=721

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+++ K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  549  KQEELKNKFENICKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  607

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+Y+T+L+ SGF +
Sbjct  608  LRDNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLYETSLLSSGFTL  667

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  668  EDPQTHANRIYRMIKLGLGI  687



>ref|XP_007300418.1| HSP90-domain-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM89924.1| HSP90-domain-containing protein [Stereum hirsutum FP-91666 SS1]
Length=665

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            ++DL K  K AL  + V++V +SNR+AD+PCV+VT ++GWS+NMERIM++Q L D S  +
Sbjct  540  YEDLCKVIKEALG-EKVEKVVVSNRIADSPCVLVTGQFGWSSNMERIMKAQALRDTSMSS  598

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP+HPIIKEL+ +V +D  D+S ++   L+++TAL+ SGF++ +P  FA 
Sbjct  599  YMASKKTLELNPKHPIIKELKRKVTEDKADKSVRDLTYLLFETALLTSGFSLEEPTSFAK  658

Query  352  RIYNSV  335
            RI+  +
Sbjct  659  RIHRMI  664



>ref|XP_002998541.1| heat shock protein 90 [Phytophthora infestans T30-4]
 gb|EEY69894.1| heat shock protein 90 [Phytophthora infestans T30-4]
Length=706

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +YGWSANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L+Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMSSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>gb|ABV55506.1| heat shock protein 90 [Microplitis mediator]
Length=723

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F++L K  K  L S  V++V +SNRL D+PC +VTS++GW+ANMERIM++Q 
Sbjct  552  KREEDKAKFEELCKVMKTILDS-KVEKVVVSNRLVDSPCCIVTSQFGWTANMERIMKAQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HP+I+ LR++   D  D+S K+   L+++TAL+ SGF++
Sbjct  611  LRDTSTMGYMAAKKHLEINPDHPVIENLRQKAEADKNDKSVKDLVVLLFETALLSSGFSL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  DDPQVHAARIYRMIKLGLGI  690



>gb|AER28025.1| heat shock protein 83S2 [Stratiomys singularior]
Length=719

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  F+ L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  546  KREEDKAKFEGLCKVMKSIL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  604

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP HPII+ LR++   D  D+S K+   L+++T+L+ SGF++
Sbjct  605  LRDSSTMGYMTSKKHLEINPDHPIIENLRQKTEADKNDKSVKDLVILLFETSLLSSGFSL  664

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRI+  +K  L I
Sbjct  665  DDPQVHASRIHRMIKLGLGI  684



>gb|EPY32689.1| heat shock protein 83-1 [Strigomonas culicis]
Length=272

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            SF+ L K  K  L  D V++V++S RLA +PC++VTS++GWSA+ME+IM++Q L D+S  
Sbjct  108  SFEKLCKLIKDILG-DKVEKVQLSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMA  166

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
             YM  K+ +E+NP H I+KEL+ RV  D  D++ K+   L++ T+L+ SGFN+ DP  +A
Sbjct  167  TYMMSKKTMEVNPHHVIVKELKRRVDSDENDKAIKDLVFLLFDTSLLTSGFNLEDPTAYA  226

Query  355  SRIYNSVKSSLNI  317
             RI++ +K  L++
Sbjct  227  ERIHHMIKLGLSL  239



>gb|ETK95017.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETL48421.1| heat shock protein 90-2 [Phytophthora parasitica]
Length=706

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +YGWSANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L+Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>ref|XP_008915791.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETI55191.1| heat shock protein 90-2 [Phytophthora parasitica P1569]
 gb|ETM01491.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM54696.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM98910.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETO83922.1| heat shock protein 90-2 [Phytophthora parasitica P1976]
 gb|ETP24998.1| heat shock protein 90-2 [Phytophthora parasitica CJ01A1]
 gb|ETP52997.1| heat shock protein 90-2 [Phytophthora parasitica P10297]
Length=706

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +YGWSANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L+Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>ref|XP_009534751.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
 gb|EGZ09890.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
Length=706

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K + + L K  K  L  D V++V+ISNR+ ++PCV+VT +YGWSANMERIM++Q L 
Sbjct  539  EEAKAATEGLCKLMKEVL-DDKVEKVEISNRIVESPCVLVTGEYGWSANMERIMKAQALR  597

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP HPIIK LRE+   D  D++ K+   L+Y T+L+ SGF++ +
Sbjct  598  DSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKSDKTVKDLIWLLYDTSLLTSGFSLDE  657

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  L+I
Sbjct  658  PTTFANRIHRLIKLGLSI  675



>gb|KIJ44391.1| hypothetical protein M422DRAFT_228502 [Sphaerobolus stellatus 
SS14]
Length=700

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E+KE ++DL K  K +L  D V++V +SNR+ D+PCV+VT ++GWSANMERIM++Q L 
Sbjct  533  QEIKE-YEDLCKVIKESLG-DKVEKVVVSNRITDSPCVLVTGQFGWSANMERIMKAQALR  590

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  +YM  K+ LE+NP +PI+KEL+ +V  DP D++ ++   L+++TAL+ SGF + +
Sbjct  591  DSSMSSYMASKKTLELNPHNPIVKELKRKVASDPADKAVRDLTYLLFETALLTSGFVLDE  650

Query  370  PKDFASRIYNSVKSSLNI  317
            P +FA RI+  +   L++
Sbjct  651  PINFAKRIHRMISLGLDV  668



>ref|NP_001278186.1| heat shock protein HSP 90-alpha 1-like [Astyanax mexicanus]
 gb|AAO52675.1| heat shock protein 90 alpha [Astyanax mexicanus]
Length=723

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K  ELK  F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  551  KQDELKTKFENLCKIMKDIL-DKKIEKVTVSNRLVASPCCIVTSTYGWTANMERIMKSQA  609

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  610  LRDNSTMGYMTAKKHLEINPLHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  669

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  670  EDPQTHANRIYRMIKLGLGI  689



>ref|XP_008311364.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Cynoglossus semilaevis]
Length=724

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+DL K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  552  KQEELKNKFEDLCKIMKDIL-DKKIEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  610

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LR +   D  D++ K+   L+++TAL+ SGF +
Sbjct  611  LRDNSTMGYMTAKKHLEINPMHPIVETLRVKAEVDKNDKAVKDLVILLFETALLSSGFTL  670

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  671  EDPQTHANRIYRMIKLGLGI  690



>emb|CCA68353.1| related to HSP80 heat shock protein 80 [Piriformospora indica 
DSM 11827]
Length=702

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+DL K  K AL  D V++V ISNR++D+PCV+VT ++GWS+NMERIM++Q L D+S  +
Sbjct  541  FEDLCKTVKDALG-DKVEKVVISNRISDSPCVLVTGQFGWSSNMERIMKAQALRDSSMSS  599

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PIIKEL+++V +D  D+S ++   L+++TAL+ SGF + +P  FA 
Sbjct  600  YMASKKTLELNPHNPIIKELKKKVAEDKADKSVRDLTYLLFETALLVSGFVLEEPTGFAK  659

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  660  RIHRMISLGLDV  671



>gb|EYD92886.1| hsp90 family protein, partial [Escherichia coli 1-176-05_S1_C1]
Length=294

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 98/143 (69%), Gaps = 6/143 (4%)
 Frame = -1

Query  727  ELKESFKDLTKWWK------GALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQ  566
            E KE+F+ L K ++        +  D VD+V  S R++D+PCV+VTS+YGWSANMERIM+
Sbjct  123  EEKEAFEALQKEYEPLCQLIKEVLHDKVDKVITSQRISDSPCVLVTSEYGWSANMERIMK  182

Query  565  SQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESG  386
            +Q L D S  +YM  K+ +EINP +PI+ EL+ ++V D  D++ K+   L+Y+T+L+ SG
Sbjct  183  AQALRDTSMTSYMMSKKTMEINPYNPIMTELKNKIVNDKSDKTVKDLIWLLYETSLLTSG  242

Query  385  FNVPDPKDFASRIYNSVKSSLNI  317
            F++ DP  F+SRI   +K  L+I
Sbjct  243  FSLEDPTQFSSRINRMIKLGLSI  265



>gb|EKF32566.1| heat shock protein 85, putative, partial [Trypanosoma cruzi marinkellei]
Length=323

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            +++ L K  K  L  D V++V +S RLA +PC++VTS++GWSA+ME+IM++Q L D+S  
Sbjct  161  AYERLCKAMKDVLG-DKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMS  219

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            AYM  K+ +EINP HPI+KEL+ RV  D  D++ K+   L++ TAL+ SGF + DP  +A
Sbjct  220  AYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLDDPTSYA  279

Query  355  SRIYNSVKSSLNI  317
             RI+  +K  L++
Sbjct  280  ERIHRMIKLGLSL  292


 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = -1

Query  715  SFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQ  536
            +++ L K  K  L  D V++V +S RLA +PC++VTS++GWSA+ME+IM++Q L D+S  
Sbjct  17   AYERLCKAMKDVLG-DKVEKVVVSERLATSPCILVTSEFGWSAHMEQIMRNQALRDSSMS  75

Query  535  AYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFA  356
            AYM  K+ +EINP HPI+KEL+ RV  D  D++ K+   L++ TAL+ SGF + DP  +A
Sbjct  76   AYMMSKKTMEINPAHPIVKELKRRVEADENDKAVKDLVYLLFDTALLTSGFTLDDPTSYA  135

Query  355  SRIYNSVK  332
             RI+  +K
Sbjct  136  ERIHRMIK  143



>ref|XP_005911315.1| PREDICTED: heat shock protein HSP 90-alpha-like, partial [Bos 
mutus]
Length=164

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -1

Query  709  KDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAY  530
            ++L K  K  L    V++V +SNRL  +PC +VTS YGW+ANMERIM++Q L D SK  Y
Sbjct  1    ENLCKIMKDILEK-KVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSKMGY  59

Query  529  MRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASR  350
            M  K+ LEINP H II+ LR++   D  D+S K+   L+Y TAL+ SGF++ DP+  A+R
Sbjct  60   MAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYDTALLSSGFSLEDPQTHANR  119

Query  349  IYNSVKSSLNI  317
            IY  +K  L I
Sbjct  120  IYRMIKLGLGI  130



>gb|AIA62362.1| hsp90, partial [Bactrocera minax]
Length=455

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E +  F++L +  K  L  + V++V +SNRL ++PC +VTS++GWSANMERIM++Q 
Sbjct  283  KREEDRAKFENLCRLMKSIL-DNKVEKVVVSNRLVESPCCIVTSQFGWSANMERIMKAQA  341

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM GK+ LEINP HPII+ LR++   D  D++ K+   L+++TAL+ SGF++
Sbjct  342  LRDTSTMGYMAGKKHLEINPEHPIIETLRQKADADKNDKAVKDLCILLFETALLSSGFSL  401

Query  376  PDPKDFASRIYNSVKSSLNI  317
              P+  ASRIY  +K  L I
Sbjct  402  DSPQVHASRIYRMIKLGLGI  421



>ref|XP_001649752.1| AAEL014843-PA [Aedes aegypti]
 ref|XP_001655642.1| AAEL011704-PA [Aedes aegypti]
 gb|EAT32919.1| AAEL014843-PA [Aedes aegypti]
 gb|EAT36187.1| AAEL011704-PA [Aedes aegypti]
Length=715

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  549  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  607

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++ +P   AS
Sbjct  608  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  667

Query  352  RIYNSVKSSLNI  317
            RIY  VK  L I
Sbjct  668  RIYRMVKLGLGI  679



>gb|ADD10372.1| heat shock protein 90 [Meloidogyne incognita]
Length=708

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+ L K  K  L    V +V +SNRL  +PC +VT +YGW+ANMERIM++Q L D+S   
Sbjct  542  FEKLCKVIKDIL-DKKVQKVSVSNRLVSSPCCIVTGEYGWTANMERIMKAQALRDSSTMG  600

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP H IIK LRER+  D +D++ K+   L+Y+TAL+ SGF++ DP+  AS
Sbjct  601  YMASKKNLEINPDHSIIKSLRERIDSDQDDKTAKDLVVLLYETALLTSGFSLEDPQQHAS  660

Query  352  RIYNSVKSSLNIS  314
            RIY  VK  L+I+
Sbjct  661  RIYRMVKLGLDIT  673



>gb|AEF33377.1| heat shock protein 90, partial [Crassostrea ariakensis]
Length=169

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  727  ELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSD  548
            E K  ++ L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q L D
Sbjct  1    EQKAEYEGLCKVMKDIL-DKKVEKVVVSNRLVTSPCCIVTSQYGWSANMERIMKAQALRD  59

Query  547  ASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDP  368
            +S   YM  K+ LEINP H IIK L+E+   D  D+S K+   L+++T+L+ SGF++ +P
Sbjct  60   SSTMGYMAAKKHLEINPDHSIIKSLKEKAEADKNDKSVKDLVMLLFETSLLASGFSLEEP  119

Query  367  KDFASRIYNSVKSSLNI  317
               ASRI+  +K  L I
Sbjct  120  GTHASRIHRMIKLGLGI  136



>ref|XP_002165028.1| PREDICTED: heat shock protein HSP 90-alpha 1-like [Hydra vulgaris]
Length=722

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK SF++L K  K  L    V++V +SNRL D+PC +VTS YGWSANMERIM++Q 
Sbjct  549  KQEELKASFEELCKVIKDIL-DKRVEKVTVSNRLVDSPCCIVTSTYGWSANMERIMKAQA  607

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP H I+  L+++V  D  D+S K+   L+Y+T+L+ SGF++
Sbjct  608  LRDTSTMGYMAAKKHLEINPEHSIMVALKKKVDADKNDKSIKDLIVLLYETSLLSSGFSL  667

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP++ A+RI+  VK  L +
Sbjct  668  EDPQNHAARIHRMVKLGLGV  687



>ref|XP_001655641.1| AAEL011708-PA [Aedes aegypti]
 gb|EAT36186.1| AAEL011708-PA [Aedes aegypti]
Length=715

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q L D+S   
Sbjct  549  FENLCKVMKSVL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMG  607

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM GK+ +EINP H II+ LR+R   D  D++ K+   L+++TAL+ SGF++ +P   AS
Sbjct  608  YMAGKKHMEINPDHSIIETLRQRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGVHAS  667

Query  352  RIYNSVKSSLNI  317
            RIY  VK  L I
Sbjct  668  RIYRMVKLGLGI  679



>ref|XP_002447413.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
 gb|EES11741.1| hypothetical protein SORBIDRAFT_06g000660 [Sorghum bicolor]
Length=716

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K+ F+DL K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L 
Sbjct  551  EERKKQFEDLCKVIKDILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  609

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ D
Sbjct  610  DSSMSAYMSSKKTMEINPDNGIMEELRKRAEADRNDKSVKDLVLLLFETALLTSGFSLDD  669

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  LNI
Sbjct  670  PNTFAARIHRMLKLGLNI  687



>gb|AAM02974.1|AF421541_1 Hsp90 [Crypthecodinium cohnii]
Length=711

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 98/140 (70%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +ELK  F+ LTK  K  L  D V++V +S+R+AD+PCV+ TS+YGWSANMERIM++Q 
Sbjct  540  KLEELKAEFEPLTKLMKEVLG-DKVEKVLVSSRMADSPCVLTTSEYGWSANMERIMKAQA  598

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            + D S  +YM  K+ +EINP+H I+ EL+++   D  D++ K+   L++ T+L+ SGFN+
Sbjct  599  MRDNSMTSYMVSKKTMEINPKHSIMSELKKKAAADKSDKTVKDLIWLLFDTSLLTSGFNL  658

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P  FA RI+  +K  L+I
Sbjct  659  DEPTQFAGRIHRMIKLGLSI  678



>ref|XP_004974995.1| PREDICTED: heat shock protein 82-like [Setaria italica]
Length=709

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +E K+ F+DL K  K  L  D V++V +S+R+ D+PC +VT +YGW+ANMERIM++Q L 
Sbjct  544  EERKKQFEDLCKVIKEILG-DRVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALR  602

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D+S  AYM  K+ +EINP + I++ELR+R   D  D+S K+   L+++TAL+ SGF++ D
Sbjct  603  DSSMSAYMASKKTMEINPDNGIMEELRKRAEADRNDKSVKDLVMLLFETALLTSGFSLDD  662

Query  370  PKDFASRIYNSVKSSLNI  317
            P  FA+RI+  +K  LNI
Sbjct  663  PNTFAARIHRMLKLGLNI  680



>dbj|BAH71458.1| ACYPI002010 [Acyrthosiphon pisum]
Length=250

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+ L K  K  L    V++V ISNRL ++PC +VTS+YGW+ANMERIM++Q L D+S   
Sbjct  85   FEKLCKVVKDIL-DKKVEKVVISNRLVESPCCIVTSQYGWTANMERIMKAQALRDSSTMG  143

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPII+ LR++   D  D++ ++   L+++T+L+ SGF + DP+  AS
Sbjct  144  YMSAKKHLEINPDHPIIETLRQKAEADSNDKAVRDLVMLLFETSLLSSGFGLEDPQVHAS  203

Query  352  RIYNSVKSSLNI  317
            RI+  +K  L I
Sbjct  204  RIHRMIKLGLGI  215



>gb|AAB49983.1| heat shock protein hsp90 [Oncorhynchus tshawytscha]
Length=726

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  554  KQEELNTKFENLCKTMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  612

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  613  LRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  672

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  673  DDPQTHANRIYRMIKLGLGI  692



>emb|CDQ59969.1| unnamed protein product [Oncorhynchus mykiss]
Length=718

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  546  KQEELNTKFENLCKTMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  604

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  605  LRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  664

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  665  DDPQTHANRIYRMIKLGLGI  684



>gb|AER28024.1| heat shock protein 83S1 [Stratiomys singularior]
Length=719

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K   + L K  K  L  + V++V +SNRL D+PC +VTS+YGWSANMERIM++Q 
Sbjct  546  KREEDKAKLEGLCKVMKSIL-DNKVEKVVVSNRLVDSPCCIVTSQYGWSANMERIMKAQA  604

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP HPII+ LR++   D  D+S K+   L+++T+L+ SGF++
Sbjct  605  LRDSSTMGYMTSKKHLEINPDHPIIENLRQKTEADKNDKSVKDLVILLFETSLLSSGFSL  664

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L I
Sbjct  665  DDPQVHASRIYRMIKLGLGI  684



>gb|AIU38246.1| heat shock protein 90 [Anisakis brevispiculata]
Length=721

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  546  KFEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQA  604

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  605  LRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFTL  664

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L+I
Sbjct  665  DDPQLHASRIYRMIKLGLDI  684



>ref|XP_003074078.1| heat shock protein 90C (ISS) [Ostreococcus tauri]
Length=679

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = -1

Query  730  KELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLS  551
            +EL++ FKDLT W K  L +  V++V +SNRL DTPCV+VTSK+GWSANMERIM++Q + 
Sbjct  530  EELEKEFKDLTDWMKETLGT-QVEKVTVSNRLTDTPCVLVTSKFGWSANMERIMKAQAMG  588

Query  550  DASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPD  371
            D     YM+GK+ +EINP  P+I +LR+  +K+   +   ++ QL++ TAL+ SGF++  
Sbjct  589  DNRASDYMKGKKTMEINPSSPVIAQLRK--LKEAGSKEATDSCQLLFDTALLTSGFSIDK  646

Query  370  PKDFASRIY  344
            P  FASR++
Sbjct  647  PSVFASRVF  655



>gb|AGT57168.1| heat shock protein 90-alpha 4 [Salmo salar]
Length=727

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 92/140 (66%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +EL   F++L K  K  L    +++V +SNRL  +PC +VTS YGW+ANMERIM+SQ 
Sbjct  555  KQEELNTKFENLCKTMKDILDK-KIEKVSVSNRLVSSPCCIVTSTYGWTANMERIMKSQA  613

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D S   YM  K+ LEINP HPI++ LRE+   D  D++ K+   L+++TAL+ SGF +
Sbjct  614  LRDNSTMGYMTAKKHLEINPTHPIVETLREKAEADKNDKAVKDLVILLFETALLSSGFTL  673

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  A+RIY  +K  L I
Sbjct  674  DDPQTHANRIYRMIKLGLGI  693



>gb|AIU38242.1| heat shock protein 90 [Anisakis pegreffii]
Length=718

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  543  KYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQA  601

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  602  LRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFTL  661

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L+I
Sbjct  662  DDPQLHASRIYRMIKLGLDI  681



>gb|EJU00792.1| heat shock protein 90 [Dacryopinax sp. DJM-731 SS1]
Length=695

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F DL K  K AL  D V++V +SNR+ D+PCV+VT ++GWS+NMERIM++Q L DAS  +
Sbjct  534  FDDLCKSIKEALG-DKVEKVVVSNRIVDSPCVLVTGQFGWSSNMERIMKAQALRDASMSS  592

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LE+NP +PIIKEL+ +V  D  D++ ++   L+Y+TAL+ SGF + +P  FA 
Sbjct  593  YMASKKTLELNPHNPIIKELKTKVAADKNDKTVRDLTYLLYETALLTSGFVLDEPSSFAK  652

Query  352  RIYNSVKSSLNI  317
            RI+  +   L++
Sbjct  653  RIHRMISLGLDV  664



>gb|AIU38245.1| heat shock protein 90 [Anisakis physeteris]
Length=720

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  545  KFEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQA  603

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  604  LRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFTL  663

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L+I
Sbjct  664  DDPQLHASRIYRMIKLGLDI  683



>ref|XP_003396897.1| PREDICTED: heat shock protein 83-like [Bombus terrestris]
 ref|XP_003486638.1| PREDICTED: heat shock protein 83-like [Bombus impatiens]
Length=725

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  561  FENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  619

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L+++TAL+ SGF + DP+  AS
Sbjct  620  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  679

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L  
Sbjct  680  RIYRMIKLGLGF  691



>gb|AIU38244.1| heat shock protein 90 [Anisakis paggiae]
Length=720

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  545  KYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQA  603

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  604  LRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFTL  663

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L+I
Sbjct  664  DDPQLHASRIYRMIKLGLDI  683



>gb|KFD54842.1| hypothetical protein M513_04276 [Trichuris suis]
 gb|KFD71713.1| hypothetical protein M514_04276 [Trichuris suis]
 gb|KHJ45962.1| Hsp90 protein [Trichuris suis]
Length=726

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L  + V++V +SNRL ++PC +VT +YGWSANMERIM++Q 
Sbjct  553  KREEDKAKYEELCKVIKDIL-DNKVEKVTVSNRLVNSPCCIVTGQYGWSANMERIMKAQA  611

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP +PII ELRER+ +D  D++ K+   L+++T+L+ SGF++
Sbjct  612  LRDSSTMGYMSAKKHLEINPDNPIIGELRERIARDKNDKTVKDLVILLFETSLLSSGFSL  671

Query  376  PDPKDFASRIYNSVKSSLNI  317
             +P+  A RIY  VK  L I
Sbjct  672  EEPQIHAQRIYRMVKLGLGI  691



>ref|XP_006619000.1| PREDICTED: heat shock protein HSP 90-alpha-like [Apis dorsata]
Length=724

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F++L K  K  L    V++V +SNRL D+PC +VTS+YGW+ANMERIM++Q L DAS   
Sbjct  560  FENLCKVMKDIL-DKKVEKVVVSNRLVDSPCCIVTSQYGWTANMERIMKAQALRDASTMG  618

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPI++ LR++   D  D+S K+   L+++TAL+ SGF + DP+  AS
Sbjct  619  YMAAKKHLEINPDHPIMENLRQKAEADKHDKSVKDLVMLLFETALLSSGFALEDPQVHAS  678

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L  
Sbjct  679  RIYRMIKLGLGF  690



>gb|AIU38243.1| heat shock protein 90 [Anisakis typica]
Length=720

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -1

Query  736  KAKELKESFKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQT  557
            K +E K  +++L K  K  L    V++V +SNRL  +PC +VTS+YGWSANMERIM++Q 
Sbjct  545  KYEEDKVKYENLCKVIKDILEK-KVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQA  603

Query  556  LSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNV  377
            L D+S   YM  K+ LEINP H +IK LRERV  D  D++ K+   L+++TAL+ SGF +
Sbjct  604  LRDSSTMGYMAAKKHLEINPDHSVIKALRERVEADKNDKTVKDLVVLLFETALLSSGFTL  663

Query  376  PDPKDFASRIYNSVKSSLNI  317
             DP+  ASRIY  +K  L+I
Sbjct  664  DDPQLHASRIYRMIKLGLDI  683



>gb|ADM83426.1| heat shock protein 90 [Panonychus citri]
Length=730

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = -1

Query  712  FKDLTKWWKGALASDNVDEVKISNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQA  533
            F+ L K  K  L    V++V ISNRL  +PC +VTS+YGWSANMERIM++Q L D +   
Sbjct  564  FETLCKVMKDVLEK-RVEKVTISNRLVTSPCCIVTSQYGWSANMERIMKAQALRDTTTMG  622

Query  532  YMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFAS  353
            YM  K+ LEINP HPI++ LR+R+  D  D++ K+   L+++TAL+ SGF++ DP++ +S
Sbjct  623  YMAAKKHLEINPDHPIVENLRQRIEADKSDKAVKDLVMLLFETALLCSGFSLEDPQNHSS  682

Query  352  RIYNSVKSSLNI  317
            RIY  +K  L I
Sbjct  683  RIYRMIKLGLGI  694



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500