BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002H10

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG28215.1|  hypothetical protein F383_15738                         324   2e-104   Gossypium arboreum [tree cotton]
ref|XP_006365098.1|  PREDICTED: BTB/POZ domain-containing protein...    323   3e-104   Solanum tuberosum [potatoes]
gb|KDO49087.1|  hypothetical protein CISIN_1g012309mg                   322   4e-104   Citrus sinensis [apfelsine]
ref|XP_006423255.1|  hypothetical protein CICLE_v10028323mg             322   6e-104   Citrus clementina [clementine]
ref|XP_011088392.1|  PREDICTED: BTB/POZ domain-containing protein...    322   8e-104   Sesamum indicum [beniseed]
ref|XP_007042203.1|  BTB/POZ domain-containing protein isoform 1        322   1e-103   Theobroma cacao [chocolate]
ref|XP_009769017.1|  PREDICTED: BTB/POZ domain-containing protein...    321   2e-103   Nicotiana sylvestris
ref|XP_009605963.1|  PREDICTED: BTB/POZ domain-containing protein...    321   3e-103   Nicotiana tomentosiformis
gb|KHN39781.1|  hypothetical protein glysoja_020521                     311   7e-103   Glycine soja [wild soybean]
gb|KDP46249.1|  hypothetical protein JCGZ_10089                         319   2e-102   Jatropha curcas
ref|XP_004230912.1|  PREDICTED: BTB/POZ domain-containing protein...    318   5e-102   Solanum lycopersicum
gb|EYU37795.1|  hypothetical protein MIMGU_mgv1a005092mg                317   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_010107848.1|  hypothetical protein L484_027435                   313   2e-100   Morus notabilis
gb|KHF97793.1|  hypothetical protein F383_14636                         312   3e-100   Gossypium arboreum [tree cotton]
ref|XP_010254858.1|  PREDICTED: BTB/POZ domain-containing protein...    312   4e-100   Nelumbo nucifera [Indian lotus]
gb|KJB79192.1|  hypothetical protein B456_013G037300                    313   5e-100   Gossypium raimondii
ref|XP_002305426.2|  hypothetical protein POPTR_0004s16200g             312   5e-100   Populus trichocarpa [western balsam poplar]
ref|XP_011037531.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-99    Populus euphratica
ref|XP_003537876.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-99    Glycine max [soybeans]
gb|KJB47492.1|  hypothetical protein B456_008G028700                    310   2e-99    Gossypium raimondii
ref|XP_011092786.1|  PREDICTED: BTB/POZ domain-containing protein...    311   2e-99    Sesamum indicum [beniseed]
ref|XP_007131838.1|  hypothetical protein PHAVU_011G045500g             309   1e-98    Phaseolus vulgaris [French bean]
ref|XP_010530838.1|  PREDICTED: BTB/POZ domain-containing protein...    308   4e-98    Tarenaya hassleriana [spider flower]
ref|XP_010263676.1|  PREDICTED: BTB/POZ domain-containing protein...    298   1e-94    Nelumbo nucifera [Indian lotus]
gb|KHN25372.1|  BTB/POZ domain-containing protein                       295   2e-94    Glycine soja [wild soybean]
ref|XP_003631650.1|  PREDICTED: BTB/POZ domain-containing protein...    297   4e-94    Vitis vinifera
ref|XP_002509483.1|  protein binding protein, putative                  297   4e-94    Ricinus communis
ref|XP_010690889.1|  PREDICTED: BTB/POZ domain-containing protein...    296   9e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006592105.1|  PREDICTED: BTB/POZ domain-containing protein...    294   3e-93    Glycine max [soybeans]
ref|XP_007199822.1|  hypothetical protein PRUPE_ppa005350mg             291   2e-92    
ref|XP_008236884.1|  PREDICTED: BTB/POZ domain-containing protein...    291   9e-92    Prunus mume [ume]
ref|XP_008356920.1|  PREDICTED: BTB/POZ domain-containing protein...    290   2e-91    
ref|XP_004292039.2|  PREDICTED: BTB/POZ domain-containing protein...    288   9e-91    Fragaria vesca subsp. vesca
emb|CDO97055.1|  unnamed protein product                                273   3e-89    Coffea canephora [robusta coffee]
ref|XP_008377314.1|  PREDICTED: BTB/POZ domain-containing protein...    283   6e-89    Malus domestica [apple tree]
ref|XP_009374197.1|  PREDICTED: BTB/POZ domain-containing protein...    282   6e-89    Pyrus x bretschneideri [bai li]
ref|XP_010942871.1|  PREDICTED: BTB/POZ domain-containing protein...    282   2e-88    Elaeis guineensis
ref|XP_004507442.1|  PREDICTED: BTB/POZ domain-containing protein...    282   2e-88    Cicer arietinum [garbanzo]
ref|XP_010942018.1|  PREDICTED: BTB/POZ domain-containing protein...    278   1e-86    
ref|XP_010935064.1|  PREDICTED: BTB/POZ domain-containing protein...    277   1e-86    Elaeis guineensis
ref|XP_008787306.1|  PREDICTED: BTB/POZ domain-containing protein...    276   4e-86    Phoenix dactylifera
ref|XP_010939281.1|  PREDICTED: BTB/POZ domain-containing protein...    274   1e-85    Elaeis guineensis
ref|XP_008785748.1|  PREDICTED: BTB/POZ domain-containing protein...    273   2e-85    Phoenix dactylifera
ref|XP_008447033.1|  PREDICTED: BTB/POZ domain-containing protein...    273   7e-85    Cucumis melo [Oriental melon]
ref|NP_001274393.1|  BTB/POZ domain-containing protein At1g63850-...    271   4e-84    Cucumis sativus [cucumbers]
ref|XP_003606902.1|  hypothetical protein MTR_4g070010                  266   4e-82    Medicago truncatula
gb|ACU23336.1|  unknown                                                 246   1e-78    Glycine max [soybeans]
emb|CBI32585.3|  unnamed protein product                                244   6e-78    Vitis vinifera
ref|XP_009392960.1|  PREDICTED: BTB/POZ domain-containing protein...    253   2e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405968.1|  PREDICTED: BTB/POZ domain-containing protein...    252   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028585.1|  PREDICTED: BTB/POZ domain-containing protein...    248   2e-75    Eucalyptus grandis [rose gum]
ref|XP_001779398.1|  predicted protein                                  243   6e-74    
ref|XP_001770525.1|  predicted protein                                  238   1e-71    
dbj|BAJ99609.1|  predicted protein                                      233   9e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560455.1|  PREDICTED: BTB/POZ domain-containing protein...    231   5e-69    Brachypodium distachyon [annual false brome]
ref|XP_002983939.1|  hypothetical protein SELMODRAFT_271682             230   1e-68    
ref|XP_002960731.1|  hypothetical protein SELMODRAFT_270156             230   1e-68    
ref|XP_006650517.1|  PREDICTED: BTB/POZ domain-containing protein...    228   1e-67    Oryza brachyantha
ref|NP_001051117.1|  Os03g0723600                                       224   3e-66    
gb|EAZ28420.1|  hypothetical protein OsJ_12401                          224   3e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981939.1|  PREDICTED: BTB/POZ domain-containing protein...    219   2e-64    Setaria italica
ref|XP_002466545.1|  hypothetical protein SORBIDRAFT_01g009710          218   7e-64    Sorghum bicolor [broomcorn]
ref|NP_001144803.1|  uncharacterized protein LOC100277879               218   1e-63    Zea mays [maize]
gb|ACG43083.1|  hypothetical protein                                    216   3e-63    Zea mays [maize]
gb|EMT33092.1|  hypothetical protein F775_31498                         205   5e-61    
ref|XP_007042204.1|  BTB/POZ domain-containing protein isoform 2        182   1e-50    
gb|EPS62964.1|  hypothetical protein M569_11824                         172   9e-48    Genlisea aurea
ref|XP_007042205.1|  BTB/POZ domain-containing protein isoform 3        174   2e-47    
ref|XP_004230913.1|  PREDICTED: BTB/POZ domain-containing protein...    171   1e-46    Solanum lycopersicum
gb|KJB47493.1|  hypothetical protein B456_008G028700                    161   5e-43    Gossypium raimondii
gb|KJB47491.1|  hypothetical protein B456_008G028700                    159   2e-42    Gossypium raimondii
ref|XP_010530839.1|  PREDICTED: BTB/POZ domain-containing protein...    159   3e-42    Tarenaya hassleriana [spider flower]
emb|CAN67577.1|  hypothetical protein VITISV_015330                     161   8e-42    Vitis vinifera
ref|XP_006856015.1|  hypothetical protein AMTR_s00059p00043440          148   6e-41    
ref|XP_006856016.1|  hypothetical protein AMTR_s00059p00043870          148   4e-38    
ref|XP_010942021.1|  PREDICTED: BTB/POZ domain-containing protein...    137   5e-34    
ref|XP_010939282.1|  PREDICTED: BTB/POZ domain-containing protein...    135   1e-33    
gb|KHN13433.1|  Anaphase-promoting complex subunit 4                    133   5e-33    Glycine soja [wild soybean]
gb|EMS59331.1|  hypothetical protein TRIUR3_19712                       116   4e-27    Triticum urartu
ref|XP_008665335.1|  PREDICTED: uncharacterized protein LOC103643943    108   1e-25    
ref|XP_004981940.1|  PREDICTED: BTB/POZ domain-containing protein...    111   9e-25    
ref|XP_002963321.1|  hypothetical protein SELMODRAFT_270367           62.4    8e-08    
ref|XP_002974611.1|  hypothetical protein SELMODRAFT_271097           62.0    8e-08    
ref|XP_004143891.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    2e-07    
gb|KGN50074.1|  hypothetical protein Csa_5G152890                     60.5    4e-07    Cucumis sativus [cucumbers]
ref|XP_007160095.1|  hypothetical protein PHAVU_002G291900g           60.1    4e-07    Phaseolus vulgaris [French bean]
ref|XP_008437316.1|  PREDICTED: BTB/POZ domain-containing protein...  60.1    5e-07    Cucumis melo [Oriental melon]
gb|KHN16799.1|  BTB/POZ domain-containing protein                     59.3    7e-07    Glycine soja [wild soybean]
ref|XP_009397488.1|  PREDICTED: BTB/POZ domain-containing protein...  59.3    8e-07    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002531214.1|  protein binding protein, putative                59.3    9e-07    Ricinus communis
gb|KDP25402.1|  hypothetical protein JCGZ_20558                       59.3    9e-07    Jatropha curcas
ref|XP_007040315.1|  BTB/POZ domain-containing protein isoform 1      58.9    1e-06    
gb|KJB20610.1|  hypothetical protein B456_003G156100                  58.9    1e-06    Gossypium raimondii
ref|NP_001067187.1|  Os12g0596600                                     57.4    1e-06    
gb|KHG01374.1|  hypothetical protein F383_23678                       58.5    2e-06    Gossypium arboreum [tree cotton]
ref|XP_004963062.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    2e-06    Setaria italica
ref|XP_008776124.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    2e-06    
ref|XP_003532421.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    2e-06    Glycine max [soybeans]
ref|XP_008776113.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    2e-06    
ref|XP_003524451.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    2e-06    Glycine max [soybeans]
ref|XP_002299517.2|  hypothetical protein POPTR_0001s09710g           57.8    3e-06    Populus trichocarpa [western balsam poplar]
ref|XP_011080923.1|  PREDICTED: BTB/POZ domain-containing protein...  57.8    3e-06    
ref|XP_010089067.1|  BTB/POZ domain-containing protein                57.4    3e-06    
gb|KHG02986.1|  hypothetical protein F383_23864                       57.0    4e-06    Gossypium arboreum [tree cotton]
ref|NP_001053645.1|  Os04g0579700                                     56.6    6e-06    
gb|ABG22069.1|  expressed protein                                     56.6    7e-06    Oryza sativa Japonica Group [Japonica rice]
gb|ABA99196.2|  expressed protein                                     56.6    7e-06    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300808.1|  PREDICTED: BTB/POZ domain-containing protein...  56.6    8e-06    Fragaria vesca subsp. vesca
gb|EPS62176.1|  hypothetical protein M569_12618                       56.2    8e-06    Genlisea aurea
ref|XP_010676445.1|  PREDICTED: BTB/POZ domain-containing protein...  56.2    9e-06    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH21112.1|  BTB/POZ domain plant protein                          55.8    1e-05    Medicago truncatula
ref|NP_001169621.1|  uncharacterized protein LOC100383502             55.8    1e-05    Zea mays [maize]
ref|XP_004976580.1|  PREDICTED: BTB/POZ domain-containing protein...  55.5    2e-05    
dbj|BAJ95813.1|  predicted protein                                    55.5    2e-05    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE53535.1|  hypothetical protein OsJ_36742                        55.5    2e-05    Oryza sativa Japonica Group [Japonica rice]
gb|AIB05883.1|  TRAF transcription factor                             55.5    2e-05    Zea mays [maize]
gb|AFW59116.1|  hypothetical protein ZEAMMB73_743291                  55.5    2e-05    
ref|NP_001168062.1|  hypothetical protein                             55.1    2e-05    Zea mays [maize]
gb|KJB20225.1|  hypothetical protein B456_003G139200                  55.1    2e-05    Gossypium raimondii
ref|XP_008238939.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    2e-05    Prunus mume [ume]
ref|XP_006664162.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    2e-05    Oryza brachyantha
gb|KDP44149.1|  hypothetical protein JCGZ_05616                       54.7    3e-05    Jatropha curcas
ref|XP_002446981.1|  hypothetical protein SORBIDRAFT_06g026230        55.1    3e-05    
ref|XP_011015247.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    3e-05    Populus euphratica
ref|XP_011022633.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    3e-05    Populus euphratica
ref|XP_004503685.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    3e-05    Cicer arietinum [garbanzo]
ref|XP_011015245.1|  PREDICTED: BTB/POZ domain-containing protein...  55.1    3e-05    Populus euphratica
ref|XP_002968764.1|  hypothetical protein SELMODRAFT_90136            54.7    3e-05    
gb|EMS65337.1|  hypothetical protein TRIUR3_32744                     54.7    3e-05    Triticum urartu
ref|XP_010243288.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    3e-05    Nelumbo nucifera [Indian lotus]
ref|XP_007210316.1|  hypothetical protein PRUPE_ppa002210mg           54.7    3e-05    
gb|EMT14102.1|  hypothetical protein F775_07870                       54.3    3e-05    
ref|XP_010058250.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  54.3    4e-05    
ref|XP_010555851.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    4e-05    Tarenaya hassleriana [spider flower]
gb|KCW72192.1|  hypothetical protein EUGRSUZ_E00642                   54.3    4e-05    Eucalyptus grandis [rose gum]
ref|XP_001772871.1|  predicted protein                                54.3    4e-05    
ref|XP_010941741.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    4e-05    Elaeis guineensis
ref|XP_006400887.1|  hypothetical protein EUTSA_v10013333mg           54.3    4e-05    Eutrema salsugineum [saltwater cress]
ref|XP_009389780.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    4e-05    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011029330.1|  PREDICTED: BTB/POZ domain-containing protein...  54.3    4e-05    Populus euphratica
ref|XP_006652685.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    5e-05    
gb|AAR14275.1|  predicted protein                                     53.9    5e-05    Populus tremula x Populus alba [gray poplar]
gb|KJB37507.1|  hypothetical protein B456_006G208800                  53.9    5e-05    Gossypium raimondii
ref|XP_011086477.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    5e-05    Sesamum indicum [beniseed]
ref|XP_010254985.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    5e-05    Nelumbo nucifera [Indian lotus]
gb|KJB52168.1|  hypothetical protein B456_008G248700                  53.9    5e-05    Gossypium raimondii
ref|XP_010069058.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    5e-05    Eucalyptus grandis [rose gum]
ref|XP_011086471.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    6e-05    Sesamum indicum [beniseed]
ref|XP_009419272.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    6e-05    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010069057.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    6e-05    Eucalyptus grandis [rose gum]
gb|EMT26347.1|  hypothetical protein F775_16772                       53.5    7e-05    
ref|XP_011089383.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    8e-05    
gb|KHG07032.1|  hypothetical protein F383_02815                       53.1    8e-05    Gossypium arboreum [tree cotton]
ref|XP_011085536.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    9e-05    Sesamum indicum [beniseed]
emb|CBI34370.3|  unnamed protein product                              53.1    9e-05    Vitis vinifera
ref|XP_006856144.1|  hypothetical protein AMTR_s00059p00166010        53.1    9e-05    Amborella trichopoda
ref|XP_009419041.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    9e-05    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB24321.1|  hypothetical protein B456_004G139400                  53.1    9e-05    Gossypium raimondii
ref|XP_011099262.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    1e-04    
ref|XP_010919095.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    1e-04    Elaeis guineensis
ref|XP_004251284.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    1e-04    Solanum lycopersicum
ref|XP_006829095.1|  hypothetical protein AMTR_s00001p00262820        53.1    1e-04    
ref|XP_006365150.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    1e-04    Solanum tuberosum [potatoes]
ref|XP_008808898.1|  PREDICTED: BTB/POZ domain-containing protein...  53.1    1e-04    Phoenix dactylifera
gb|KHN44517.1|  BTB/POZ domain-containing protein                     52.8    1e-04    Glycine soja [wild soybean]
tpg|DAA61328.1|  TPA: hypothetical protein ZEAMMB73_882597            52.4    1e-04    
ref|XP_010255266.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    1e-04    Nelumbo nucifera [Indian lotus]
ref|XP_006476518.1|  PREDICTED: BTB/POZ domain-containing protein...  52.8    1e-04    Citrus sinensis [apfelsine]
ref|XP_001751363.1|  predicted protein                                52.4    1e-04    
ref|XP_010233737.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    2e-04    Brachypodium distachyon [annual false brome]
ref|XP_006439497.1|  hypothetical protein CICLE_v10019226mg           52.8    2e-04    Citrus clementina [clementine]
gb|KHN22018.1|  BTB/POZ domain-containing protein                     51.6    2e-04    Glycine soja [wild soybean]
ref|XP_003548003.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    2e-04    Glycine max [soybeans]
gb|KHG15549.1|  hypothetical protein F383_06896                       52.4    2e-04    Gossypium arboreum [tree cotton]
ref|XP_002279382.2|  PREDICTED: BTB/POZ domain-containing protein...  52.4    2e-04    Vitis vinifera
ref|XP_009800799.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    2e-04    Nicotiana sylvestris
ref|XP_010092990.1|  hypothetical protein L484_007171                 52.0    2e-04    
ref|XP_010260115.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    2e-04    Nelumbo nucifera [Indian lotus]
gb|EYU18898.1|  hypothetical protein MIMGU_mgv1a005394mg              52.0    2e-04    Erythranthe guttata [common monkey flower]
ref|XP_009793569.1|  PREDICTED: uncharacterized protein LOC104240425  52.0    2e-04    Nicotiana sylvestris
ref|XP_009774422.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    2e-04    Nicotiana sylvestris
gb|KDO76298.1|  hypothetical protein CISIN_1g006210mg                 52.0    2e-04    Citrus sinensis [apfelsine]
ref|XP_004505925.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    2e-04    Cicer arietinum [garbanzo]
gb|KHN05697.1|  BTB/POZ domain-containing protein                     52.0    3e-04    Glycine soja [wild soybean]
dbj|BAJ96039.1|  predicted protein                                    51.6    3e-04    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003540755.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    3e-04    Glycine max [soybeans]
ref|XP_010313540.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  50.8    3e-04    
ref|XP_009610322.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    4e-04    Nicotiana tomentosiformis
ref|XP_006650658.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    4e-04    Oryza brachyantha
ref|XP_009407677.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    4e-04    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010029862.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    5e-04    
ref|XP_010680938.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    5e-04    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002270447.1|  PREDICTED: uncharacterized protein LOC100240757  50.8    5e-04    Vitis vinifera
ref|XP_008783774.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    5e-04    Phoenix dactylifera
ref|XP_010685873.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    5e-04    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400477.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    5e-04    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010922477.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    5e-04    
ref|XP_009388509.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    5e-04    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002521651.1|  conserved hypothetical protein                   50.8    5e-04    Ricinus communis
ref|XP_009628159.1|  PREDICTED: BTB/POZ domain-containing protein...  50.8    6e-04    Nicotiana tomentosiformis
ref|XP_009590559.1|  PREDICTED: uncharacterized protein LOC104087710  50.4    6e-04    Nicotiana tomentosiformis
emb|CBI29026.3|  unnamed protein product                              50.8    6e-04    Vitis vinifera
ref|XP_006425769.1|  hypothetical protein CICLE_v10026330mg           50.1    6e-04    
gb|KCW85653.1|  hypothetical protein EUGRSUZ_B02440                   50.4    7e-04    Eucalyptus grandis [rose gum]
gb|KFK27540.1|  hypothetical protein AALP_AA8G396600                  50.1    7e-04    Arabis alpina [alpine rockcress]
ref|XP_006828235.1|  hypothetical protein AMTR_s00023p00185370        50.4    7e-04    Amborella trichopoda
gb|ACR38622.1|  unknown                                               50.4    8e-04    Zea mays [maize]
ref|XP_010547478.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    8e-04    
ref|XP_010043649.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  50.4    8e-04    
ref|XP_010941924.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    8e-04    Elaeis guineensis
ref|XP_006591005.1|  PREDICTED: BTB/POZ domain-containing protein...  50.1    9e-04    Glycine max [soybeans]
ref|XP_007016614.1|  BTB/POZ domain-containing protein                50.1    0.001    
ref|XP_011073126.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  50.1    0.001    Sesamum indicum [beniseed]
ref|XP_010443796.1|  PREDICTED: BTB/POZ domain-containing protein...  50.1    0.001    Camelina sativa [gold-of-pleasure]
emb|CDP12055.1|  unnamed protein product                              50.1    0.001    Coffea canephora [robusta coffee]



>gb|KHG28215.1| hypothetical protein F383_15738 [Gossypium arboreum]
Length=502

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AV EWS Q SFTADLQRAFRDDAWRN 
Sbjct  322  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVVEWSEQASFTADLQRAFRDDAWRNI  381

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAVVLRCTCKLANAV+ GTILA RQVRMKLVK+WLPVL+ CKDNVSPM+P+HK L+
Sbjct  382  VPGLPAVVLRCTCKLANAVAAGTILAARQVRMKLVKDWLPVLLVCKDNVSPMLPSHKPLH  441

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELEETFLRIISTLP+SDAQ LLQQCLSFSTRNVEDCPHLI+AF TWFRRA R
Sbjct  442  LELEETFLRIISTLPMSDAQVLLQQCLSFSTRNVEDCPHLITAFNTWFRRATR  494



>ref|XP_006365098.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Solanum 
tuberosum]
Length=505

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHL+WLVERMIELRVADTAV+EWSNQ +FTADL RA RDDAWRN 
Sbjct  327  EAIQRLNLHTAMTNGRHLVWLVERMIELRVADTAVQEWSNQAAFTADLLRALRDDAWRNI  386

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAVVLRCTCKL+NAV+ GTILA RQVRMK+VK+WLPVLI CKD V+PM P+HK +Y
Sbjct  387  VPGLPAVVLRCTCKLSNAVATGTILATRQVRMKIVKDWLPVLILCKDYVTPMTPSHKTIY  446

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            +ELE+TFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR
Sbjct  447  VELEDTFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  499



>gb|KDO49087.1| hypothetical protein CISIN_1g012309mg [Citrus sinensis]
Length=466

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AVKEWS Q +FTADLQRAFRDDAWR
Sbjct  286  ETEAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVKEWSEQAAFTADLQRAFRDDAWR  345

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAV++RCTCKLANAV+ GT LA RQVRMKLVK+WLPVLI CKDNVSP++P+HK 
Sbjct  346  NIVPGLPAVIMRCTCKLANAVAAGTTLAARQVRMKLVKDWLPVLIVCKDNVSPLLPSHKS  405

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LYLELE+TFLRIISTLP+SD+QELLQQCLSFST+NVEDCPHL++AF TWFRRA R
Sbjct  406  LYLELEDTFLRIISTLPMSDSQELLQQCLSFSTKNVEDCPHLVTAFNTWFRRATR  460



>ref|XP_006423255.1| hypothetical protein CICLE_v10028323mg [Citrus clementina]
 ref|XP_006487149.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
 gb|ESR36495.1| hypothetical protein CICLE_v10028323mg [Citrus clementina]
Length=484

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AVKEWS Q +FTADLQRAFRDDAWRN 
Sbjct  306  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVKEWSEQAAFTADLQRAFRDDAWRNI  365

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV++RCTCKLANAV+ GT LA RQVRMKLVK+WLPVLI CKDNVSP++P+HK LY
Sbjct  366  VPGLPAVIMRCTCKLANAVAAGTTLAARQVRMKLVKDWLPVLIVCKDNVSPLLPSHKSLY  425

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELE+TFLRIISTLP+SD+QELLQQCLSFST+NVEDCPHL++AF TWFRRA R
Sbjct  426  LELEDTFLRIISTLPMSDSQELLQQCLSFSTKNVEDCPHLVTAFNTWFRRATR  478



>ref|XP_011088392.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Sesamum 
indicum]
Length=499

 Score =   322 bits (825),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNG+HLLWLVERMIEL+VADTAVK WS Q SFTADLQRAFRDDAWRN 
Sbjct  319  EAIQRLNLHTAMTNGKHLLWLVERMIELKVADTAVKAWSEQASFTADLQRAFRDDAWRNI  378

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VP LPAVVLRCT +LANAV+ G ILA RQVRMKLV++WLPVLI CKD+VSPM PNHK LY
Sbjct  379  VPSLPAVVLRCTSRLANAVATGNILATRQVRMKLVRDWLPVLIICKDSVSPMGPNHKSLY  438

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDF  203
            LELEETFLRIISTLPLSDAQELLQQCLSFSTRNV+DCPHL++AFTTWFRRANR   Q DF
Sbjct  439  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVDDCPHLVAAFTTWFRRANRP-PQPDF  497



>ref|XP_007042203.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOX98034.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=508

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AVKEWS Q +FTADLQRAFRDDAWR
Sbjct  326  ETEAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVKEWSEQAAFTADLQRAFRDDAWR  385

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N+VPGLPAVVLRCTCKLANAV+ GTI+A RQVRMKLVK+WLPVL  CKDNVSPM+P+HK 
Sbjct  386  NFVPGLPAVVLRCTCKLANAVATGTIIAARQVRMKLVKDWLPVLNVCKDNVSPMLPSHKT  445

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LYLELEETFLRIISTLP+SDAQ LL+QCLSFSTRNVEDCPHL++AF TWFRRA +
Sbjct  446  LYLELEETFLRIISTLPMSDAQVLLRQCLSFSTRNVEDCPHLVTAFNTWFRRATQ  500



>ref|XP_009769017.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nicotiana 
sylvestris]
Length=506

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWL+ERMIELRVAD AV+EWSNQ SFTADL RA RDDAWRN 
Sbjct  331  EAIQRLNLHTAMTNGRHLLWLLERMIELRVADAAVQEWSNQASFTADLLRALRDDAWRNI  390

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAVVLRCTCKLANAV+ GTILA RQVRMKLVK+WLPVLI CKDNV+PMMP+HK +Y
Sbjct  391  VPGLPAVVLRCTCKLANAVAAGTILATRQVRMKLVKDWLPVLILCKDNVTPMMPSHKTVY  450

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
            +ELE+TFLRIISTL L DAQELLQQCLSFSTRNV+DCPHL+ AFTTWFRRANRS
Sbjct  451  VELEDTFLRIISTLTLPDAQELLQQCLSFSTRNVDDCPHLVGAFTTWFRRANRS  504



>ref|XP_009605963.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nicotiana 
tomentosiformis]
Length=512

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWL+ERMIELRVAD AV+EWSNQ SFTADL RA RDDAWRN 
Sbjct  331  EAIQRLNLHTAMTNGRHLLWLLERMIELRVADAAVQEWSNQASFTADLLRALRDDAWRNI  390

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAVVLRCTCKLANAV+ GTILA RQVRMKLVK+WLPVLI CKDNV+PMMP+HK +Y
Sbjct  391  VPGLPAVVLRCTCKLANAVATGTILATRQVRMKLVKDWLPVLILCKDNVTPMMPSHKTVY  450

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
            +ELE+TFLRIISTL L DAQELLQQCLSFSTRNV+DCPHL+ AFTTWFRRANRS
Sbjct  451  VELEDTFLRIISTLTLPDAQELLQQCLSFSTRNVDDCPHLVGAFTTWFRRANRS  504



>gb|KHN39781.1| hypothetical protein glysoja_020521 [Glycine soja]
Length=253

 Score =   311 bits (797),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLH A TNG+HLLWLVERMIELRVAD AV+EWS Q  FTADLQRAFRDDAWR
Sbjct  69   ETEAIQRLNLHKASTNGKHLLWLVERMIELRVADVAVREWSEQAGFTADLQRAFRDDAWR  128

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAV+LRCTC+LANAVS GTILA RQVR KLV++WLPVL+ CKDNVSP+ P++K 
Sbjct  129  NIVPGLPAVILRCTCRLANAVSAGTILASRQVRRKLVEDWLPVLVVCKDNVSPISPSNKS  188

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LYLELEETFLRIISTLP+SDAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  189  LYLELEETFLRIISTLPMSDAQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRAAR  243



>gb|KDP46249.1| hypothetical protein JCGZ_10089 [Jatropha curcas]
Length=511

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTA+TNG+HLLWLVERMIEL+VAD+AVKEWS Q +FTADLQRAFRDDAWR
Sbjct  331  ETEAIQRLNLHTALTNGKHLLWLVERMIELKVADSAVKEWSEQSAFTADLQRAFRDDAWR  390

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAVVLRCT KLANAV+ GTILA RQVRMKLVK+WLPVLI CKDNVSPM P+HK 
Sbjct  391  NIVPGLPAVVLRCTLKLANAVAAGTILAARQVRMKLVKDWLPVLIVCKDNVSPMSPSHKS  450

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LY+ELEETFLRIISTLP+SDAQELLQQCLSFSTRNVEDCPHL+ AF TWFRRA
Sbjct  451  LYIELEETFLRIISTLPMSDAQELLQQCLSFSTRNVEDCPHLVCAFNTWFRRA  503



>ref|XP_004230912.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Solanum lycopersicum]
Length=507

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHL+WLVERMIELRVADTAV+EWSNQ +FTADL RA RDDAWRN 
Sbjct  329  EAIQRLNLHTAMTNGRHLVWLVERMIELRVADTAVQEWSNQAAFTADLLRALRDDAWRNI  388

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAVVLRCTCKL+NAV+ GTILA RQVR K+VK+WLPVLI CKD  +PMMP+HK +Y
Sbjct  389  VPGLPAVVLRCTCKLSNAVATGTILATRQVRKKIVKDWLPVLILCKDYATPMMPSHKTIY  448

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            +ELE+TFL IISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRAN+
Sbjct  449  VELEDTFLSIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANK  501



>gb|EYU37795.1| hypothetical protein MIMGU_mgv1a005092mg [Erythranthe guttata]
Length=497

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNG+HLLWLVERMIELRVADTAV  WS Q SFTADLQRAFRDDAWRN 
Sbjct  317  EAIQRLNLHTAMTNGKHLLWLVERMIELRVADTAVMAWSEQASFTADLQRAFRDDAWRNI  376

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VP LPAVVLRCT +LANAV+ G ILA +QVRMKLV++WLPVLI CKD+VSPM PNHK LY
Sbjct  377  VPSLPAVVLRCTSRLANAVATGNILATKQVRMKLVRDWLPVLIICKDSVSPMGPNHKSLY  436

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDF  203
            LELEETFLRIISTLPLSDAQ LLQQCLSFSTRNV+DCPHL+SAF+TWFRRANR      F
Sbjct  437  LELEETFLRIISTLPLSDAQGLLQQCLSFSTRNVDDCPHLVSAFSTWFRRANRPPHPDSF  496



>ref|XP_010107848.1| hypothetical protein L484_027435 [Morus notabilis]
 gb|EXC17248.1| hypothetical protein L484_027435 [Morus notabilis]
Length=501

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWLVERMIEL+VAD AVKEWS Q SFT+DLQRAFRDDAWR
Sbjct  319  ETEAIQRLNLHTAMTNGRHLLWLVERMIELKVADAAVKEWSEQASFTSDLQRAFRDDAWR  378

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAVVLRCTC+LANAV+ G+ILA RQVR KLVK+WLPVLI CK+NVSP+ P++K 
Sbjct  379  NIVPGLPAVVLRCTCRLANAVAAGSILAARQVRKKLVKDWLPVLIVCKENVSPLSPSNKL  438

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LYLELEETFLRIISTLP+SDAQELLQQCLSFSTR+V+DCPHLI+AF TWFRRA
Sbjct  439  LYLELEETFLRIISTLPMSDAQELLQQCLSFSTRDVDDCPHLITAFNTWFRRA  491



>gb|KHF97793.1| hypothetical protein F383_14636 [Gossypium arboreum]
Length=473

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LHTAMTNGRHLLWLVE MIEL+VAD+AVK+WS Q +FT DLQ+AFRDDAWRN 
Sbjct  293  EAIQRLHLHTAMTNGRHLLWLVEMMIELKVADSAVKQWSEQAAFTVDLQKAFRDDAWRNI  352

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCTCKLA+AV+ GTIL+ RQVRMKLVK+WLPVLI+CKDNVSPM+P+HK LY
Sbjct  353  VPGLPAVMLRCTCKLASAVAAGTILSSRQVRMKLVKDWLPVLISCKDNVSPMLPSHKTLY  412

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELEETFLRIISTLP+SDAQ LLQQCLSFSTRNVEDCPHL++AF TWFRRA++
Sbjct  413  LELEETFLRIISTLPMSDAQVLLQQCLSFSTRNVEDCPHLVTAFNTWFRRASQ  465



>ref|XP_010254858.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Nelumbo 
nucifera]
Length=489

 Score =   312 bits (799),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLH AMTNGRHLLWLVERMIELRVADTAVK WS+Q SFTADLQRAFRDDAWR
Sbjct  309  ETEAIQRLNLHKAMTNGRHLLWLVERMIELRVADTAVKVWSDQASFTADLQRAFRDDAWR  368

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAV+LRCT KLANAV+ G+ILA RQVRMKLVK+WLPVLI CKDN SPM+P+HK 
Sbjct  369  NIVPGLPAVILRCTYKLANAVATGSILAVRQVRMKLVKDWLPVLIVCKDNSSPMLPSHKS  428

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LY ELEETFL IISTLP+SDAQ LL QCLSFSTRNVEDCPHL+SAF TWFRRA R
Sbjct  429  LYQELEETFLGIISTLPMSDAQGLLPQCLSFSTRNVEDCPHLVSAFNTWFRRATR  483



>gb|KJB79192.1| hypothetical protein B456_013G037300 [Gossypium raimondii]
Length=516

 Score =   313 bits (801),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 162/187 (87%), Gaps = 14/187 (7%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AV EWS Q SFTADLQRAFRDDAWRN 
Sbjct  322  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVVEWSEQASFTADLQRAFRDDAWRNI  381

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQ--------------VRMKLVKNWLPVLIACK  425
            VPGLPAVVLRCTCKLANAV+ GTILA RQ              VRMKLVK+WLPVL+ CK
Sbjct  382  VPGLPAVVLRCTCKLANAVAAGTILAARQFVDYIRVDGNSVGMVRMKLVKDWLPVLLVCK  441

Query  424  DNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTT  245
            DNVSPM+P+HK L+LELEETFLRIISTLP+SDAQ LLQQCLSFSTRNVEDCPHLI+AF T
Sbjct  442  DNVSPMLPSHKPLHLELEETFLRIISTLPMSDAQLLLQQCLSFSTRNVEDCPHLITAFNT  501

Query  244  WFRRANR  224
            WFRRA R
Sbjct  502  WFRRATR  508



>ref|XP_002305426.2| hypothetical protein POPTR_0004s16200g [Populus trichocarpa]
 gb|EEE85937.2| hypothetical protein POPTR_0004s16200g [Populus trichocarpa]
Length=508

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNG+HLLWLVERMIELRVAD+AVKEWS Q SFTADLQRAFRDDAWRN 
Sbjct  331  EAIQRLNLHTAMTNGKHLLWLVERMIELRVADSAVKEWSEQDSFTADLQRAFRDDAWRNI  390

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDN-VSPMMPNHKQL  386
            VPG PAV+LRCTCKLANAV+ GTILA RQVRMKLVK+WLPVLI CKD+ +S M+PNHK L
Sbjct  391  VPGFPAVLLRCTCKLANAVASGTILAARQVRMKLVKDWLPVLIVCKDSALSSMLPNHKSL  450

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            YLELEETFLRIISTLP+SDAQ LLQQCLSFSTRN EDCPHL++AF TWFRRA
Sbjct  451  YLELEETFLRIISTLPMSDAQVLLQQCLSFSTRNFEDCPHLVTAFNTWFRRA  502



>ref|XP_011037531.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=509

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNG+HLLWLVERMIELRVAD+AVKEWS Q SFTADLQRAFRDDAWR
Sbjct  330  ETEAIQRLNLHTAMTNGKHLLWLVERMIELRVADSAVKEWSEQDSFTADLQRAFRDDAWR  389

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNV-SPMMPNHK  392
            N VPG PAV+LRCTCKLANAV+ GTILA RQVRMKLVK+WLPVLI CKD+  S M+P+HK
Sbjct  390  NIVPGFPAVLLRCTCKLANAVASGTILAARQVRMKLVKDWLPVLIVCKDSAFSSMLPSHK  449

Query  391  QLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             LYLELEETFLRIISTLP+SDAQ LLQQCLSFSTRNVEDCPHL++AF TWFRRA
Sbjct  450  SLYLELEETFLRIISTLPMSDAQVLLQQCLSFSTRNVEDCPHLVTAFNTWFRRA  503



>ref|XP_003537876.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Glycine 
max]
Length=493

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH A TNG+HLLWLVERMIELRVAD AV+EWS Q  FTADLQRAFRDDAWRN 
Sbjct  311  EAIQRLNLHKASTNGKHLLWLVERMIELRVADVAVREWSEQAGFTADLQRAFRDDAWRNI  370

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCTC+LANAVS GTILA RQVR KLV++WLPVL+ CKDNVSP+ P++K LY
Sbjct  371  VPGLPAVILRCTCRLANAVSAGTILASRQVRRKLVEDWLPVLVVCKDNVSPISPSNKSLY  430

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELEETFLRIISTLP+SDAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  431  LELEETFLRIISTLPMSDAQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRAAR  483



>gb|KJB47492.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=473

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LHTAMTNGRHLLWLVERMIEL+VAD AVK+WS Q +FT DLQ+AFRDDAWRN 
Sbjct  293  EAIQRLHLHTAMTNGRHLLWLVERMIELKVADLAVKQWSEQAAFTVDLQKAFRDDAWRNI  352

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCTCKLA+AV+ GTIL+ RQVRMKLVK+WLPVLI+ KDNVSPM+P+HK LY
Sbjct  353  VPGLPAVMLRCTCKLASAVAAGTILSSRQVRMKLVKDWLPVLISSKDNVSPMLPSHKTLY  412

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LELEETFLRIISTLP+SDAQ LLQQCLSFSTRNVEDCPHL++AF TWFRRA
Sbjct  413  LELEETFLRIISTLPMSDAQVLLQQCLSFSTRNVEDCPHLVTAFNTWFRRA  463



>ref|XP_011092786.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Sesamum 
indicum]
Length=514

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAM NG+HLLWL+ERMIELRVADTAVK WS Q SFT DLQRA RDDAWRN 
Sbjct  334  EAIQRLNLHTAMINGKHLLWLMERMIELRVADTAVKAWSQQTSFTGDLQRALRDDAWRNI  393

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VP LP+VVLRCTC+LANAV+ G ILADRQVRM LV++WLP+LI CK +VSPM PNHK LY
Sbjct  394  VPSLPSVVLRCTCRLANAVAAGNILADRQVRMDLVRDWLPLLITCKASVSPMGPNHKSLY  453

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELEETFLRIISTLP+SDAQELLQQCLSFSTRN++DCPHL++AFTTWFRRANR
Sbjct  454  LELEETFLRIISTLPISDAQELLQQCLSFSTRNMDDCPHLVAAFTTWFRRANR  506



>ref|XP_007131838.1| hypothetical protein PHAVU_011G045500g [Phaseolus vulgaris]
 gb|ESW03832.1| hypothetical protein PHAVU_011G045500g [Phaseolus vulgaris]
Length=508

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH A TNG+HLLWLVERMIELRVAD AV+EWS Q  FTADLQRAFRDDAWRN 
Sbjct  326  EAIQRLNLHKASTNGKHLLWLVERMIELRVADVAVREWSEQACFTADLQRAFRDDAWRNI  385

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCTC+LANAVS GTILA RQVR KLV++WLPVL+ACKDNVSP+ P +K LY
Sbjct  386  VPGLPAVILRCTCRLANAVSAGTILASRQVRRKLVEDWLPVLVACKDNVSPISPGNKSLY  445

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELE TFLRIISTLPLSDAQELLQ CLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  446  LELEATFLRIISTLPLSDAQELLQSCLSFSTRNVEDCPHLVTAFNTWFRRAAR  498



>ref|XP_010530838.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Tarenaya hassleriana]
Length=511

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QRL+LHTAM NG+HL+W+VERMIELRVADTAVKEWS Q +FTADLQRAFRDDAWRN 
Sbjct  327  EAMQRLSLHTAMVNGKHLIWVVERMIELRVADTAVKEWSEQAAFTADLQRAFRDDAWRNM  386

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGLPAVVLRCTCKLA+AV+ G+ILA RQVRMKLVK+WLPVLI C+DNVSP++PNHK + 
Sbjct  387  APGLPAVVLRCTCKLADAVASGSILAARQVRMKLVKDWLPVLIVCRDNVSPILPNHKSMC  446

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQ  212
            LELEE FLRIISTL ++D+QELL+QCLSFSTRNVEDCPHL++AF TWFRRA RS +Q
Sbjct  447  LELEEKFLRIISTLAMTDSQELLKQCLSFSTRNVEDCPHLVTAFNTWFRRATRSGQQ  503



>ref|XP_010263676.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Nelumbo 
nucifera]
Length=483

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD AVKEWS+Q SFTA+LQRAFRDDAWRN 
Sbjct  305  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADNAVKEWSDQASFTANLQRAFRDDAWRNI  364

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPA++LRCT KLANAV+ G+ILA +QVRM+LVK+WLPVLI CKD  SP++PN K L 
Sbjct  365  VPGLPAIMLRCTSKLANAVAAGSILAAKQVRMRLVKDWLPVLIVCKDKGSPVLPNRKSLC  424

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             ELEETFLRIISTLP+SDAQELL  CLSF TRN+EDCPHL+SAF TWFRRA R
Sbjct  425  QELEETFLRIISTLPMSDAQELLPLCLSFCTRNIEDCPHLVSAFNTWFRRATR  477



>gb|KHN25372.1| BTB/POZ domain-containing protein [Glycine soja]
Length=394

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLH A TNG+HLLWLVERMIELRVAD AV+EWS Q  FTADLQRAF DDAWR
Sbjct  213  ETEAIQRLNLHKASTNGKHLLWLVERMIELRVADVAVREWSEQAGFTADLQRAFGDDAWR  272

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAV+LRCTC+LANAVS GTILA RQVR KLV++WLPVL+ CKDNVS   P++K 
Sbjct  273  NIVPGLPAVILRCTCRLANAVSAGTILASRQVRRKLVQDWLPVLLVCKDNVS---PSNKS  329

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            L+LELE+TFLRIISTLP+SDAQELLQ+CLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  330  LHLELEQTFLRIISTLPMSDAQELLQRCLSFSTRNVEDCPHLVTAFNTWFRRAAR  384



>ref|XP_003631650.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Vitis 
vinifera]
Length=488

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWL+ERMIEL+VAD AV+EWS Q +FTADLQRAFRDDAWR
Sbjct  307  ETEAIQRLNLHTAMTNGRHLLWLIERMIELKVADKAVREWSEQSTFTADLQRAFRDDAWR  366

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLP VVLRCTCKLANAV+ G+ILA R VRMKLVK WLPVLI CKDNVS ++  HK 
Sbjct  367  NIVPGLPVVVLRCTCKLANAVASGSILAARPVRMKLVKEWLPVLIVCKDNVS-VLHTHKS  425

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQK  209
            LY ELEE FLRIIST PLSDAQELLQQCLSF+TRNV+DCPHL++AF TWF RA R   Q 
Sbjct  426  LYTELEEIFLRIISTFPLSDAQELLQQCLSFATRNVDDCPHLVTAFNTWFCRAARP-PQA  484

Query  208  DFVC  197
            D +C
Sbjct  485  DSLC  488



>ref|XP_002509483.1| protein binding protein, putative [Ricinus communis]
 gb|EEF50870.1| protein binding protein, putative [Ricinus communis]
Length=498

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQR+NLHTA+TNG+HLLWLVERMI+L+VAD AV EWS Q  FT DLQRAFRDDA RN 
Sbjct  319  EAIQRVNLHTALTNGKHLLWLVERMIDLKVADNAVIEWSEQSGFTGDLQRAFRDDASRNI  378

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLP VVLRCT KLANAV+ G+ILA RQVRMKLVK+WLPVLI CKDNV PM  +H+ LY
Sbjct  379  VPGLPNVVLRCTAKLANAVASGSILAPRQVRMKLVKDWLPVLIVCKDNVPPMSVSHRSLY  438

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDF  203
            LELEETFL+IISTLP+SDAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA R  ++  F
Sbjct  439  LELEETFLKIISTLPMSDAQELLQQCLSFSTRNVEDCPHLVNAFNTWFRRAMRPPQRNLF  498



>ref|XP_010690889.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   296 bits (758),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 156/189 (83%), Gaps = 9/189 (5%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTA+TNG+HLLWLVERMIELRVAD AVKEWS Q SF ADLQRAFRDDAWRN 
Sbjct  316  EAIQRLNLHTALTNGKHLLWLVERMIELRVADVAVKEWSEQDSFAADLQRAFRDDAWRNI  375

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHK---  392
            VPGLP VVL+CT KLANAV+ G IL  RQVRMK VK+WLPVLI CK+  SP++P+HK   
Sbjct  376  VPGLPTVVLKCTSKLANAVASGNILVARQVRMKFVKDWLPVLIVCKEKASPVLPSHKPVL  435

Query  391  ------QLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
                   LYLELE+TFLRIISTLP+ DAQELLQQCLSFSTR+ EDCPHLI+AF TWFRRA
Sbjct  436  HSPTPTSLYLELEDTFLRIISTLPMDDAQELLQQCLSFSTRDSEDCPHLITAFNTWFRRA  495

Query  229  NRSHEQKDF  203
             RS    +F
Sbjct  496  TRSSLVTNF  504



>ref|XP_006592105.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=485

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 155/173 (90%), Gaps = 3/173 (2%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH A TNG+HLLWLVERMIELRVAD AV+EWS Q  FTADLQRAF DDAWRN 
Sbjct  306  EAIQRLNLHKASTNGKHLLWLVERMIELRVADVAVREWSEQAGFTADLQRAFGDDAWRNI  365

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCTC+LANAVS GTILA RQVR KLV++WLPVL+ CKDNVS   P++K L+
Sbjct  366  VPGLPAVILRCTCRLANAVSAGTILASRQVRRKLVQDWLPVLLVCKDNVS---PSNKSLH  422

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            LELE+TFLRIISTLP+SDAQELLQ+CLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  423  LELEQTFLRIISTLPMSDAQELLQRCLSFSTRNVEDCPHLVTAFNTWFRRAAR  475



>ref|XP_007199822.1| hypothetical protein PRUPE_ppa005350mg [Prunus persica]
 gb|EMJ01021.1| hypothetical protein PRUPE_ppa005350mg [Prunus persica]
Length=465

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQR+NLHTAMTNG+HLLWLVERMIELRVA++AVKEWS Q +FTADLQRAFRDDAWRN 
Sbjct  284  EAIQRINLHTAMTNGKHLLWLVERMIELRVAESAVKEWSEQPAFTADLQRAFRDDAWRNI  343

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKD-NVSPMMPNHKQL  386
            VP LP+V+LRCT +L NAV+ GTIL   QVR KLVK+WLPVLI CKD N SP+ P++K L
Sbjct  344  VPSLPSVLLRCTSRLVNAVATGTILVAAQVRKKLVKDWLPVLIVCKDNNASPLTPSNKPL  403

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKD  206
            YL+LEETFLRIISTLP+ DAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA +  + ++
Sbjct  404  YLDLEETFLRIISTLPMPDAQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRATQPPQAQN  463

Query  205  F  203
             
Sbjct  464  L  464



>ref|XP_008236884.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Prunus 
mume]
Length=486

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQR+NLHTAMTNG+HLLWLVERMIELRVA++AVKEWS Q +FTADLQRAFRDDAWRN 
Sbjct  305  EAIQRINLHTAMTNGKHLLWLVERMIELRVAESAVKEWSEQPAFTADLQRAFRDDAWRNI  364

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKD-NVSPMMPNHKQL  386
            VP LP+V+LRCT +L NAV+ GTIL   QVR KLVK+WLPVLI CKD N SP+ P++K L
Sbjct  365  VPSLPSVLLRCTSRLVNAVATGTILVASQVRKKLVKDWLPVLIVCKDNNASPLTPSNKPL  424

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKD  206
            YL+LEETFLRIISTLP+ DAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA    + ++
Sbjct  425  YLDLEETFLRIISTLPMPDAQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRATHPPQAQN  484

Query  205  F  203
             
Sbjct  485  L  485



>ref|XP_008356920.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Malus 
domestica]
Length=490

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNG+HL+WLVERMIELRVAD+AV+EWS Q +F ADLQRAFRDDAWRN 
Sbjct  309  EAIQRLNLHTAMTNGKHLVWLVERMIELRVADSAVREWSEQPAFAADLQRAFRDDAWRNI  368

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKD-NVSPMMPNHKQL  386
            VPGLP+++LRCT +LANAV+ GTIL D QVR KLVK+WLPVLI CKD N SP+  ++K L
Sbjct  369  VPGLPSILLRCTSRLANAVAAGTILVDAQVRKKLVKDWLPVLIVCKDTNTSPLTSSNKPL  428

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRAN  227
            YL+LEE FLRIISTLP+SD+QELLQQCLSFSTRNVEDCPHL++AF TWFRRA 
Sbjct  429  YLDLEEIFLRIISTLPMSDSQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRAT  481



>ref|XP_004292039.2| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Fragaria 
vesca subsp. vesca]
Length=500

 Score =   288 bits (738),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD AVKEWS Q +F ADLQRAFRDDAWRN 
Sbjct  323  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADAAVKEWSEQPAFAADLQRAFRDDAWRNI  382

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLP V+LRCT KL++A++ GTIL   QVR KLV +WLPVLI CKDN+SP+ PN++ LY
Sbjct  383  VPGLPGVLLRCTAKLSSAIASGTILVAAQVRKKLVNDWLPVLIVCKDNISPLTPNNRPLY  442

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            L+LEETFL+IISTLP+ DAQELLQQCL FSTR  +DCPHL+ AF TWFRRA R
Sbjct  443  LDLEETFLKIISTLPMLDAQELLQQCLVFSTRTFDDCPHLVMAFNTWFRRAAR  495



>emb|CDO97055.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   273 bits (698),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  670  MIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLANAVSMGTI  491
            MIELRVADTAV+EWS+Q SFTADLQRAFRDDAWRN VPGLPAVVLRCTCKLANAV+ G I
Sbjct  1    MIELRVADTAVEEWSDQASFTADLQRAFRDDAWRNIVPGLPAVVLRCTCKLANAVATGNI  60

Query  490  LADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQ  311
            LA RQVRMKLVK+WLPVLI CK+NVS MM +HK LY ELEETFLRIISTLP+SDAQELLQ
Sbjct  61   LAARQVRMKLVKDWLPVLIICKENVSHMMSSHKSLYQELEETFLRIISTLPMSDAQELLQ  120

Query  310  QCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
            QCLSFSTRNV+DCPHL++AFTTWFRRANRS
Sbjct  121  QCLSFSTRNVDDCPHLVTAFTTWFRRANRS  150



>ref|XP_008377314.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Malus 
domestica]
Length=487

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 2/181 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTA+T+G+HL+WLVERMIELRVAD+AVKEWS Q +FTADLQRAF+DDAWRN 
Sbjct  307  EAIQRLNLHTALTHGKHLVWLVERMIELRVADSAVKEWSEQPAFTADLQRAFQDDAWRNI  366

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKD-NVSPMMPNHKQL  386
            VPGLP+V+LRCT +LANAV+ GTIL   QVR KLVK+WLPVLI CKD N SP+  ++K L
Sbjct  367  VPGLPSVLLRCTSRLANAVASGTILVAAQVRKKLVKDWLPVLIVCKDTNASPLTSSNKPL  426

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKD  206
            YL+LEETFLRIISTLP+SD+QELLQQCLSFSTRNV DCPHL++AF TWFRRA  S ++++
Sbjct  427  YLDLEETFLRIISTLPMSDSQELLQQCLSFSTRNV-DCPHLVTAFNTWFRRATHSPQREN  485

Query  205  F  203
             
Sbjct  486  L  486



>ref|XP_009374197.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like, 
partial [Pyrus x bretschneideri]
Length=454

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTA+T+G+HL+WLVERMIELRVAD+AVKEWS Q +FTADLQRAF+DDAWRN 
Sbjct  274  EAIQRLNLHTALTHGKHLVWLVERMIELRVADSAVKEWSEQPAFTADLQRAFQDDAWRNI  333

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKD-NVSPMMPNHKQL  386
            VPGLP+V+LRCT +LANAV+ GTIL   QVR KLVK+WLPVLI CKD N SP+  ++K L
Sbjct  334  VPGLPSVLLRCTSRLANAVASGTILVAAQVRKKLVKDWLPVLIVCKDTNASPLTSSNKPL  393

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
            YL+LEETFLRIISTLP+SD+QELLQQCLSFSTRNV DCPHL++AF TWFRRA  S
Sbjct  394  YLDLEETFLRIISTLPMSDSQELLQQCLSFSTRNV-DCPHLVTAFNTWFRRATHS  447



>ref|XP_010942871.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Elaeis 
guineensis]
Length=482

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LH AM N RHLLWLVERMIELRVAD AV+EWS Q +  ADLQR FRDDAWRN 
Sbjct  302  EAIQRLSLHKAMVNARHLLWLVERMIELRVADMAVREWSEQATLVADLQRTFRDDAWRNI  361

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGLP++V+RCT +LANAV+ G+ILA  QVRMKLVK WLPVL  C+D VSPM   HK LY
Sbjct  362  APGLPSLVMRCTSRLANAVAAGSILAPGQVRMKLVKEWLPVLNVCRDMVSPMPSGHKMLY  421

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             E+EE FL IISTLP+SDAQELLQQCLSFSTRNV+DCPHLISAF TWFRRANR
Sbjct  422  QEMEEIFLSIISTLPMSDAQELLQQCLSFSTRNVDDCPHLISAFNTWFRRANR  474



>ref|XP_004507442.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Cicer 
arietinum]
Length=491

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 2/171 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAI+RLNLH A T G+HLLWLVERMIELRVAD AV+EWS Q  FTADL+RAFRDDAWRN 
Sbjct  308  EAIERLNLHKASTIGKHLLWLVERMIELRVADVAVREWSEQEPFTADLKRAFRDDAWRNI  367

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCT KLA+AV  GTILA  QVR KLV++WLPVL+ CKDNVSP   ++K LY
Sbjct  368  VPGLPAVILRCTSKLAHAVCAGTILASTQVRRKLVEDWLPVLVVCKDNVSPA--SNKALY  425

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LELEETFL+IISTLP+SDAQELLQQCLSFSTRNVEDCPHL++AF TWFRRA
Sbjct  426  LELEETFLQIISTLPMSDAQELLQQCLSFSTRNVEDCPHLVTAFNTWFRRA  476



>ref|XP_010942018.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942019.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010942020.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X1 [Elaeis guineensis]
Length=495

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAI RL+LH AM N RHLLWLVERMIELRV D AV+EWS Q +  ADLQR FRDDAWRN 
Sbjct  315  EAIHRLSLHKAMVNARHLLWLVERMIELRVVDMAVREWSEQAALVADLQRTFRDDAWRNI  374

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGL ++V+RCT +LANAV+ G+ILA RQVRMKLVK WLPVL  C+D VSP+   HK  Y
Sbjct  375  APGLSSLVMRCTSRLANAVAAGSILAPRQVRMKLVKEWLPVLNVCRDMVSPIPSGHKMFY  434

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             E+EETFLRIISTLP+SDA+ELLQQCLSFSTRNV+DCPHLISAF TWFRRANR
Sbjct  435  HEMEETFLRIISTLPMSDAKELLQQCLSFSTRNVDDCPHLISAFNTWFRRANR  487



>ref|XP_010935064.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Elaeis 
guineensis]
Length=482

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+L+ AM N RHLLWLVERMIELRVAD AV+EWS Q +  ADLQR FRDDAWRN 
Sbjct  302  EAIQRLSLYKAMVNARHLLWLVERMIELRVADMAVREWSEQAALVADLQRTFRDDAWRNI  361

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PG P++V+RCT +LANAV+ G+ILA RQVRM+LVK WLPVL  C+D VSPM   HK LY
Sbjct  362  APGFPSLVMRCTSRLANAVAAGSILAPRQVRMRLVKEWLPVLNVCRDMVSPMPSGHKMLY  421

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             E+EE FL IISTLP+SDAQELLQQCLSFSTRNV+DCPHLI AF TWFRRANR
Sbjct  422  QEMEEIFLSIISTLPMSDAQELLQQCLSFSTRNVDDCPHLILAFNTWFRRANR  474



>ref|XP_008787306.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Phoenix 
dactylifera]
Length=488

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LH AM N RHLLWLVERMIELRVAD AV+EWS Q +  ADLQR FRDDAWRN 
Sbjct  308  EAIQRLSLHKAMVNARHLLWLVERMIELRVADMAVREWSEQAALVADLQRTFRDDAWRNI  367

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGL ++V+RCT +LANAV+ G+ILA RQVRMKLVK WLPVL  C+D VSP+    K LY
Sbjct  368  APGLSSLVMRCTSRLANAVAAGSILAPRQVRMKLVKEWLPVLNVCRDMVSPIPSGQKMLY  427

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
             E+EETFL IISTLP+S+A+ELLQQCLSFSTRNV+DCPHLISAF TWFRRANRS
Sbjct  428  HEMEETFLMIISTLPMSNAKELLQQCLSFSTRNVDDCPHLISAFNTWFRRANRS  481



>ref|XP_010939281.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Elaeis guineensis]
Length=466

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH  M N +HL WLVERMIELRVADTAVKEWS Q +  ADLQ+ FRDDAW+N 
Sbjct  286  EAIQRLNLHATMVNVKHLHWLVERMIELRVADTAVKEWSEQAALAADLQKTFRDDAWKNI  345

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGLP +V RCTC+LAN+V+ G+ LA RQVRM+ VK+WLPVL  C+D  SPM   HK ++
Sbjct  346  APGLPTLVARCTCRLANSVASGSTLAPRQVRMRFVKDWLPVLNVCRDVASPMPTGHKPVF  405

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             ELEETFLRIISTLP+SDAQELLQQCLSFSTRNV+DCPHL SAF TWFRRANR
Sbjct  406  QELEETFLRIISTLPMSDAQELLQQCLSFSTRNVDDCPHLTSAFQTWFRRANR  458



>ref|XP_008785748.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like, 
partial [Phoenix dactylifera]
Length=444

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH  M N +HL WLVERMIELRVADTAVKEWS Q +  ADLQ+ FRDDAW+N 
Sbjct  264  EAIQRLNLHATMVNVKHLHWLVERMIELRVADTAVKEWSEQTALAADLQKTFRDDAWKNI  323

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGLP +V RCTC+LAN+V+ G+ LA RQVRMK VKNWLPVL  C+D  SPM   HK ++
Sbjct  324  APGLPTLVARCTCRLANSVASGSTLAPRQVRMKFVKNWLPVLNVCRDVASPMPTGHKSVF  383

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             ELEETFLRIISTLP+S AQELLQQCLSFSTRNV+DCPHL SAF TWFRRANR
Sbjct  384  QELEETFLRIISTLPMSYAQELLQQCLSFSTRNVDDCPHLTSAFQTWFRRANR  436



>ref|XP_008447033.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Cucumis 
melo]
Length=480

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTN +HL WLVERMIELRVAD AV EWS Q SFTADLQRAFRDD WR  
Sbjct  303  EAIQRLNLHTAMTNAKHLSWLVERMIELRVADVAVDEWSEQASFTADLQRAFRDDGWRGI  362

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPG P+V+LRCT KLANAV+ G+ILA++QVR KLVK+WLPVL+  KD+ SP++ ++K L 
Sbjct  363  VPGFPSVLLRCTSKLANAVAAGSILANKQVRKKLVKHWLPVLLVSKDH-SPLLASNKGLC  421

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            +ELEETFLRIISTLPLSDAQELLQQCLSF TRNV+DCPHL  AF TWFRRA
Sbjct  422  MELEETFLRIISTLPLSDAQELLQQCLSF-TRNVDDCPHLFKAFNTWFRRA  471



>ref|NP_001274393.1| BTB/POZ domain-containing protein At1g63850-like [Cucumis sativus]
 gb|AGZ83151.1| BTB/POZ domain-containing zinc finger protein [Cucumis sativus]
 gb|KGN44351.1| hypothetical protein Csa_7G268480 [Cucumis sativus]
Length=480

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTN +HL WLVERMIELRVAD AV EWS Q SFTADLQRAFRDD WR  
Sbjct  303  EAIQRLNLHTAMTNAKHLSWLVERMIELRVADVAVDEWSEQASFTADLQRAFRDDGWRGI  362

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPG P+V+LRCT KLANAV+ G+ILA++QVR KLVK+WLPVL+  KD+ SP++ ++K L 
Sbjct  363  VPGFPSVLLRCTSKLANAVAAGSILANKQVRKKLVKHWLPVLLVSKDH-SPLLASNKGLC  421

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            +ELEETFLRIISTLPLSDAQELLQQCLSF TR+V+DCPHL  AF TWFRRA
Sbjct  422  MELEETFLRIISTLPLSDAQELLQQCLSF-TRHVDDCPHLFKAFNTWFRRA  471



>ref|XP_003606902.1| hypothetical protein MTR_4g070010 [Medicago truncatula]
 gb|AES89099.1| BTB/POZ domain plant-like protein, putative [Medicago truncatula]
Length=487

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 156/185 (84%), Gaps = 6/185 (3%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QR+NLH A T G+HLLWLVERM+ELRVAD AV+EWS Q +FT DL++AF +DAWRN 
Sbjct  305  EAMQRVNLHKASTIGKHLLWLVERMVELRVADAAVREWSEQEAFTGDLKKAFGEDAWRNI  364

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCT KLA+AV  GT++A  QVR KLV++WLPVL+ CKD  SP+  ++K LY
Sbjct  365  VPGLPAVILRCTSKLAHAVCAGTVVASTQVRRKLVEDWLPVLVVCKD-FSPV--SNKSLY  421

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQK-D  206
            LELEETFLRIISTLP+SDAQELLQ+CLSFSTRNVEDCPHL++AF TWFRRA  +H  K D
Sbjct  422  LELEETFLRIISTLPMSDAQELLQKCLSFSTRNVEDCPHLVTAFNTWFRRA--AHPFKLD  479

Query  205  FVCKK  191
             VC +
Sbjct  480  SVCDQ  484



>gb|ACU23336.1| unknown [Glycine max]
Length=156

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -2

Query  670  MIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLANAVSMGTI  491
            MIELRVAD AV+EWS Q  FTADLQRAF DDAWRN VPGLPAV+ RCTC+LANAVS GTI
Sbjct  1    MIELRVADVAVREWSEQAGFTADLQRAFGDDAWRNIVPGLPAVIFRCTCRLANAVSAGTI  60

Query  490  LADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQ  311
            LA RQVR KLV++WLPVL+ CKDNVS   P++K L+LELE+TFLRIISTLP+SDAQELLQ
Sbjct  61   LASRQVRRKLVQDWLPVLLVCKDNVS---PSNKSLHLELEQTFLRIISTLPMSDAQELLQ  117

Query  310  QCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            +CLSFSTRNVEDCPHL++AF TWFRRA R
Sbjct  118  RCLSFSTRNVEDCPHLVTAFNTWFRRAAR  146



>emb|CBI32585.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = -2

Query  670  MIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLANAVSMGTI  491
            MIEL+VAD AV+EWS Q +FTADLQRAFRDDAWRN VPGLP VVLRCTCKLANAV+ G+I
Sbjct  1    MIELKVADKAVREWSEQSTFTADLQRAFRDDAWRNIVPGLPVVVLRCTCKLANAVASGSI  60

Query  490  LADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQ  311
            LA R VRMKLVK WLPVLI CKDNVS ++  HK LY ELEE FLRIIST PLSDAQELLQ
Sbjct  61   LAARPVRMKLVKEWLPVLIVCKDNVS-VLHTHKSLYTELEEIFLRIISTFPLSDAQELLQ  119

Query  310  QCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDFVC  197
            QCLSF+TRNV+DCPHL++AF TWF RA R   Q D +C
Sbjct  120  QCLSFATRNVDDCPHLVTAFNTWFCRAARP-PQADSLC  156



>ref|XP_009392960.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH  M+N +HL WLVER+IE+RVADTAV+EWS Q +  ADL + FRDD W+N 
Sbjct  294  EAIQRLNLHAVMSNLKHLHWLVERIIEVRVADTAVREWSEQEALAADLMKTFRDDTWKNI  353

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGLP +V RC+ +LA+AV+ G  LA RQVRMK+V+NWLPVL   +D  SP+   ++ LY
Sbjct  354  APGLPLLVTRCSYRLADAVASGATLAPRQVRMKIVRNWLPVLNVLRDTFSPLPSGYRTLY  413

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             +LEETFL+IISTLPLSDAQELLQQCLSFSTRN++DCPHL SAF TWFRRANR
Sbjct  414  PDLEETFLKIISTLPLSDAQELLQQCLSFSTRNLDDCPHLTSAFKTWFRRANR  466



>ref|XP_009405968.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like [Musa 
acuminata subsp. malaccensis]
Length=464

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QRLNLH A+ N +HL WLVERMIELRVADTAV EWS Q +  ADLQ+ FRDDAW+N 
Sbjct  284  EAMQRLNLHAAVVNAKHLHWLVERMIELRVADTAVAEWSEQAALAADLQKTFRDDAWKNI  343

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
             PGL ++V++ T ++A AV  GT +A RQVRMKLV+ WLPVL  C+D VSPM    K + 
Sbjct  344  APGLLSLVIKSTFRVAKAVVSGTTVAPRQVRMKLVRGWLPVLNVCRDIVSPMPTGQKSVI  403

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             ELEETFL IISTLP+SD+QELLQQCLSFSTRN++DCPHLI AF TWFRRANR
Sbjct  404  QELEETFLSIISTLPMSDSQELLQQCLSFSTRNIDDCPHLILAFKTWFRRANR  456



>ref|XP_010028585.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Eucalyptus 
grandis]
 gb|KCW55349.1| hypothetical protein EUGRSUZ_I01267 [Eucalyptus grandis]
Length=484

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LH A TNGRHLLWLVERMIELRVA+ A KEWS Q +FTADL +AF D++W   
Sbjct  304  EAIQRLHLHMATTNGRHLLWLVERMIELRVAEAAAKEWSEQPNFTADLLKAFVDESWMCI  363

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPG PAV++RCT KLA A++ G ILA RQVRMKLV++WLPV+I CKD     + + K +Y
Sbjct  364  VPGFPAVMMRCTLKLAQAITAGNILAARQVRMKLVEDWLPVVIVCKDKGLATLCSSKSIY  423

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
             +LEETFL IISTLP+SDAQ LLQ+CL FSTR+ EDCPHL++AF TWFRRA+++
Sbjct  424  SDLEETFLSIISTLPMSDAQLLLQKCLCFSTRSTEDCPHLVTAFNTWFRRASQT  477



>ref|XP_001779398.1| predicted protein [Physcomitrella patens]
 gb|EDQ55788.1| predicted protein, partial [Physcomitrella patens]
Length=424

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QR NLHTA+ +GRHLLW+VERMIELRVA+TAV EWS Q +FTA+L+RAF DD WRN 
Sbjct  231  EALQRQNLHTAVVSGRHLLWIVERMIELRVAETAVVEWSEQGAFTANLKRAFSDDTWRNI  290

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNV---SPMMPNHK  392
             PGLPA+VLRCTC+LA+AV+ G+I+A +QVR+KLVK WLPVL+  ++++         +K
Sbjct  291  APGLPALVLRCTCRLASAVACGSIIASQQVRLKLVKEWLPVLVVSREHLPTSGASANQNK  350

Query  391  QLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
             L+ ELE  FL II TLP+ DAQ LLQQCLSF+TRN+EDCPHL++AF  WFRRA +
Sbjct  351  HLHQELENLFLNIILTLPMDDAQRLLQQCLSFATRNLEDCPHLVNAFNVWFRRATQ  406



>ref|XP_001770525.1| predicted protein [Physcomitrella patens]
 gb|EDQ64694.1| predicted protein [Physcomitrella patens]
Length=462

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 145/177 (82%), Gaps = 5/177 (3%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QR NLHTA+  G+HL W+VERMIEL+VA+TAV EWS Q +F A+L+RAF DD W+N 
Sbjct  273  EALQRQNLHTAVVKGKHLFWIVERMIELKVAETAVVEWSEQGAFAANLKRAFSDDTWKNI  332

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLI----ACKDNVSPMMPNH  395
             PGL ++VLRCTC+LA+AV+ G+I+A +QVR+KLVK+WLPVL+      +DN    + N 
Sbjct  333  APGLSSLVLRCTCRLASAVACGSIIASQQVRLKLVKDWLPVLVVSRNVSRDNQLSAVQN-  391

Query  394  KQLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            KQL+ ELE+ FL+II TLP+S++Q+LLQQCLSF+T+N+EDCPHL++AF  WFRRANR
Sbjct  392  KQLHQELEDVFLKIILTLPMSESQKLLQQCLSFATQNLEDCPHLVNAFNAWFRRANR  448



>dbj|BAJ99609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQ+LNLH+A+ N +HLLWL+ERM+++RVAD AVK WS QV+  ADLQ+   D D WRN
Sbjct  293  EAIQKLNLHSAVLNVKHLLWLIERMVDMRVADNAVKLWSEQVALAADLQKLLNDADMWRN  352

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT +LAN+V +G  L  RQVRMKLVK+WLPVL  C+D   PM   +K  
Sbjct  353  MAPGLPMLVTRCTLRLANSVMIGETLVPRQVRMKLVKSWLPVLNVCRDIAQPMHSGYKSS  412

Query  385  YL-ELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
               ELEETFL+IISTL + DAQELLQQCL FSTRNV+DCPHL++AF TWFRRA+RS
Sbjct  413  NCQELEETFLQIISTLSVPDAQELLQQCLGFSTRNVDDCPHLVTAFKTWFRRASRS  468



>ref|XP_003560455.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Brachypodium 
distachyon]
Length=473

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQ+LNLH+A+ N +HLLWL+ERM+++RVAD AVK WS Q    ADLQ+   D D WRN
Sbjct  292  EAIQKLNLHSAVLNVKHLLWLIERMVDMRVADNAVKLWSEQAPLAADLQKLLNDADMWRN  351

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT +LAN+V  G  L  RQVRMK+VK+WLPVL  C+D   PM   +K  
Sbjct  352  MAPGLPMLVTRCTLRLANSVVTGETLVPRQVRMKVVKSWLPVLNVCRDIAQPMHSGYKSS  411

Query  385  YL-ELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
               ELE+TFL+IISTLP+ DAQELLQQCL FSTRNV+DCPHL+SAF TWFRRA R+
Sbjct  412  NCQELEDTFLQIISTLPVPDAQELLQQCLGFSTRNVDDCPHLVSAFKTWFRRAGRA  467



>ref|XP_002983939.1| hypothetical protein SELMODRAFT_271682 [Selaginella moellendorffii]
 gb|EFJ14951.1| hypothetical protein SELMODRAFT_271682 [Selaginella moellendorffii]
Length=469

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QR NLHTA+ +GRHLLWLVERMIEL+VA+ AV EWS Q SFTA+L+RAF DD WRN 
Sbjct  294  EAMQRQNLHTAVVSGRHLLWLVERMIELKVAENAVLEWSEQSSFTANLKRAFMDDVWRNN  353

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCT +LA A+  G+IL  R+VR K+V++WLPVLI  K+N      N KQL+
Sbjct  354  VPGLPAVLLRCTSRLAQAMVTGSILVSREVRKKMVRDWLPVLITSKENAVSANCN-KQLH  412

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSH  218
              LEE FL++ISTLP+ DAQELLQQCLSF++R +++  +L  AF TWFRRA  S 
Sbjct  413  QNLEEVFLKLISTLPVGDAQELLQQCLSFASRGLDESSNLAMAFATWFRRAGASE  467



>ref|XP_002960731.1| hypothetical protein SELMODRAFT_270156 [Selaginella moellendorffii]
 gb|EFJ38270.1| hypothetical protein SELMODRAFT_270156 [Selaginella moellendorffii]
Length=469

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 1/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QR NLHTA+ +GRHLLWLVERMIEL+VA+ AV EWS Q SFTA+L+RAF DD WRN 
Sbjct  294  EAMQRQNLHTAVVSGRHLLWLVERMIELKVAENAVLEWSEQSSFTANLKRAFMDDVWRNN  353

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY  383
            VPGLPAV+LRCT +LA A+  G+IL  R+VR K+V++WLPVLI  K+N      N KQL+
Sbjct  354  VPGLPAVLLRCTSRLAQAMVTGSILVSREVRKKMVRDWLPVLITSKENAVSANCN-KQLH  412

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSH  218
              LEE FL++ISTLP+ DAQELLQQCLSF++R +++  +L  AF TWFRRA  S 
Sbjct  413  QNLEEVFLKLISTLPVGDAQELLQQCLSFASRGLDESSNLAMAFATWFRRAGASE  467



>ref|XP_006650517.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Oryza 
brachyantha]
Length=483

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNL +A+ N RHLLWL+ERM+E+RVAD AVK WS Q + TADLQ+   D D W+N
Sbjct  302  EAIQRLNLQSAVLNVRHLLWLIERMVEMRVADNAVKLWSEQAALTADLQKLLNDVDMWKN  361

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT + A++V  G  L  RQVR KLVK+WLPVL  C++ V PM   +K  
Sbjct  362  ITPGLPVLVTRCTLRFAHSVVNGETLVPRQVRTKLVKSWLPVLNVCRNMVQPMQCGYKSP  421

Query  385  YL-ELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
               ELEETFL+IISTLP+ DAQELLQQCL FSTRNV+DCPHL++AF TWFRRA R+
Sbjct  422  NCQELEETFLQIISTLPVPDAQELLQQCLGFSTRNVDDCPHLVAAFKTWFRRAGRA  477



>ref|NP_001051117.1| Os03g0723600 [Oryza sativa Japonica Group]
 gb|AAR01629.1| expressed protein [Oryza sativa Japonica Group]
 gb|AAX95681.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98613.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13031.1| Os03g0723600 [Oryza sativa Japonica Group]
 gb|EAY91702.1| hypothetical protein OsI_13343 [Oryza sativa Indica Group]
 dbj|BAG90527.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            +AIQRLNL +A+ N RHLLWL+ERM+E+RVA  AVK WS Q + TADLQ+   D D W+N
Sbjct  297  DAIQRLNLQSAVLNVRHLLWLIERMVEMRVAGNAVKLWSEQAALTADLQKLLNDVDMWKN  356

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT + AN+V  G  +  RQVR KLV++WLPVL  C++ V PM   +K  
Sbjct  357  ITPGLPVLVTRCTLRFANSVVNGETIVPRQVRTKLVRSWLPVLNVCRNMVQPMQCGYKSP  416

Query  385  YL-ELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
               ELEETFL+IISTLP+ DAQELLQQCL FSTRNV+DCPHLI+AF TWFRRA R+
Sbjct  417  NCQELEETFLQIISTLPVPDAQELLQQCLGFSTRNVDDCPHLIAAFKTWFRRAGRA  472



>gb|EAZ28420.1| hypothetical protein OsJ_12401 [Oryza sativa Japonica Group]
Length=478

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            +AIQRLNL +A+ N RHLLWL+ERM+E+RVA  AVK WS Q + TADLQ+   D D W+N
Sbjct  297  DAIQRLNLQSAVLNVRHLLWLIERMVEMRVAGNAVKLWSEQAALTADLQKLLNDVDMWKN  356

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT + AN+V  G  +  RQVR KLV++WLPVL  C++ V PM   +K  
Sbjct  357  ITPGLPVLVTRCTLRFANSVVNGETIVPRQVRTKLVRSWLPVLNVCRNMVQPMQCGYKSP  416

Query  385  YL-ELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
               ELEETFL+IISTLP+ DAQELLQQCL FSTRNV+DCPHLI+AF TWFRRA R+
Sbjct  417  NCQELEETFLQIISTLPVPDAQELLQQCLGFSTRNVDDCPHLIAAFKTWFRRAGRA  472



>ref|XP_004981939.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Setaria italica]
Length=482

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNLH+A+ N +HL WL+ERM++LRVAD AV  WS+QV+   DLQ+   D D WRN
Sbjct  302  EAIQRLNLHSAVLNVKHLYWLIERMVDLRVADNAVTLWSDQVALATDLQKLLSDADMWRN  361

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT +LAN+V  G  L  RQVR KLV  WLPVL  C+  V PM  +    
Sbjct  362  MTPGLPVLVTRCTLRLANSVVTGETLVPRQVRTKLVSCWLPVLNVCRGIVQPMHFHKSTN  421

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKD  206
              ELEE FL+IISTLP+ +AQELL+QCL FSTRNV+DCPHL++AF TWFRRA R+    D
Sbjct  422  CQELEEAFLQIISTLPVPEAQELLRQCLGFSTRNVDDCPHLVAAFKTWFRRAGRAPLGGD  481

Query  205  F  203
             
Sbjct  482  I  482



>ref|XP_002466545.1| hypothetical protein SORBIDRAFT_01g009710 [Sorghum bicolor]
 gb|EER93543.1| hypothetical protein SORBIDRAFT_01g009710 [Sorghum bicolor]
Length=478

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 128/175 (73%), Gaps = 1/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNL +A+ N +HL WL+ERM++LRVA  AV  WS+Q +   DLQ+   D D WRN
Sbjct  298  EAIQRLNLQSAVLNVKHLYWLIERMVDLRVAHNAVMLWSDQAALATDLQKLLNDADMWRN  357

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT +LAN+V  G  L  RQVRM LVK+WLPVL  C+D V PM       
Sbjct  358  MTPGLPMLVTRCTLRLANSVITGETLVPRQVRMMLVKSWLPVLNVCRDIVQPMHFQKSTN  417

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
              ELEE FL+IISTLP+ +AQELLQQCL FSTRNV+DCPHL++AF TWFRRA R+
Sbjct  418  CQELEEAFLQIISTLPVPEAQELLQQCLGFSTRNVDDCPHLVAAFKTWFRRAGRA  472



>ref|NP_001144803.1| uncharacterized protein LOC100277879 [Zea mays]
 gb|ACN36063.1| unknown [Zea mays]
Length=478

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNL +A++N +HL WL+ERM++LRVAD AV  WS+Q +   DLQ+   D D WRN
Sbjct  298  EAIQRLNLQSAVSNVKHLYWLIERMVDLRVADNAVTLWSDQAALATDLQKLLNDADMWRN  357

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT KLAN+V  G  L  RQVR  LV++WLPVL  C+D V PM       
Sbjct  358  MTPGLPMLVTRCTLKLANSVITGETLVPRQVRRMLVRSWLPVLNVCRDIVQPMHSQKSTN  417

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
              ELE  FL+IISTLP  +AQELLQQCL FSTRNV+DCPHL++AF TWFRRA R+
Sbjct  418  CQELEGAFLQIISTLPFLEAQELLQQCLGFSTRNVDDCPHLVTAFKTWFRRAGRA  472



>gb|ACG43083.1| hypothetical protein [Zea mays]
 gb|AFW67769.1| hypothetical protein ZEAMMB73_894611 [Zea mays]
Length=478

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNL +A+ N +HL WL+ERM++LRVAD AV  WS+Q +   DLQ+   D D WRN
Sbjct  298  EAIQRLNLQSAVLNVKHLYWLIERMVDLRVADNAVTLWSDQAALATDLQKLLNDADMWRN  357

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL  386
              PGLP +V RCT KLAN+V  G  L  RQVR  LV++WLPVL  C+D V PM       
Sbjct  358  MTPGLPMLVTRCTLKLANSVITGETLVPRQVRRMLVRSWLPVLNVCRDIVQPMHSQKSTN  417

Query  385  YLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
              ELE  FL+IISTLP  +AQELLQQCL FSTRNV+DCPHL++AF TWFRRA R+
Sbjct  418  CQELEGAFLQIISTLPFLEAQELLQQCLGFSTRNVDDCPHLVTAFKTWFRRAGRA  472



>gb|EMT33092.1| hypothetical protein F775_31498 [Aegilops tauschii]
Length=280

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 135/222 (61%), Gaps = 49/222 (22%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQ+LNLH+A+ N +HLLWL+ERM+++RVAD AVK WS QV+  ADLQ+   D D WRN
Sbjct  49   EAIQKLNLHSAVLNVKHLLWLIERMVDMRVADNAVKLWSEQVALAADLQKLLNDADMWRN  108

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQ------------------------------  476
              PGLP +V RCT +LA++V +G  L  RQ                              
Sbjct  109  MAPGLPMLVTRCTLRLAHSVMIGETLVPRQVNRKLLLQISVGSNKIMHSMVKTRPSNWFE  168

Query  475  -----------------VRMKLVKNWLPVLIACKDNVSPMMPNHKQLYL-ELEETFLRII  350
                             VRMKLVK+WLPVL  C+D   PM   +K     ELEETFL+II
Sbjct  169  LLVNGDGLRFSLVRSEVVRMKLVKSWLPVLNVCRDIAQPMHSGYKSSNCQELEETFLKII  228

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            STL + DAQELLQQCL FSTRNV+DC HL++AF TWFRRA+R
Sbjct  229  STLSVPDAQELLQQCLGFSTRNVDDCQHLVTAFKTWFRRASR  270



>ref|XP_007042204.1| BTB/POZ domain-containing protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX98035.1| BTB/POZ domain-containing protein isoform 2, partial [Theobroma 
cacao]
Length=425

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 2/100 (2%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AVKEWS Q +FTADLQRAFRDDAWR
Sbjct  326  ETEAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVKEWSEQAAFTADLQRAFRDDAWR  385

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADR--QVRMKLVK  455
            N+VPGLPAVVLRCTCKLANAV+ GTI+A R  QVRMKLVK
Sbjct  386  NFVPGLPAVVLRCTCKLANAVATGTIIAARQFQVRMKLVK  425



>gb|EPS62964.1| hypothetical protein M569_11824, partial [Genlisea aurea]
Length=354

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 109/171 (64%), Gaps = 48/171 (28%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EA+QR++LHTA T+G+HLLWL+ERMIEL+VA+T                         
Sbjct  232  ETEAMQRVHLHTAATSGKHLLWLIERMIELKVANT-------------------------  266

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
                                   G I+A  QVRMKLV  WLPVLI CKD+ S M P+HK 
Sbjct  267  -----------------------GNIIAPTQVRMKLVNEWLPVLILCKDSDSTMGPSHKT  303

Query  388  LYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFR  236
            LYLELEETFLRIISTLPLS AQELLQ+CLSFSTRN++DC HL++AFTTWFR
Sbjct  304  LYLELEETFLRIISTLPLSAAQELLQRCLSFSTRNLDDCRHLVAAFTTWFR  354



>ref|XP_007042205.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOX98036.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=441

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + EAIQRLNLHTAMTNGRHLLWLVERMIELRVAD+AVKEWS Q +FTADLQRAFRDDAWR
Sbjct  326  ETEAIQRLNLHTAMTNGRHLLWLVERMIELRVADSAVKEWSEQAAFTADLQRAFRDDAWR  385

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQ  476
            N+VPGLPAVVLRCTCKLANAV+ GTI+A RQ
Sbjct  386  NFVPGLPAVVLRCTCKLANAVATGTIIAARQ  416



>ref|XP_004230913.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Solanum lycopersicum]
Length=428

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHL+WLVERMIELRVADTAV+EWSNQ +FTADL RA RDDAWRN 
Sbjct  329  EAIQRLNLHTAMTNGRHLVWLVERMIELRVADTAVQEWSNQAAFTADLLRALRDDAWRNI  388

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKL  461
            VPGLPAVVLRCTCKL+NAV+ GTILA RQVR  L
Sbjct  389  VPGLPAVVLRCTCKLSNAVATGTILATRQVRFVL  422



>gb|KJB47493.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=389

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LHTAMTNGRHLLWLVERMIEL+VAD AVK+WS Q +FT DLQ+AFRDDAWRN 
Sbjct  293  EAIQRLHLHTAMTNGRHLLWLVERMIELKVADLAVKQWSEQAAFTVDLQKAFRDDAWRNI  352

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQV  473
            VPGLPAV+LRCTCKLA+AV+ GTIL+ RQV
Sbjct  353  VPGLPAVMLRCTCKLASAVAAGTILSSRQV  382



>gb|KJB47491.1| hypothetical protein B456_008G028700 [Gossypium raimondii]
Length=393

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRL+LHTAMTNGRHLLWLVERMIEL+VAD AVK+WS Q +FT DLQ+AFRDDAWRN 
Sbjct  293  EAIQRLHLHTAMTNGRHLLWLVERMIELKVADLAVKQWSEQAAFTVDLQKAFRDDAWRNI  352

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQ  476
            VPGLPAV+LRCTCKLA+AV+ GTIL+ RQ
Sbjct  353  VPGLPAVMLRCTCKLASAVAAGTILSSRQ  381



>ref|XP_010530839.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Tarenaya hassleriana]
Length=416

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QRL+LHTAM NG+HL+W+VERMIELRVADTAVKEWS Q +FTADLQRAFRDDAWRN 
Sbjct  327  EAMQRLSLHTAMVNGKHLIWVVERMIELRVADTAVKEWSEQAAFTADLQRAFRDDAWRNM  386

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQ  476
             PGLPAVVLRCTCKLA+AV+ G+ILA RQ
Sbjct  387  APGLPAVVLRCTCKLADAVASGSILAARQ  415



>emb|CAN67577.1| hypothetical protein VITISV_015330 [Vitis vinifera]
Length=686

 Score =   161 bits (407),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLHTAMTNGRHLLWL+ERMIEL+VAD AV+EWS Q +FTADLQRAFRDDAWRN 
Sbjct  309  EAIQRLNLHTAMTNGRHLLWLIERMIELKVADKAVREWSEQSTFTADLQRAFRDDAWRNI  368

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADR  479
            VPGLP VVLRCTCKLANAV+ G+ILA R
Sbjct  369  VPGLPVVVLRCTCKLANAVASGSILAAR  396


 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 11/120 (9%)
 Frame = -2

Query  529  TCKLANAVSMGTILADRQ---------VRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE  377
            T K +N + +G  L+  +         VRMKLVK WLPVLI CKDNVS ++  HK LY E
Sbjct  569  TIKTSNLMDIGHNLSKDEIKQISFVFHVRMKLVKEWLPVLIVCKDNVS-VLHTHKSLYTE  627

Query  376  LEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDFVC  197
            LEE FLRIIST PLSDAQELLQQCLSF+TRNV+DCPHL++AF TWF RA R   Q D +C
Sbjct  628  LEEIFLRIISTFPLSDAQELLQQCLSFATRNVDDCPHLVTAFNTWFCRAARP-PQADSLC  686



>ref|XP_006856015.1| hypothetical protein AMTR_s00059p00043440 [Amborella trichopoda]
 gb|ERN17482.1| hypothetical protein AMTR_s00059p00043440 [Amborella trichopoda]
Length=129

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 4/102 (4%)
 Frame = -2

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIIS  347
            C+L N     T + + QVRMKLVK+WLPVLI CKDN +P+    K LYLELEETFLRIIS
Sbjct  25   CELENT----TPIEEMQVRMKLVKDWLPVLIVCKDNATPIPSGQKSLYLELEETFLRIIS  80

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRS  221
            TLP+S AQELLQQCL+FSTRNVE+CPHL+SAF TWFRRA R+
Sbjct  81   TLPMSHAQELLQQCLTFSTRNVEECPHLVSAFDTWFRRAARA  122



>ref|XP_006856016.1| hypothetical protein AMTR_s00059p00043870 [Amborella trichopoda]
 gb|ERN17483.1| hypothetical protein AMTR_s00059p00043870 [Amborella trichopoda]
Length=392

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EA+QRLNLH+A+ NGRHLLWLVERM E RVAD+AVKEWSN  +F ADLQRAF DDAWRN 
Sbjct  297  EALQRLNLHSAVVNGRHLLWLVERMTEFRVADSAVKEWSNLSNFAADLQRAFTDDAWRNI  356

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLV  458
             PGLPA++LRCT +L NAV+ G+IL DRQV +  V
Sbjct  357  APGLPALILRCTWRLGNAVAAGSILVDRQVDVIFV  391



>ref|XP_010942021.1| PREDICTED: BTB/POZ domain-containing protein At3g05675-like isoform 
X2 [Elaeis guineensis]
Length=407

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAI RL+LH AM N RHLLWLVERMIELRV D AV+EWS Q +  ADLQR FRDDAWRN 
Sbjct  315  EAIHRLSLHKAMVNARHLLWLVERMIELRVVDMAVREWSEQAALVADLQRTFRDDAWRNI  374

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADRQ  476
             PGL ++V+RCT +LANAV+ G+ILA RQ
Sbjct  375  APGLSSLVMRCTSRLANAVAAGSILAPRQ  403



>ref|XP_010939282.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Elaeis guineensis]
Length=373

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNY  563
            EAIQRLNLH  M N +HL WLVERMIELRVADTAVKEWS Q +  ADLQ+ FRDDAW+N 
Sbjct  286  EAIQRLNLHATMVNVKHLHWLVERMIELRVADTAVKEWSEQAALAADLQKTFRDDAWKNI  345

Query  562  VPGLPAVVLRCTCKLANAVSMGTILADR  479
             PGLP +V RCTC+LAN+V+ G+ LA R
Sbjct  346  APGLPTLVARCTCRLANSVASGSTLAPR  373



>gb|KHN13433.1| Anaphase-promoting complex subunit 4 [Glycine soja]
Length=351

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 95/146 (65%), Gaps = 14/146 (10%)
 Frame = -2

Query  748  DPEAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR  569
            + +AIQRLNLH A TNG+HLLWLVERMIELRV D AV+EWS QV FTADLQRAFRDDAWR
Sbjct  148  ETKAIQRLNLHKASTNGKHLLWLVERMIELRVVDVAVREWSEQVVFTADLQRAFRDDAWR  207

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQ  389
            N VPGLPAV+LRC  +    ++ G  L  ++  + L+    P++             H+ 
Sbjct  208  NIVPGLPAVILRCEREARRRLATGLDLLPQEEFLSLLGGASPLV-------------HQF  254

Query  388  LYLELEETFLRIISTLPLSDAQELLQ  311
            L   + E  ++ IS + LSDA + L+
Sbjct  255  LVNTVGEVGVKRISNV-LSDAGKELE  279



>gb|EMS59331.1| hypothetical protein TRIUR3_19712 [Triticum urartu]
Length=310

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 1/96 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQ+LNLH+A+ N +HLLWL+ERM+++RVAD AVK WS QV+  ADLQ+   D D WRN
Sbjct  49   EAIQKLNLHSAVLNVKHLLWLIERMVDMRVADNAVKLWSEQVALAADLQKLLNDADMWRN  108

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLV  458
              PGLP +V RCT +LA++V +G  L  RQV  KL+
Sbjct  109  MAPGLPMLVTRCTLRLAHSVMIGETLVPRQVNRKLL  144


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  466  KLVKNWLPVLIACKDNVSPMMPNHKQLYL-ELEETFLRIISTLPLSDAQELLQQCLSFST  290
            + V NW     + +D   PM   +K     ELE TFL+IISTL + DAQELLQQCL FST
Sbjct  221  RFVSNWKSA--SRRDIAQPMHSGYKSSNCQELEGTFLKIISTLSVPDAQELLQQCLGFST  278

Query  289  RNVEDCPHLISAFTTWFRRANR  224
            RNV+DC HL++AF TWFRRA+R
Sbjct  279  RNVDDCQHLVTAFKTWFRRASR  300



>ref|XP_008665335.1| PREDICTED: uncharacterized protein LOC103643943 [Zea mays]
Length=121

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  475  VRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQQCLSF  296
            VRM LV++WLPVL  C+D + PM         +LEE FL+ ISTL + +AQELLQQCL F
Sbjct  8    VRMMLVRSWLPVLNVCRDIIQPMHFQKSTNCQDLEEAFLQNISTLLVLEAQELLQQCLGF  67

Query  295  STRNVEDCPHLISAFTTWFRRANRS  221
            STRNV+DCPHL++AF TWFRRA R+
Sbjct  68   STRNVDDCPHLVAAFKTWFRRACRA  92



>ref|XP_004981940.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Setaria italica]
Length=395

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -2

Query  742  EAIQRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRD-DAWRN  566
            EAIQRLNLH+A+ N +HL WL+ERM++LRVAD AV  WS+QV+   DLQ+   D D WRN
Sbjct  302  EAIQRLNLHSAVLNVKHLYWLIERMVDLRVADNAVTLWSDQVALATDLQKLLSDADMWRN  361

Query  565  YVPGLPAVVLRCTCKLANAVSMGTILADRQVRMK  464
              PGLP +V RCT +LAN+V  G  L  RQ + +
Sbjct  362  MTPGLPVLVTRCTLRLANSVVTGETLVPRQEQFQ  395



>ref|XP_002963321.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
 gb|EFJ35192.1| hypothetical protein SELMODRAFT_270367 [Selaginella moellendorffii]
Length=450

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 21/159 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+V+ +I+  +ADT VK W++Q    +   R             +P+V    V R T
Sbjct  291  NLNWMVDILIDREIADTFVKIWASQAELASLYSR-------------IPSVYRYDVSRIT  337

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL-YLELEETFLRII  350
             +L  A+  G +L  + VR  L++ W   L+   D+   +    K L    +EE   + I
Sbjct  338  ARLCMAIGKGQVLVPQDVRFLLLQTWFQPLV---DDFGWLQRCCKSLDKKSVEEGISQTI  394

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             TLPL   Q +L       +R+  DCP+L  AF  W+RR
Sbjct  395  LTLPLKQQQFILLGWFDCFSRSAGDCPNLNRAFEVWWRR  433



>ref|XP_002974611.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
 gb|EFJ24131.1| hypothetical protein SELMODRAFT_271097 [Selaginella moellendorffii]
Length=450

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 21/159 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+V+ +I+  +ADT VK W++Q    +   R             +P+V    V R T
Sbjct  291  NLNWMVDILIDREIADTFVKIWASQAELASLYSR-------------IPSVYRYDVSRIT  337

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL-YLELEETFLRII  350
             +L  A+  G +L  + VR  L++ W   L+   D+   +    K L    +EE   + I
Sbjct  338  ARLCMAIGKGQVLVPQDVRFLLLQTWFQPLV---DDFGWLQRCCKSLDKKSVEEGISQTI  394

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             TLPL   Q +L       +R+  DCP+L  AF  W+RR
Sbjct  395  LTLPLKQQQFILLGWFDCFSRSAGDCPNLNRAFEVWWRR  433



>ref|XP_004143891.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
 ref|XP_004166918.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cucumis 
sativus]
Length=523

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +PAV    + R T
Sbjct  356  NLHWILDILIDRQIAEDFLKTWASQSELSATHSK-------------VPAVHRFEISRVT  402

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR +L++ WL   +   D+   M    + L   L E+     I
Sbjct  403  ARLFVGIGKGQLLAPKDVRYQLLQTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNTI  459

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L    +    + EDCP++   F  W+RRA   RS EQ+
Sbjct  460  LTLPLAWQQDILLAWFNRFMNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  508



>gb|KGN50074.1| hypothetical protein Csa_5G152890 [Cucumis sativus]
Length=676

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +PAV    + R T
Sbjct  509  NLHWILDILIDRQIAEDFLKTWASQSELSATHSK-------------VPAVHRFEISRVT  555

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR +L++ WL   +   D+   M    + L   L E+     I
Sbjct  556  ARLFVGIGKGQLLAPKDVRYQLLQTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNTI  612

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L    +    + EDCP++   F  W+RRA   RS EQ+
Sbjct  613  LTLPLAWQQDILLAWFNRFMNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  661



>ref|XP_007160095.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
 gb|ESW32089.1| hypothetical protein PHAVU_002G291900g [Phaseolus vulgaris]
Length=610

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +++ ++A+  +K W++Q    ADL  A            +PAV    + R T
Sbjct  443  NLHWILDILVDRQIAEDFLKTWASQ----ADLAEAHSK---------VPAVHRFEISRVT  489

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR  L+K WL   +   D+   M    K L   L E+     I
Sbjct  490  ARLFVGIGKGQLLASKDVRCLLLKTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  546

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPLS  Q++L         + EDCP++   F  W+RRA   R+ EQ+
Sbjct  547  LTLPLSWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQE  595



>ref|XP_008437316.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
 ref|XP_008437317.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Cucumis 
melo]
Length=678

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +PAV    + R T
Sbjct  511  NLHWILDILIDRQIAEDFLKTWASQSELSAAHSK-------------VPAVHRFEISRVT  557

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR +L++ WL   +   D+   M    + L   L E+     I
Sbjct  558  ARLFVGIGKGQLLAPKDVRYQLLQTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNTI  614

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L    +    + EDCP++   F  W+RRA   RS EQ+
Sbjct  615  LTLPLAWQQDILLAWFNRFMNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  663



>gb|KHN16799.1| BTB/POZ domain-containing protein [Glycine soja]
Length=429

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +++ ++A+  +K W++Q    +DL               +PAV    V R T
Sbjct  262  NLHWILDILVDRQIAEDFLKTWASQ----SDLAEVH---------SKVPAVHRFEVSRVT  308

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR  L+K WL   +   D+   M    K L   L E+     I
Sbjct  309  ARLFVGIGKGQLLASKDVRCLLLKTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  365

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPLS  Q++L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  366  LTLPLSWQQDILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQE  414



>ref|XP_009397488.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 74/154 (48%), Gaps = 15/154 (10%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKLANA  509
            WLV+ +I  R+AD  V  W++Q   +           W + +P +    + R T +L  A
Sbjct  349  WLVDILINKRIADEFVALWADQSELST----------WHSKIPCMYRFEISRITAQLCIA  398

Query  508  VSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLPLS  332
            +  G IL  +  ++ L++ WL  L    ++ S M    +    +L E+     I TLP++
Sbjct  399  IGRGQILVTKDAKISLLRTWLEALY---EDFSWMKRACRMFDKKLIEDGLSATILTLPMA  455

Query  331  DAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            + QE+L +         ++CP++  AF  W+RRA
Sbjct  456  EQQEILLRWFDCFLSKGDNCPNIQRAFEVWWRRA  489



>ref|XP_002531214.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31191.1| protein binding protein, putative [Ricinus communis]
Length=474

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +             N    +PA+    + R T
Sbjct  307  NLHWILDILIDRQIAEDFLKTWASQSELS-------------NAHSKIPALHRYEISRVT  353

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL   +   D+   M    K L   L E+     I
Sbjct  354  ARLFVGIGKGQLLALKEVRWLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  410

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  QE+L    +    + EDCP++   F  W+RRA   RS EQ+
Sbjct  411  LTLPLAWQQEILLAWFNRFLNSGEDCPNIQRGFEIWWRRAFWRRSGEQE  459



>gb|KDP25402.1| hypothetical protein JCGZ_20558 [Jatropha curcas]
Length=665

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 83/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +         DA       +PAV    V R T
Sbjct  498  NLHWILDILIDRQIAEDFLKTWASQTELS---------DAHSK----IPAVHRYEVSRVT  544

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL   +   D+   M    K L   L E+     I
Sbjct  545  ARLFVGIGKGQLLASKEVRCLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  601

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  QE+L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  602  LTLPLAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQE  650



>ref|XP_007040315.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040316.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007040319.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24816.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24817.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY24820.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=657

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +         DA       +PAV    V R T
Sbjct  490  NLHWILDILIDRQIAEDFLKSWASQSELS---------DAHSK----VPAVHRYEVSRVT  536

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +++R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  537  ARLFVGIGKGQLLASKEMRCLLLQTWL---VPFYDDFGWMRRASKGLDRHLVEDGLSNTI  593

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  QE+L         + EDCP++   F  W+RRA   RS EQ+
Sbjct  594  LTLPLAWQQEILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  642



>gb|KJB20610.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
 gb|KJB20611.1| hypothetical protein B456_003G156100 [Gossypium raimondii]
Length=638

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +             N    +PAV    V R T
Sbjct  471  NLHWILDILIDRQIAEDFLKSWASQSELS-------------NVHSKVPAVHRYEVSRVT  517

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL   +   D+   M    + L   L E+     I
Sbjct  518  ARLFVGIGKGQLLASKEVRCLLLQTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNTI  574

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++  AF  W+RRA   RS +Q+
Sbjct  575  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRAFEIWWRRAFWKRSGDQE  623



>ref|NP_001067187.1| Os12g0596600 [Oryza sativa Japonica Group]
 dbj|BAF30206.1| Os12g0596600, partial [Oryza sativa Japonica Group]
Length=233

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 76/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  W+NQ S  A+L            +P      + C T +L
Sbjct  80   NLLWLVEILVNQRICDDFVALWANQ-SKIAELH---------GKLPVASRHTVSCITARL  129

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TL
Sbjct  130  FVGIGRGEMLPSKNTRLLLLQVWLQPLI---DDYSWLQCSCRSFDRKLVEEGIGQTILTL  186

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL D + +L   L    +  ++CP+L  AF  W+RR 
Sbjct  187  PLEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWWRRT  223



>gb|KHG01374.1| hypothetical protein F383_23678 [Gossypium arboreum]
Length=640

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +             N    +PAV    V R T
Sbjct  473  NLHWILDILIDRQIAEDFLKSWASQSELS-------------NVHSKVPAVHRYEVSRVT  519

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL   +   D+   M    + L   L E+     I
Sbjct  520  ARLFVGIGKGQLLASKEVRCLLLQTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNTI  576

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++  AF  W+RRA   RS +Q+
Sbjct  577  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRAFEIWWRRAFWKRSGDQE  625



>ref|XP_004963062.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Setaria 
italica]
Length=526

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 77/156 (49%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  WS+Q    A+L          + +PG     + C T +L
Sbjct  361  NLLWLVEILVTQRICDDFVVMWSSQTEL-AELH---------SKLPGASRHTVSCITARL  410

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R++L++ WL  LI   D+ S +  + +    +L E+   + I TL
Sbjct  411  FVGIGRGEMLPSKNTRLRLLQVWLQALI---DDYSWLQCSCRSFDRKLVEDGIGQTILTL  467

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D + +L        +  ++CP+L  AF  W+RR
Sbjct  468  PLEDQRSILLSWFGRFLKLGDNCPNLQRAFEVWWRR  503



>ref|XP_008776124.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X2 [Phoenix dactylifera]
Length=507

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 82/174 (47%), Gaps = 24/174 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            ++ WLVE +I  R+ D  V  W++Q    ++L R        + +P +    + R T +L
Sbjct  343  NIQWLVEILINKRMCDEFVTLWADQ----SELARC------HSKIPCMYRYEISRITAQL  392

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE--LEETFLRIIST  344
              A+  G IL  +  R+ L++ WL  L          M +  +++ +  +E+   R+I T
Sbjct  393  CVAIGRGQILVSKDARISLLRTWLEALY----EDFGWMKSACRIFDKNVVEDGLCRMILT  448

Query  343  LPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA-------NRSHEQKDF  203
            LP++  Q +L +   +     +DCP++  AF  W+RRA        + H  K F
Sbjct  449  LPMAQQQTILLKWFDYFLNKGDDCPNIQRAFEVWWRRAFVRQYAGTQDHSGKSF  502



>ref|XP_003532421.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
 ref|XP_006584729.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Glycine max]
Length=538

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +++ ++A+  +K W++Q    +DL               +PAV    V R T
Sbjct  371  NLHWILDILVDRQIAEDFLKTWASQ----SDLAEVHSK---------VPAVHRFEVSRVT  417

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR  L+K WL   +   D+   M    K L   L E+     I
Sbjct  418  ARLFVGIGKGQLLASKDVRCLLLKTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  474

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPLS  Q++L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  475  LTLPLSWQQDILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQE  523



>ref|XP_008776113.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like isoform 
X1 [Phoenix dactylifera]
Length=509

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 78/158 (49%), Gaps = 17/158 (11%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            ++ WLVE +I  R+ D  V  W++Q    ++L R        + +P +    + R T +L
Sbjct  343  NIQWLVEILINKRMCDEFVTLWADQ----SELARC------HSKIPCMYRYEISRITAQL  392

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE--LEETFLRIIST  344
              A+  G IL  +  R+ L++ WL  L          M +  +++ +  +E+   R+I T
Sbjct  393  CVAIGRGQILVSKDARISLLRTWLEALY----EDFGWMKSACRIFDKNVVEDGLCRMILT  448

Query  343  LPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LP++  Q +L +   +     +DCP++  AF  W+RRA
Sbjct  449  LPMAQQQTILLKWFDYFLNKGDDCPNIQRAFEVWWRRA  486



>ref|XP_003524451.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Glycine max]
Length=564

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +++ ++A+  +K W++Q    +DL  A            +PAV    V R T
Sbjct  397  NLHWILDILVDRQIAEDFLKTWASQ----SDLAEAHSK---------VPAVHRFEVSRVT  443

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA + VR  L+K WL   +   D+   M    K L   L E+     I
Sbjct  444  ARLFVGIGKGQLLASKDVRCLLLKTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  500

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL   Q++L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  501  LTLPLPCQQDILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQE  549



>ref|XP_002299517.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
 gb|EEE84322.2| hypothetical protein POPTR_0001s09710g [Populus trichocarpa]
Length=656

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 80/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +    +             +PAV    V R T
Sbjct  489  NLHWILDILIDRQIAEEFLKTWASQSELSGVHSK-------------IPAVHRYEVSRVT  535

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  536  ARLFVGIGKGQLLASKEARCLLLQTWL---VPFYDDFGWMRRTSKGLDRHLIEDGLSNTI  592

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++   F  W+RRA   RS EQ+
Sbjct  593  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  641



>ref|XP_011080923.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Sesamum 
indicum]
Length=532

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L WL++ +I+ ++AD  +K W++Q    +DL  A       + VP +    V R T +L
Sbjct  365  NLHWLLDILIDRQIADDFLKMWASQ----SDLSEA------HSKVPAIHRYEVSRVTARL  414

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I TL
Sbjct  415  LVGIGKGQLLASKEARCMLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTILTL  471

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            P++  QE+L           +DCP++   F  W+RRA
Sbjct  472  PMAWQQEILLSWFDRFLNAGDDCPNIQRGFEVWWRRA  508



>ref|XP_010089067.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB37314.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=437

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 25/170 (15%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFT-ADLQRAFRDDAWRNYVPGLPAV----VLRC  530
            +L W+++ +I+ ++A+  +K W++Q     A L+              +PA+    V R 
Sbjct  270  NLHWILDILIDRQIAEDFLKTWASQTELAEAHLK--------------VPAIHRYEVSRV  315

Query  529  TCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRI  353
            T +L   +  G +LA + VR  L++ WL   +   D+   M    + L   L E+     
Sbjct  316  TARLFVGIGKGQLLASKDVRGLLLRTWL---VPFYDDFGWMRRASRGLDRHLIEDGLSNT  372

Query  352  ISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
            I TLPL+  Q++L    +    + EDCP++   F  W+RRA   RS EQ+
Sbjct  373  ILTLPLAWQQDILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  422



>gb|KHG02986.1| hypothetical protein F383_23864 [Gossypium arboreum]
Length=646

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +    +             +P V    V R T
Sbjct  479  NLHWILDILIDRQIAEEFLKTWASQSELSGAHSK-------------VPVVHRFEVSRVT  525

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL   +   D+   M    K L   L E+     I
Sbjct  526  ARLFVGIGKGQLLASKEVRWLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNSI  582

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  QE+          + EDCP++   F  W+RRA   RS EQ+
Sbjct  583  LTLPLAWQQEIFLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  631



>ref|NP_001053645.1| Os04g0579700 [Oryza sativa Japonica Group]
 emb|CAE03270.1| OSJNBa0011J08.25 [Oryza sativa Japonica Group]
 emb|CAD41158.2| OSJNBa0064M23.3 [Oryza sativa Japonica Group]
 dbj|BAF15559.1| Os04g0579700 [Oryza sativa Japonica Group]
 gb|EAY95268.1| hypothetical protein OsI_17091 [Oryza sativa Indica Group]
 gb|EAZ31736.1| hypothetical protein OsJ_15888 [Oryza sativa Japonica Group]
Length=533

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 75/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ ++E ++A+  ++ W+ Q+   A+L            VP +    V R T +L
Sbjct  367  NLHWMLDILVERQIAEDFLRTWAMQIEL-AELH---------GKVPAIHRYEVSRVTARL  416

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  ++VR +L+  WL       ++   M    K L   L E+     I TL
Sbjct  417  FVGVGKGQILVSKEVRCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTILTL  473

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  474  PLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  510



>gb|ABG22069.1| expressed protein [Oryza sativa Japonica Group]
Length=510

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 76/156 (49%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  W+NQ S  A+L            +P      + C T +L
Sbjct  357  NLLWLVEILVNQRICDDFVALWANQ-SKIAELH---------GKLPVASRHTVSCITARL  406

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TL
Sbjct  407  FVGIGRGEMLPSKNTRLLLLQVWLQPLI---DDYSWLQCSCRSFDRKLVEEGIGQTILTL  463

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  464  PLEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWWRR  499



>gb|ABA99196.2| expressed protein [Oryza sativa Japonica Group]
Length=513

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 76/156 (49%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  W+NQ S  A+L            +P      + C T +L
Sbjct  357  NLLWLVEILVNQRICDDFVALWANQ-SKIAELH---------GKLPVASRHTVSCITARL  406

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TL
Sbjct  407  FVGIGRGEMLPSKNTRLLLLQVWLQPLI---DDYSWLQCSCRSFDRKLVEEGIGQTILTL  463

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  464  PLEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWWRR  499



>ref|XP_004300808.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Fragaria 
vesca subsp. vesca]
Length=616

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 79/165 (48%), Gaps = 15/165 (9%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L W+++ +I+ ++A+  +K W++Q   +    +     A   Y       V R T +L 
Sbjct  450  NLHWILDILIDRQMAEDFLKTWASQTELSESHSKVA---AVHRYE------VSRVTARLF  500

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G +LA + VR  L++ WL   +   D+   M    K L   L E+     I TLP
Sbjct  501  VGIGKGQLLASKDVRFLLLRTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLP  557

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
            L+  QE+L    +    + EDCP++   F  W+RR+   R+ EQ+
Sbjct  558  LAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRSFWRRNGEQE  602



>gb|EPS62176.1| hypothetical protein M569_12618 [Genlisea aurea]
Length=524

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 75/159 (47%), Gaps = 22/159 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+V  +I+ ++ +   + W++Q    A   R             +PA+    + R T
Sbjct  364  NLQWIVGILIDRKMGEEVARVWADQEELAALHSR-------------VPAMYRHEISRVT  410

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIIS  347
             +L  ++  G +LA ++ R++L+  WL  L    D+ + M     +  +E  E   R + 
Sbjct  411  AQLCVSIGKGEVLAPKETRVRLLSTWLEALY---DDFAWMRAAMDRKGIE--EGLCRTVL  465

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            TLPL++ Q +L + L       + CP +  AF  W+RRA
Sbjct  466  TLPLAEQQAVLLRWLDRYVDGGDGCPDMRRAFEIWWRRA  504



>ref|XP_010676445.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Beta 
vulgaris subsp. vulgaris]
Length=585

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 13/156 (8%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L W+++ +I+ ++A+  +K W++Q   +          A     P     + R T +L 
Sbjct  417  NLHWILDILIDRQIAEDFLKTWASQSEMSK---------AHSKVPPVHRFEISRVTARLF  467

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G +LA + VR  L++ WL   +   D+   M    K L   L E+     I TLP
Sbjct  468  VGIGKGQLLASKDVRCLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTILTLP  524

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            LS  QE+L         + EDCP++   F  W+RRA
Sbjct  525  LSWQQEILLAWFDRFLNSGEDCPNIQRGFEVWWRRA  560



>gb|KEH21112.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=595

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W+++    ++L  A            +PAV    V R T
Sbjct  428  NLHWILDILIDRQIAEDFLKMWASE----SELSEAHSK---------VPAVHRFEVSRVT  474

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L+K WL   +   D+   M    K L   + E+     I
Sbjct  475  ARLFVGIGKGQLLATKEARCLLLKTWL---VPFYDDFGWMRRASKGLDRHIIEDGLSNTI  531

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQ  212
             TLPLS  QE+L    +    + EDCP++   F  W+RRA   R+ EQ
Sbjct  532  LTLPLSWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQ  579



>ref|NP_001169621.1| uncharacterized protein LOC100383502 [Zea mays]
 gb|ACN34307.1| unknown [Zea mays]
Length=546

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E ++A+  ++ W+ Q    A  ++             +PA+    V R T
Sbjct  380  NLHWMLDILVERQIAEDFLRTWATQTELAAMHRK-------------VPAIHRYEVSRVT  426

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  427  ARLFVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  483

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  484  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  523



>ref|XP_004976580.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Setaria 
italica]
Length=549

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 75/160 (47%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E ++A+  ++ W+ Q    A++ R             +PA+    V R T
Sbjct  383  NLHWMLDILVERQIAEEFLRTWAMQTEL-AEMHRK------------VPAIHRYEVSRVT  429

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  430  ARLFVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  486

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  487  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  526



>dbj|BAJ95813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 74/158 (47%), Gaps = 19/158 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            +LLWLVE ++  R+ D  V  W++Q    S  A L  A R              V   T 
Sbjct  371  NLLWLVEILVNQRICDDFVVMWASQSELASLHAKLPIASRH------------TVSSITA  418

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L   +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I 
Sbjct  419  RLFVGIGRGEMLPSKDTRLLLLQVWLQALI---DDYSWLQCSCRSFDRKLVEEGIGQTIL  475

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            TLPL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  476  TLPLEDQRSILLSWLGRFLKLGDNCPNLQRAFEVWWRR  513



>gb|EEE53535.1| hypothetical protein OsJ_36742 [Oryza sativa Japonica Group]
Length=1123

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 76/156 (49%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  W+NQ S  A+L            +P      + C T +L
Sbjct  357  NLLWLVEILVNQRICDDFVALWANQ-SKIAELH---------GKLPVASRHTVSCITARL  406

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TL
Sbjct  407  FVGIGRGEMLPSKNTRLLLLQVWLQPLI---DDYSWLQCSCRSFDRKLVEEGIGQTILTL  463

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  464  PLEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWWRR  499



>gb|AIB05883.1| TRAF transcription factor, partial [Zea mays]
Length=606

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E ++A+  ++ W+ Q    A  ++             +PA+    V R T
Sbjct  440  NLHWMLDILVERQIAEDFLRTWATQTELAAMHRK-------------VPAIHRYEVSRVT  486

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  487  ARLFVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  543

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  544  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  583



>gb|AFW59116.1| hypothetical protein ZEAMMB73_743291 [Zea mays]
Length=606

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E ++A+  ++ W+ Q    A  ++             +PA+    V R T
Sbjct  440  NLHWMLDILVERQIAEDFLRTWATQTELAAMHRK-------------VPAIHRYEVSRVT  486

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  487  ARLFVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  543

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  544  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  583



>ref|NP_001168062.1| hypothetical protein [Zea mays]
 ref|XP_008671020.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Zea 
mays]
 gb|ACN26975.1| unknown [Zea mays]
 tpg|DAA42716.1| TPA: hypothetical protein ZEAMMB73_494397 [Zea mays]
 tpg|DAA53077.1| TPA: hypothetical protein ZEAMMB73_512829 [Zea mays]
Length=545

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 72/164 (44%), Gaps = 29/164 (18%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWL E + E   AD     W++Q    A+L            +P +   ++ C T +L
Sbjct  377  NLLWLAEILSERHAADELTAIWASQTELAAELH---------PRIPVMHRHLVSCVTARL  427

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLY--------LELEETF  362
              AV  G  L  R+ R +L+  WLP          P+M +++ L           +E+  
Sbjct  428  LVAVGKGEALPSRETRRRLLDVWLP----------PLMDDYRWLQHGCRWFDRAAVEDGI  477

Query  361  LRIISTLPLSDAQELLQQCLS-FSTRNVEDCPHLISAFTTWFRR  233
             + + TLPL + Q +L   L  F     + CP+L  AF  W+RR
Sbjct  478  GQAVLTLPLEEQQAVLLAWLGRFLRAGGDGCPNLQRAFEVWWRR  521



>gb|KJB20225.1| hypothetical protein B456_003G139200 [Gossypium raimondii]
Length=513

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 74/157 (47%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            +L W+V+ +IE R+A+  VK W++Q    A+L          + +P +    + R T +L
Sbjct  347  NLQWIVDILIEKRMANDFVKLWADQREL-AELH---------SKIPTMYRHGISRITAQL  396

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G IL  ++ R  L+  WL  L    D+   M    K +  +L E+     I TL
Sbjct  397  CIAIGRGNILVGKESRFSLLATWLEALY---DDFGWMRSASKSVDKKLVEDGLSHTILTL  453

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             +   Q +L +         +DCP++  AF  W+RRA
Sbjct  454  SMRQQQAILLKWFDRFLNKGDDCPNIQRAFEVWWRRA  490



>ref|XP_008238939.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Prunus 
mume]
Length=643

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 79/165 (48%), Gaps = 15/165 (9%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L W+++ +I+ ++A+  +K W++Q+  +         +A           V R T +L 
Sbjct  476  NLHWILDILIDRQIAEDFLKTWASQIELS---------EAHSKVAAVYRYEVSRVTARLF  526

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL-YLELEETFLRIISTLP  338
              +  G +L  + VR  L++ WL   +   D+ + M    K L    +E+     I TLP
Sbjct  527  VGLGKGQLLVSKDVRFLLLQTWL---VPFYDDFAWMRRASKGLDRHSIEDGLSNTILTLP  583

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
            L+  QE+L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  584  LAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQE  628



>ref|XP_006664162.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=516

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (49%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE ++  R+ D  V  W++Q S  A+L            +P      + C T +L
Sbjct  363  NLLWLVEILVNQRICDDFVTLWASQ-SEIAELH---------GKLPVASRHTVSCVTARL  412

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TL
Sbjct  413  FVGIGRGEMLPSKNTRLLLLQVWLQALI---DDYSWLQCSCRSFDRKLVEEGIGQTILTL  469

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  470  PLEDQRSMLLAWLGRFLKLGDNCPNLQRAFEVWWRR  505



>gb|KDP44149.1| hypothetical protein JCGZ_05616 [Jatropha curcas]
Length=510

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 71/167 (43%), Gaps = 35/167 (21%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+ + +I+ + AD  VK W++Q    +               P +P +    + + T
Sbjct  344  NLQWIADILIDKKAADEFVKLWADQKELAS-------------LHPKVPTIYRHEISKIT  390

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLI--------ACKDNVSPMMPNHKQLYLELE  371
             +L  A+  G IL  ++ R  L+  WL  L         ACK          K+L   +E
Sbjct  391  AQLCIAIGRGQILVPKETRFSLLSTWLEALYEDFGWIRRACK-------SVDKKL---VE  440

Query  370  ETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            +   R I TLPL   Q +L           +DCP++  AF  W+RRA
Sbjct  441  DGLGRTILTLPLLQQQAILLNWFDRFLNKGDDCPNIQRAFEVWWRRA  487



>ref|XP_002446981.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
 gb|EES11309.1| hypothetical protein SORBIDRAFT_06g026230 [Sorghum bicolor]
Length=552

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E ++A+  ++ W+ Q    A  ++             +PA+    V R T
Sbjct  386  NLHWMLDILVERQIAEEFLRTWAMQTELAAMHRK-------------VPAIHRYEVSRVT  432

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  433  ARLFVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  489

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  490  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  529



>ref|XP_011015247.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Populus euphratica]
Length=621

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +P +    V R T
Sbjct  454  NLHWILDILIDRQIAEDFLKTWASQSELSAVHSK-------------IPTIHRYEVSRVT  500

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  501  ARLFVGIGKGQLLASKEARSLLLQTWL---VPFYDDFGWMRRATKGLDRHLIEDGLSNTI  557

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++   F  W+RRA   R  EQ+
Sbjct  558  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRGGEQE  606



>ref|XP_011022633.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=658

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +P +    V R T
Sbjct  491  NLHWILDILIDRQIAEDFLKTWASQSELSAVHSK-------------IPTIHRYEVSRVT  537

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  538  ARLFVGIGKGQLLASKEARSLLLQTWL---VPFYDDFGWMRRATKGLDRHLIEDGLSNTI  594

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++   F  W+RRA   R  EQ+
Sbjct  595  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRGGEQE  643



>ref|XP_004503685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Cicer 
arietinum]
Length=609

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 80/168 (48%), Gaps = 23/168 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W+++   + +  +             +PAV    V R T
Sbjct  442  NLHWILDILIDRQIAEDFLKTWASESELSEEHSK-------------VPAVHRFEVSRVT  488

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L+K WL   +   D+   M    K L   L E+     I
Sbjct  489  ARLFVGIGKGQLLASKDARCLLLKTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  545

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQ  212
             TLPLS  QE+L    +    + EDCP++   F  W+RRA   R+ EQ
Sbjct  546  LTLPLSWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWKRNGEQ  593



>ref|XP_011015245.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Populus euphratica]
Length=658

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +P +    V R T
Sbjct  491  NLHWILDILIDRQIAEDFLKTWASQSELSAVHSK-------------IPTIHRYEVSRVT  537

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  538  ARLFVGIGKGQLLASKEARSLLLQTWL---VPFYDDFGWMRRATKGLDRHLIEDGLSNTI  594

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++   F  W+RRA   R  EQ+
Sbjct  595  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRGGEQE  643



>ref|XP_002968764.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
 gb|EFJ29880.1| hypothetical protein SELMODRAFT_90136 [Selaginella moellendorffii]
Length=464

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 75/159 (47%), Gaps = 24/159 (15%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCTCKL  518
            WL E +I+  VA+  V  WS +    A + R             LPA+    V R T +L
Sbjct  311  WLAELLIDRGVAEELVHIWSRESQLAA-MHRL------------LPAMQRHEVSRITARL  357

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMP-NHKQLYLE---LEETFLRII  350
               +  G I+A +QVR  L+  WL  L+   D+ S M     K  +L+   +EE   + I
Sbjct  358  CIGIGRGQIMAPQQVRALLLATWLEPLM---DDFSWMQRLGSKITFLDKKTVEEGLCQTI  414

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             TL L + + +L       +R+ ++CP+L  AF  W+RR
Sbjct  415  LTLSLEEQRSILMSWFEKFSRDGDNCPNLQRAFEVWWRR  453



>gb|EMS65337.1| hypothetical protein TRIUR3_32744 [Triticum urartu]
Length=559

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 75/155 (48%), Gaps = 13/155 (8%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            ++LWLVE ++  R+ D  V  W++Q      L  A    A R+ V  +       T +L 
Sbjct  406  NILWLVEILVNQRICDDFVVMWASQSELA--LLHAKLPIASRHTVSSI-------TARLF  456

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I TLP
Sbjct  457  VGIGRGEMLPSKDTRLLLLQVWLQALI---DDYSWLQCSCRSFDRKLVEEGIGQTILTLP  513

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            L D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  514  LEDQRSILLSWLGRFLKLGDNCPNLQRAFEVWWRR  548



>ref|XP_010243288.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
 ref|XP_010243289.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=538

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 72/156 (46%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWL+E + + + AD     W++Q        R          +P +   ++ C T +L
Sbjct  368  NLLWLLEILADRQAADEFALIWASQQELATLHSR----------LPTVSRHLISCITARL  417

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G IL  +  R+ L++ WL  LI   D+ S +    +    ++ EE   R I TL
Sbjct  418  FVGIGRGEILPSKDTRLLLLQTWLQPLI---DDYSWLQHGCRSFDRKVVEEGMGRTILTL  474

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D Q +L   L    +  + CP+L  AF  W+RR
Sbjct  475  PLEDQQSILLSWLGSFLKAGDSCPNLQRAFEVWWRR  510



>ref|XP_007210316.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
 gb|EMJ11515.1| hypothetical protein PRUPE_ppa002210mg [Prunus persica]
Length=700

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/165 (27%), Positives = 78/165 (47%), Gaps = 15/165 (9%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L W+++ +I+ ++A+  +K W++Q   +         +A           V R T +L 
Sbjct  533  NLHWILDILIDRQIAEDFLKTWASQTELS---------EAHSKVAAVYRYEVSRVTARLF  583

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL-YLELEETFLRIISTLP  338
              +  G +L  + VR  L++ WL   +   D+ + M    K L    +E+     I TLP
Sbjct  584  VGLGKGQLLVSKDVRFLLLRTWL---VPFYDDFAWMRRASKGLDRHSIEDGLSNTILTLP  640

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
            L+  QE+L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  641  LAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQE  685



>gb|EMT14102.1| hypothetical protein F775_07870 [Aegilops tauschii]
Length=518

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 74/158 (47%), Gaps = 19/158 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            ++LWLVE ++  R+ D  V  W++Q    S  A L  A R              V   T 
Sbjct  365  NILWLVEILVNQRICDDFVVMWASQSELASLHAKLPIASRH------------TVSSITA  412

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L   +  G +L  +  R+ L++ WL  LI   D+ S +  + +    +L EE   + I 
Sbjct  413  RLFVGIGRGEMLPSKDTRLLLLQVWLQALI---DDYSWLQCSCRSFDRKLVEEGIGQTIL  469

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            TLPL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  470  TLPLEDQRSILLSWLGRFLKLGDNCPNLQRAFEVWWRR  507



>ref|XP_010058250.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Eucalyptus grandis]
Length=523

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 77/170 (45%), Gaps = 25/170 (15%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L WL++ +I+ ++A+  +  W+++   +             +  P +PAV    V R T
Sbjct  356  NLQWLLDILIDRQIAEDFLASWASESEMS-------------DAHPKVPAVHRFEVSRVT  402

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L++ WL   +   ++   M    K L   L E+     I
Sbjct  403  ARLFVGIGKGQLLAPKDARCLLLQTWL---VPFYNDFGWMRRASKGLDRHLIEDGLSNTI  459

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA----NRSHEQ  212
             TLPL   QE++         + EDCP++   F  W+RRA    N  H+Q
Sbjct  460  LTLPLPWQQEIMLAWFDRFLNSSEDCPNIQRGFEVWWRRAFWRRNGDHQQ  509



>ref|XP_010555851.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Tarenaya 
hassleriana]
Length=539

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 78/161 (48%), Gaps = 23/161 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +  W++ +S  +++             P +PAV    + R T
Sbjct  368  NLHWVLDILIDRQIAEDFLITWAS-LSELSEMH------------PKVPAVHRYEISRVT  414

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL--YLELEETFLRI  353
             +L   +  G ILA ++VR  L++NWL       ++   M    K L  YL +EE     
Sbjct  415  ARLFVGIGKGQILAPKEVRCLLLRNWLTPFY---NDFGWMRRASKGLDRYL-IEEGLSNT  470

Query  352  ISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            I TLPL+  QE           + EDCP+L   F  W+RR+
Sbjct  471  ILTLPLAWQQEFFLAWFDRFLNSSEDCPNLQRGFEVWWRRS  511



>gb|KCW72192.1| hypothetical protein EUGRSUZ_E00642 [Eucalyptus grandis]
Length=404

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 77/170 (45%), Gaps = 25/170 (15%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L WL++ +I+ ++A+  +  W+++   +             +  P +PAV    V R T
Sbjct  237  NLQWLLDILIDRQIAEDFLASWASESEMS-------------DAHPKVPAVHRFEVSRVT  283

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L++ WL   +   ++   M    K L   L E+     I
Sbjct  284  ARLFVGIGKGQLLAPKDARCLLLQTWL---VPFYNDFGWMRRASKGLDRHLIEDGLSNTI  340

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA----NRSHEQ  212
             TLPL   QE++         + EDCP++   F  W+RRA    N  H+Q
Sbjct  341  LTLPLPWQQEIMLAWFDRFLNSSEDCPNIQRGFEVWWRRAFWRRNGDHQQ  390



>ref|XP_001772871.1| predicted protein [Physcomitrella patens]
 gb|EDQ62273.1| predicted protein [Physcomitrella patens]
Length=518

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/174 (21%), Positives = 76/174 (44%), Gaps = 7/174 (4%)
 Frame = -2

Query  724  NLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPA  545
            N H        L WL++ +  L++AD ++K +S +    A L  +      R Y      
Sbjct  338  NAHQVTLACSALRWLIDELFSLQIADMSIKIFSEEQEL-AQLMVS------RVYQNPFTE  390

Query  544  VVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEET  365
             + +   ++  A+  G ++A R VR+ L+  WLP++    ++ +       ++   +E +
Sbjct  391  TLFQILVRMLQALHKGEVIAPRSVRLALISTWLPIIAKLGNDHNDNFGRTYEIRRNVELS  450

Query  364  FLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANRSHEQKDF  203
            F  ++ TLP+ D + + +  +    +  +  P L  AF  W  +   +  + D 
Sbjct  451  FGAVVETLPMLDQEAVFKIWVGACLKCRKAWPDLSDAFDAWCSKLRAAQRESDL  504



>ref|XP_010941741.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941747.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941755.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 78/164 (48%), Gaps = 16/164 (10%)
 Frame = -2

Query  718  HTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVV  539
            H A+    +LLWLVE + +  +AD     W++Q    A+L          + +P +   +
Sbjct  358  HIAL-EADNLLWLVEILADRHIADEFAVMWASQNEL-AELH---------SKLPIMSRHL  406

Query  538  LRC-TCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EET  365
            + C T +L  A+  G +L  +  R  L+  WL  LI   D+ S +    +    ++ EE 
Sbjct  407  ISCITARLFVAIGRGEMLPSKDTRQLLLHVWLQPLI---DDYSWLQHGCRSFDRKVVEEG  463

Query  364  FLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
              R I TLPL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  464  IGRTILTLPLEDQQNILLSWLGSFLKVGDNCPNLQRAFEVWWRR  507



>ref|XP_006400887.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
 gb|ESQ42340.1| hypothetical protein EUTSA_v10013333mg [Eutrema salsugineum]
Length=500

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 72/162 (44%), Gaps = 24/162 (15%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            ++LW+V+ +IE ++ D  VK W++Q                 N    +P +    + + T
Sbjct  336  NMLWMVDILIEKKMCDEFVKLWADQKELA-------------NLHSKIPTMYRHEISKIT  382

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVL---IACKDNVSPMMPNHKQLYLELEETFLR  356
             ++   +  G IL +R+ R  ++  WL  L         +S    + K +   L +T L 
Sbjct  383  AQICVGIGKGRILVNRETRFAVLNTWLEALYDDFGWMRRLSSRTLDRKVVEDGLSQTIL-  441

Query  355  IISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
               TL L   Q +L +      RN +DCP++  AF  W+RRA
Sbjct  442  ---TLSLRQQQVILMKWFDRFLRNGDDCPNVQRAFEVWWRRA  480



>ref|XP_009389780.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 72/160 (45%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++AD  ++ W+ Q   +                P +PA+    V R T
Sbjct  481  NLHWILDILIDRQIADDFLRTWACQAELS-------------EMHPRVPAIHRYEVSRVT  527

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L  AV  G IL  ++ R  L++ WL       ++   M    K L   L E+     I
Sbjct  528  ARLFVAVGKGQILVSKEARCLLLRTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  584

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L           +DCP++   F  W+RRA
Sbjct  585  LTLPLATQQEILLAWFDRFLNAGDDCPNIQRGFEVWWRRA  624



>ref|XP_011029330.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Populus 
euphratica]
Length=648

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 79/169 (47%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +             +    +PAV    V R T
Sbjct  481  NLHWILDILIDRQIAEEFLKTWASQSELS-------------DVHSKIPAVHRYEVSRVT  527

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  528  ARLFVGIGKGQLLASKEARCLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  584

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++L         + EDCP++   F  W+RRA   RS E +
Sbjct  585  LTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEHE  633



>ref|XP_006652685.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Oryza 
brachyantha]
Length=532

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ ++E ++A+  ++ W+ Q+   A+L            VP +    V R T +L
Sbjct  366  NLHWMLDILVERQIAEDFLRTWAMQIEL-AELH---------GKVPAIHRYEVSRVTARL  415

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I TL
Sbjct  416  FVGVGKGQILVSKEARCQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTILTL  472

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL   QE+L    +    + EDCP++   F  W+RRA
Sbjct  473  PLPTQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  509



>gb|AAR14275.1| predicted protein [Populus tremula x Populus alba]
Length=533

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 78/169 (46%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +             +    +PAV    V R T
Sbjct  366  NLHWILDILIDRQIAEEFLKTWASQSELS-------------DVHSKIPAVHRYGVSRVT  412

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++ R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  413  ARLFVGIGKGQLLASKEARCLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNTI  469

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  Q++          + EDCP++   F  W+RRA   RS E +
Sbjct  470  LTLPLAWQQDIFLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEHE  518



>gb|KJB37507.1| hypothetical protein B456_006G208800 [Gossypium raimondii]
Length=613

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 77/161 (48%), Gaps = 22/161 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +PA+    V R T
Sbjct  466  NLHWILDILIDRQIAEDFLKSWASQSELSATHSK-------------VPAIHRFEVSRVT  512

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPN-HKQLYLEL-EETFLRI  353
             +L   +  G +LA ++ R  L++ WL   +   ++   MM    K L   L E+     
Sbjct  513  ARLFVGIGKGQLLASKEARFLLLQTWL---VPFYNDFGWMMRRASKGLDRHLIEDGLSNT  569

Query  352  ISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            I TLPL+  Q++L         + EDCP++   F  W+RRA
Sbjct  570  ILTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRA  610



>ref|XP_011086477.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X2 [Sesamum indicum]
 ref|XP_011086478.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X2 [Sesamum indicum]
Length=439

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 15/163 (9%)
 Frame = -2

Query  691  LLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLAN  512
            L W  + + +L +++  V  W   V  + ++ +     +  + + G    VL  T K+  
Sbjct  263  LSWASQIVTKLEISNDFVYTW---VETSVNIVKVAERVSPESSLTGTKLKVLEVTAKVLE  319

Query  511  AVSMGTILADRQVRMKLVKNWLPVLIACKDNVSP---------MMPNHKQLYLELEETFL  359
            A+  GT++     R+ +VK WLP +   K  V           M+ +  +L+  LE  F+
Sbjct  320  AIGYGTVILPTTRRLHMVKVWLPFVRIVKSAVDSVGSDEENDLMLKSDGELWQTLESAFV  379

Query  358  RIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             II TLP SD  E+L + L    +++   P L  AF  W  R+
Sbjct  380  SIILTLPSSDQAEILTEWL--ENKHIR-YPDLTEAFEVWCYRS  419



>ref|XP_010254985.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Nelumbo 
nucifera]
Length=539

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (47%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWL+E + + + AD     W++Q        R          +P +   ++ C T +L
Sbjct  366  NLLWLLEILADRQAADEFALIWASQQELATLHSR----------LPAVSRHLISCITARL  415

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G IL  +  R+ L++ WL  LI   D+ S +    +    ++ EE   R I TL
Sbjct  416  FVGIGKGEILPSKDTRLLLLQTWLQPLI---DDYSWLQHGCRSFDRKVVEEGMGRTILTL  472

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL + Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  473  PLENQQSILLSWLGSFLKAGDNCPNLQRAFEVWWRR  508



>gb|KJB52168.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52169.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
 gb|KJB52170.1| hypothetical protein B456_008G248700 [Gossypium raimondii]
Length=643

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 78/166 (47%), Gaps = 17/166 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ +I+ ++A+  +K W++Q   +    +          VP      V R T +L
Sbjct  476  NLHWILDILIDRQIAEDFLKTWASQSELSDSHSK----------VPVFHRFEVSRVTARL  525

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +LA +++R  L++ WL   +   D+   M    K L   L E+     I TL
Sbjct  526  FVGIGKGQLLASKELRCLLLQTWL---VPFYDDFGWMRRASKGLDRHLIEDGLSNSILTL  582

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
            PL+  QE+          + EDCP++   F  W+RRA   RS EQ+
Sbjct  583  PLAWQQEIFLAWFDRFLNSGEDCPNIQRGFEVWWRRAFWRRSGEQE  628



>ref|XP_010069058.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW57276.1| hypothetical protein EUGRSUZ_H00077 [Eucalyptus grandis]
Length=529

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ +I+ ++A+  +++W++Q     +L +A       + VP +    V R T +L
Sbjct  362  NLHWMLDILIDRQIAEEFLRKWASQF----ELSKA------HSSVPAIHRFEVSRVTARL  411

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  +  R  L++ WL   +    +   M    K L   L EE    +I TL
Sbjct  412  FVGVGKGQILVPKDTRSLLLQTWL---VPFYGDFPWMRKASKGLDRHLIEEGLGSMILTL  468

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+          + EDCP++   F  W++RA
Sbjct  469  PLAQQQEIFLGWFERFLNSGEDCPNIQRGFEVWWKRA  505



>ref|XP_011086471.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X1 [Sesamum indicum]
 ref|XP_011086472.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X1 [Sesamum indicum]
 ref|XP_011086473.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X1 [Sesamum indicum]
 ref|XP_011086474.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X1 [Sesamum indicum]
 ref|XP_011086476.1| PREDICTED: BTB/POZ domain-containing protein At3g05675 isoform 
X1 [Sesamum indicum]
Length=443

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 15/163 (9%)
 Frame = -2

Query  691  LLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLAN  512
            L W  + + +L +++  V  W   V  + ++ +     +  + + G    VL  T K+  
Sbjct  267  LSWASQIVTKLEISNDFVYTW---VETSVNIVKVAERVSPESSLTGTKLKVLEVTAKVLE  323

Query  511  AVSMGTILADRQVRMKLVKNWLPVLIACKDNVSP---------MMPNHKQLYLELEETFL  359
            A+  GT++     R+ +VK WLP +   K  V           M+ +  +L+  LE  F+
Sbjct  324  AIGYGTVILPTTRRLHMVKVWLPFVRIVKSAVDSVGSDEENDLMLKSDGELWQTLESAFV  383

Query  358  RIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             II TLP SD  E+L + L    +++   P L  AF  W  R+
Sbjct  384  SIILTLPSSDQAEILTEWL--ENKHIR-YPDLTEAFEVWCYRS  423



>ref|XP_009419272.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Musa 
acuminata subsp. malaccensis]
Length=512

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 15/154 (10%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKLANA  509
            WLV+ +I+ R+AD  V  W+NQ                 + +P +    +   T +L  A
Sbjct  349  WLVDILIDKRIADEFVSLWANQSGLAT----------CHSKIPCIYRFEISMITAQLCVA  398

Query  508  VSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLPLS  332
            +  G IL  +  ++ L++ WL  L    ++   M    +    ++ E+     I TLP++
Sbjct  399  IGKGQILVSKDAKVSLLRTWLEALF---EDFGWMKRTSRTFNKKMVEDGLSATILTLPMA  455

Query  331  DAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            + Q +L +         +DCP++  AF  W+RRA
Sbjct  456  EQQTILLRWFDCFLNKGDDCPNIQRAFEIWWRRA  489



>ref|XP_010069057.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like isoform 
X1 [Eucalyptus grandis]
Length=545

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 75/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ +I+ ++A+  +++W++Q     +L +A       + VP +    V R T +L
Sbjct  378  NLHWMLDILIDRQIAEEFLRKWASQF----ELSKA------HSSVPAIHRFEVSRVTARL  427

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  +  R  L++ WL   +    +   M    K L   L EE    +I TL
Sbjct  428  FVGVGKGQILVPKDTRSLLLQTWL---VPFYGDFPWMRKASKGLDRHLIEEGLGSMILTL  484

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+          + EDCP++   F  W++RA
Sbjct  485  PLAQQQEIFLGWFERFLNSGEDCPNIQRGFEVWWKRA  521



>gb|EMT26347.1| hypothetical protein F775_16772 [Aegilops tauschii]
Length=451

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 72/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ ++E ++A+  ++ W+ Q    A++            VP +    V R T +L
Sbjct  285  NLHWMLDILVERQIAEDFLRTWAMQNEL-AEMH---------GKVPAIHRYEVSRVTARL  334

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  ++ R +L+  WL       ++   M    K L   L EE     I TL
Sbjct  335  FVGVGKGQILVSKEARSQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEEGLANTILTL  391

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+     +    + EDCP++   F  W+RRA
Sbjct  392  PLATQQEIFLAWFNRFLNSGEDCPNIQRGFEVWWRRA  428



>ref|XP_011089383.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089384.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
 ref|XP_011089385.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Sesamum 
indicum]
Length=511

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V  +I+ ++ D  VK W++Q       + +   +R +            + + T +L 
Sbjct  351  WIVSILIDRKMGDEFVKLWADQKELAVLHSKIPTIYRHE------------ISKITAQLC  398

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
             ++  G +L  ++ R  L+  WL  L    D+   M    K +  +L EE   + I TLP
Sbjct  399  ISIGKGEVLVPKETRFALLSTWLEALY---DDFKWMRMAGKSVDRKLIEEGLSQTILTLP  455

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q LL           +DCP++ +AF  W+RRA
Sbjct  456  LPQQQSLLLNWFDRFLNRGDDCPNIQTAFEIWWRRA  491



>gb|KHG07032.1| hypothetical protein F383_02815 [Gossypium arboreum]
Length=504

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 74/157 (47%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            +L W+V+ +IE R+A+  VK W++Q    A+L          + +P +    + R T +L
Sbjct  338  NLQWIVDILIEKRMANDFVKLWADQREL-AELH---------SKIPTMYRHEISRITAQL  387

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G IL  ++ R  L+  WL  L    D+   M    K +  +L E+     I TL
Sbjct  388  CIAIGRGNILVGKESRFLLLATWLEALY---DDFGWMRRASKSVDKKLVEDGLSHTILTL  444

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             +   Q +L +         +DCP++  AF  W+RRA
Sbjct  445  SMRQQQAILLKWFDRFLNKGDDCPNIQRAFEVWWRRA  481



>ref|XP_011085536.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085537.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011085538.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=525

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (47%), Gaps = 13/156 (8%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +LLWL++ + + + AD     W+NQ    +   R      +R++V  +       T +L 
Sbjct  358  NLLWLLDILADRQAADEFAITWANQQELASLHTRL--PIVYRHHVSTI-------TARLF  408

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G +L  +  R  L+K WL  LI   ++ S +    +    ++ EE   R I TLP
Sbjct  409  VGIGRGELLPSKDTRHLLLKTWLEPLI---NDYSWLQHGCRSFDRKVVEEGIGRTILTLP  465

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L D Q +L   L    +  ++CP+L  AF  W+RR 
Sbjct  466  LEDQQSILLSWLGSFLKAGDNCPNLQRAFEVWWRRT  501



>emb|CBI34370.3| unnamed protein product [Vitis vinifera]
Length=519

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 76/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ +I+ ++A+  +K W++Q    ++L  A       + VP +    V R T +L
Sbjct  355  NLHWILDILIDRQIAEDFLKTWASQ----SELSHA------HSKVPVVHRYEVSRVTARL  404

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +LA +  R  L++ WL   +   D+   M    K L   L E+     I TL
Sbjct  405  FVGIGKGQLLASKDARCLLLQTWL---VPFYDDFGWMRRASKGLDRHLVEDGLSNTILTL  461

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+L         + EDCP++   F  W+RRA
Sbjct  462  PLAWQQEILLAWFDRFLNSGEDCPNIQRGFEVWWRRA  498



>ref|XP_006856144.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
 gb|ERN17611.1| hypothetical protein AMTR_s00059p00166010 [Amborella trichopoda]
Length=618

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 72/169 (43%), Gaps = 39/169 (23%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPA----VVLRCT  527
            +LLWLVE +I+   AD  V  W++Q    ADL             P LP     +    T
Sbjct  452  NLLWLVEILIDRLAADEFVVMWTSQ-HHLADLH------------PRLPIASRHLASHIT  498

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLI--------ACK--DNVSPMMPNHKQLYLE  377
             ++  A+  G ++A R+ R  L   W   LI        AC+  D  +            
Sbjct  499  ARICIAIGKGEVVASREARCSLFDTWFQPLIEDYGWLKHACRSFDRRA------------  546

Query  376  LEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            +EE   R I TLPL D + +    L+   +  + CP+L  AF  W+RRA
Sbjct  547  VEEGVGRTILTLPLEDQRRIFVSWLNSFLKFGDSCPNLQGAFEVWWRRA  595



>ref|XP_009419041.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419043.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=526

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 74/156 (47%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L+WL+E +++   AD     W++Q    A+L            VP +   ++ C TC+L
Sbjct  365  NLIWLLEILVDRNAADEFTLMWASQNEL-AELH---------TKVPTMSRHLVSCITCRL  414

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  ++ R  L+  WL  LI   ++ S +    +    ++ EE   R I TL
Sbjct  415  FVGIGNGEMLPSKETRKLLLHVWLQPLI---NDYSWLQHGSRSFDRKVVEEGIGRTILTL  471

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             L D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  472  SLEDQQSILLSWLGCFLKASDNCPNLQRAFEVWWRR  507



>gb|KJB24321.1| hypothetical protein B456_004G139400 [Gossypium raimondii]
Length=518

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 47/169 (28%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +IE R+A+  +K W++Q S  +D+               +PAV    V R T
Sbjct  351  NLHWMLDILIERRIAEDFLKSWASQ-SELSDVHSK------------VPAVHRHGVSRVT  397

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +L  ++VR  L++ WL   +   ++   M    K +   L E+     I
Sbjct  398  ARLFVGMGKGQLLVPKEVRYMLLQTWL---VPFYEDFGWMRRVSKGVDTHLIEDGLSNTI  454

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  +E+L         + E+CP++   F  W+RRA   R+ EQ+
Sbjct  455  LTLPLAWQREILLAWFYRFLNSSENCPNIQRGFEVWWRRAFWQRNGEQQ  503



>ref|XP_011099262.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099263.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099264.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099265.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099266.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
 ref|XP_011099268.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Sesamum 
indicum]
Length=534

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 21/159 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +LLWL++ + + + AD     W++Q    +   +             LP V    V + T
Sbjct  366  NLLWLLDILADRQAADEFAVLWASQQELASHHTK-------------LPIVSRHHVSKIT  412

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +L  R  R  L++ WL  LI   D+ S +    +    ++ EE   R I
Sbjct  413  ARLFVGIGRGQLLPCRDTRHLLLQTWLQALI---DDYSWLQHGCRSFDRKVVEEGIGRTI  469

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             TLPL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  470  LTLPLEDQQSILLSWLGIFLKTGDNCPNLQRAFEVWWRR  508



>ref|XP_010919095.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Elaeis 
guineensis]
Length=637

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L WL++ +I+ ++AD  ++ W+ Q    A+L  A       + VP +    V R T +L
Sbjct  470  NLHWLLDILIDRQMADEFLRTWAGQ----AELSEA------HSKVPAIHRYEVSRVTARL  519

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  ++ R  L+  WL       ++   M    K L   L E+     I TL
Sbjct  520  FVGVGKGQILVSKEARCLLLSTWLEPFY---EDFGWMRRACKGLDRHLMEDGLANTILTL  576

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+L         + +DCP++   F  W+RRA
Sbjct  577  PLAMQQEILLAWFERFLNSGDDCPNIQRGFEVWWRRA  613



>ref|XP_004251284.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
lycopersicum]
Length=498

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (46%), Gaps = 19/159 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            +L WLV+ +I+ ++ D  VK W+ Q   +   + +   +R +            + + T 
Sbjct  335  NLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKIPTMYRHE------------ISKITA  382

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L  A+  G +L  + VR  L+  WL  L    D+   M    + +  +L EE   + I 
Sbjct  383  QLCIAIGRGNLLVPKDVRYCLLSTWLESLY---DDFGWMKRAGRSIDKKLVEEGLGQTIL  439

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            TLPL+  Q +L           +DCP++  AF  W+RR+
Sbjct  440  TLPLAQQQTILLNWFDRFLNKGDDCPNIQRAFEVWWRRS  478



>ref|XP_006829095.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
 gb|ERM96511.1| hypothetical protein AMTR_s00001p00262820 [Amborella trichopoda]
Length=613

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L WL++ +I+ ++A+   K W+NQ    ADL +           P +P +    V R T
Sbjct  449  NLHWLLDILIDRQMAEDFAKMWANQ----ADLAKLH---------PKVPTMYRYEVSRLT  495

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLELEETFL-RII  350
             +L  A+  G IL  + VR  L+  WL  L    ++   M    K L   + E  L + I
Sbjct  496  ARLCVAIGKGQILTPKDVRCSLLGTWLEPLY---EDFGWMRRACKALDRNVVEYGLGQTI  552

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL   Q +L           +DCP++  AF  W+RRA
Sbjct  553  LTLPLEQQQAILLGWFDRFLNAGDDCPNIQRAFEVWWRRA  592



>ref|XP_006365150.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Solanum 
tuberosum]
Length=496

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 73/159 (46%), Gaps = 19/159 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            +L WLV+ +I+ ++ D  VK W+ Q   +   + +   +R +            + + T 
Sbjct  333  NLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKIPTMYRHE------------ISKITA  380

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L  A+  G +L  + VR  L+  WL  L    D+   M    + +  +L EE   + I 
Sbjct  381  QLCIAIGRGNLLVPKDVRYCLLSTWLESLY---DDFGWMKRAGRSIDKKLVEEGLGQTIL  437

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            TLPL+  Q +L           +DCP++  AF  W+RR+
Sbjct  438  TLPLAQQQTILLNWFDRFLNKGDDCPNIQRAFEVWWRRS  476



>ref|XP_008808898.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808899.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
 ref|XP_008808900.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Phoenix 
dactylifera]
Length=528

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 75/156 (48%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L+WLVE + +  +AD     W++Q    A+L          + +P +   ++ C T +L
Sbjct  365  NLVWLVEILADRHIADEFAVIWASQNEL-AELH---------SKLPIMSRHLISCITARL  414

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G +L  +  R  L+  WL  LI   D+ S +    +    ++ EE   R I TL
Sbjct  415  FVAIGKGEMLPSKDTRQLLLHVWLQPLI---DDYSWLQHGCRSFDRKVVEEGIGRTILTL  471

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  472  PLEDQQNILLSWLGSFLKVGDNCPNLQRAFEVWWRR  507



>gb|KHN44517.1| BTB/POZ domain-containing protein [Glycine soja]
Length=404

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 68/162 (42%), Gaps = 27/162 (17%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L WL+E +I+ + AD     W+NQ      +  A      R YV  L         +L 
Sbjct  235  NLSWLLEILIDKQAADEFALMWANQQELA--VLHAKLPTVSRYYVSCLSG-------RLY  285

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE--------LEETFL  359
              +  G +L  + VR  L++ WL           P+M ++  L           +EE   
Sbjct  286  VGIGRGELLPSKDVRRLLLQTWL----------QPLMNDYNWLQHGCRSFDRKLVEEGIG  335

Query  358  RIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            R I TLPL D Q +L   L    +  + CP+L  AF  W+RR
Sbjct  336  RTILTLPLEDQQSILLSWLGSFLKTGDSCPNLQRAFEVWWRR  377



>tpg|DAA61328.1| TPA: hypothetical protein ZEAMMB73_882597 [Zea mays]
Length=304

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  457  KNWLPVLIACKDNVSPMMPNHKQLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVE  278
            +  +P+L   +D V PM         ELE  FL+IISTLP+ DAQEL QQC+ F T + +
Sbjct  150  QKLIPILNVRRDIVQPMHFQKSTNCQELEGAFLQIISTLPVPDAQELQQQCVGFRTSSTQ  209



>ref|XP_010255266.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nelumbo 
nucifera]
Length=667

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 73/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W+ Q   +    R             +P +    V R T
Sbjct  500  NLHWILDILIDRQIAEDFLKTWAAQSELSKAHSR-------------IPPIHRFEVSRVT  546

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA ++VR  L++ WL       D+   M    K L   L E+     I
Sbjct  547  ARLFVGIGKGQLLASKEVRCLLLQTWLDPFY---DDFGWMRRASKGLDRHLIEDGLSNTI  603

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +      EDCP++   F  W+RRA
Sbjct  604  LTLPLAWQQEILLAWFNRFLNCGEDCPNIQRGFEVWWRRA  643



>ref|XP_006476518.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Citrus 
sinensis]
Length=656

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 81/169 (48%), Gaps = 23/169 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q    +++  A          P +PAV    V R T
Sbjct  489  NLHWILDILIDRQIAEDFLKIWASQ----SEISEAH---------PKVPAVHRYEVSRVT  535

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +    +LA + VR  L++ WL       D+   M      L   L E+     I
Sbjct  536  ARLFVGIGKAQLLATKDVRCLLLRTWLEPFY---DDFGWMRRASNGLDRHLIEDGLSNTI  592

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA--NRSHEQK  209
             TLPL+  QE+L    +    + EDCP++   F  W+RRA   R+ EQ+
Sbjct  593  LTLPLAWQQEILIAWFNRFLNSGEDCPNIQRGFEVWWRRAFWRRNGEQE  641



>ref|XP_001751363.1| predicted protein [Physcomitrella patens]
 gb|EDQ83680.1| predicted protein, partial [Physcomitrella patens]
Length=440

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/160 (29%), Positives = 75/160 (47%), Gaps = 22/160 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L WLV+ +I+ R+AD  V+ W++Q                 N    +P +    V R T
Sbjct  295  NLHWLVDILIDRRIADDFVRMWAHQAELA-------------NLHAKVPVMFRYEVSRLT  341

Query  526  CKLANAVSMGTI-LADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRI  353
             +L  A+  G    ++  VR  L++ WL  L+   D+ + M    + L  ++ EE   + 
Sbjct  342  ARLCIAIGKGQARQSNLDVRFLLLQTWLQPLV---DDFAWMQRCCRSLDKKVVEEGISQT  398

Query  352  ISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            I TLPL   Q +L       + + +DCP+L  AF  W+RR
Sbjct  399  ILTLPLKQQQSILLSWFDRFSSSGDDCPNLQKAFEVWWRR  438



>ref|XP_010233737.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Brachypodium 
distachyon]
Length=550

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/160 (28%), Positives = 72/160 (45%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ ++E +VA+  ++ W+ Q             D        +PA+    V R T
Sbjct  384  NLHWMLDILVERQVAEEFLRTWAAQ-------------DELAEIHGKVPAIHRYEVSRVT  430

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I
Sbjct  431  ARLFVGVGKGQILVSKEARAQLLCTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  487

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  488  LTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  527



>ref|XP_006439497.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
 gb|ESR52737.1| hypothetical protein CICLE_v10019226mg [Citrus clementina]
Length=653

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (48%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q    +++  A          P +PAV    V R T
Sbjct  486  NLHWILDILIDRQIAEDFLKIWASQ----SEISEAH---------PKVPAVHRYEVSRVT  532

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +    +LA + VR  L++ WL       D+   M      L   L E+     I
Sbjct  533  ARLFVGIGKAQLLATKDVRYLLLRTWLEPFY---DDFGWMRRASNGLDRHLIEDGLSNTI  589

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  590  LTLPLAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  629



>gb|KHN22018.1| BTB/POZ domain-containing protein [Glycine soja]
Length=233

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V+ +I  +++D  VK W+ Q    +  + +   +R +            + R T +L 
Sbjct  70   WIVDILIGKKMSDEFVKIWAEQKELATLHSKISTVYRHE------------ISRITAQLC  117

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G IL  +++R  L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  118  IGIGRGHILVPKEIRFSLLSTWLEALY---EDFGWMRRASRAVDRKLIEDGLSQTILTLP  174

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +L           +DCP++  AF  W+RRA
Sbjct  175  LLQQQSVLLNWFDRFLNKGDDCPNIQKAFEIWWRRA  210



>ref|XP_003548003.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Glycine 
max]
Length=543

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 68/162 (42%), Gaps = 27/162 (17%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            +L WL+E +I+ + AD     W+NQ      +  A      R YV  L         +L 
Sbjct  374  NLSWLLEILIDKQAADEFALMWANQQELA--VLHAKLPTVSRYYVSCLSG-------RLY  424

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE--------LEETFL  359
              +  G +L  + VR  L++ WL           P+M ++  L           +EE   
Sbjct  425  VGIGRGELLPSKDVRRLLLQTWL----------QPLMNDYNWLQHGCRSFDRKLVEEGIG  474

Query  358  RIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            R I TLPL D Q +L   L    +  + CP+L  AF  W+RR
Sbjct  475  RTILTLPLEDQQSILLSWLGSFLKTGDSCPNLQRAFEVWWRR  516



>gb|KHG15549.1| hypothetical protein F383_06896 [Gossypium arboreum]
Length=613

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 22/161 (14%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q   +A   +             +PA+    V R T
Sbjct  466  NLHWILDILIDRQIAEDFLKSWASQSELSATHSK-------------VPAIHRFEVSRVT  512

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPN-HKQLYLEL-EETFLRI  353
             +L   +  G +L  ++ R  L++ WL   +   ++   MM    K L   L E+     
Sbjct  513  ARLFVGIGKGQLLVSKEARFLLLQTWL---VPFYNDFGWMMRRASKGLDRHLIEDGLSNT  569

Query  352  ISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            I TLPL+  Q++L         + EDCP++   F  W+RRA
Sbjct  570  ILTLPLAWQQDILLAWFDRFLNSGEDCPNIQRGFEVWWRRA  610



>ref|XP_002279382.2| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Vitis 
vinifera]
Length=667

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 75/160 (47%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q    ++L  A            +P V    V R T
Sbjct  500  NLHWILDILIDRQIAEDFLKTWASQ----SELSHAHSK---------VPVVHRYEVSRVT  546

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L++ WL   +   D+   M    K L   L E+     I
Sbjct  547  ARLFVGIGKGQLLASKDARCLLLQTWL---VPFYDDFGWMRRASKGLDRHLVEDGLSNTI  603

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L         + EDCP++   F  W+RRA
Sbjct  604  LTLPLAWQQEILLAWFDRFLNSGEDCPNIQRGFEVWWRRA  643



>ref|XP_009800799.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
sylvestris]
Length=645

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 77/160 (48%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  ++ W++Q    ++L  A          P +PA+    V R T
Sbjct  478  NLHWILDILIDRQIAEDFLRTWASQ----SELSEAH---------PKVPALHRYEVSRVT  524

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L++ WL   +   ++   M    + L   L E+     I
Sbjct  525  ARLFVGIGKGQLLASKDARCSLLQTWL---VPFYEDFGWMRRASRGLDRHLIEDGLSNTI  581

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLP++  QE+L         + +DCP++   F  W+RRA
Sbjct  582  LTLPMALQQEILTSWFDRFLNSGDDCPNIQRGFEIWWRRA  621



>ref|XP_010092990.1| hypothetical protein L484_007171 [Morus notabilis]
 gb|EXB53228.1| hypothetical protein L484_007171 [Morus notabilis]
Length=312

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 71/159 (45%), Gaps = 19/159 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            ++ W+V+ ++E ++AD  VK W++Q       + +   +R +            + R T 
Sbjct  146  NMQWIVDILVEKKMADEFVKLWADQKELAIMHSKIPTMYRHE------------ISRITA  193

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L  A+  G IL  +  R  L+  WL  L    ++   M    + +  +L E+   + I 
Sbjct  194  QLCIAIGRGHILVPQDARFSLLSTWLEALY---EDFGWMRRASRSVDKKLVEDALGQTIL  250

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            TLPL   Q +L           +DCP+   AF  W+RRA
Sbjct  251  TLPLPQQQTILLNWFDRFLNKGDDCPNFQRAFEIWWRRA  289



>ref|XP_010260115.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nelumbo 
nucifera]
Length=560

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 71/164 (43%), Gaps = 29/164 (18%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            ++ W+VE +I+ ++ D  V  W++Q                 + +P +    + R T +L
Sbjct  394  NMQWIVEILIDKKMGDEFVNLWADQKELAI----------LHSKIPSMFRYEISRITAQL  443

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLI--------ACKDNVSPMMPNHKQLYLELEETF  362
              AV  G IL  ++ R  L+  WL  L         AC+          K+L   +E+  
Sbjct  444  CIAVGRGQILVSKEARFSLLSTWLEALYEDFGWMRRACR-------SVDKKL---VEDGL  493

Query  361  LRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             + I TLP++  Q +L           +DCP++  AF  W+RRA
Sbjct  494  SQTILTLPMAQQQAILLNWFDRFLSKGDDCPNMQRAFEVWWRRA  537



>gb|EYU18898.1| hypothetical protein MIMGU_mgv1a005394mg [Erythranthe guttata]
Length=485

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 19/179 (11%)
 Frame = -2

Query  748  DPEAIQR---LNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDD  578
            D EA+Q+   + +        ++ W+V  +++ ++ +  VK W++Q              
Sbjct  300  DEEAVQQDRGVLMAEIAREADNMQWIVGILMDRKIGEEFVKLWADQKELAV---------  350

Query  577  AWRNYVPGL-PAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMP  401
               + +P +   V+ + T ++   +  G +L  ++VR  L+  WL  L    D+   M  
Sbjct  351  -LHSKIPVMYRHVISKITAQVCVFIGQGKVLVPKEVRFGLLSTWLDALY---DDFGWMRT  406

Query  400  -NHKQLYLEL-EETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
               K +  ++ EE   R+I TLPL+  Q +L +          DCP++  AF  W+RRA
Sbjct  407  CGGKSVDRKVVEEGLGRMILTLPLTQQQLILMKWFDRFVNGGYDCPNIKGAFEVWWRRA  465



>ref|XP_009793569.1| PREDICTED: uncharacterized protein LOC104240425 [Nicotiana sylvestris]
Length=424

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 78/167 (47%), Gaps = 16/167 (10%)
 Frame = -2

Query  733  QRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWR--NYV  560
            +R+N   A  + + LLW+  +M+     D A+ +WS    F + L         R   ++
Sbjct  262  ERVNDLAAEKHAQELLWITTKMVGCGAVDEALVQWS----FASGLASISLSSNSRVQGFI  317

Query  559  PGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVS-PMMPNHKQLY  383
              + A++     ++ N V        RQV+  ++  WLP+     + +S P++  ++++ 
Sbjct  318  VKITAILFGELKRMKNEVP-------RQVKFNILVLWLPLFCYADNGLSYPVLTGYEKV-  369

Query  382  LELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTW  242
             E+E+T   +IS+LP  D + +L   L   T    D P+L  ++  W
Sbjct  370  -EMEKTMDELISSLPTIDQEVILTNWLQDFTTTSSDWPNLQKSYDLW  415



>ref|XP_009774422.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
sylvestris]
Length=502

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            +L WLV+ +I+ ++ D  V  W+ Q   +             + +P +    + + T +L
Sbjct  339  NLQWLVDILIDRKMGDEFVNLWAEQKELSV----------LHSKIPTMYRHEISKITAQL  388

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G +L  ++VR  L+  WL  L    ++   M    + +  +L EE   + I TL
Sbjct  389  CVAIGRGNLLVPKEVRYSLLSTWLESLY---EDFGWMKRAGRSIDKKLVEEGLGQTILTL  445

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  Q +L +         +DCP++  AF  W+RR+
Sbjct  446  PLAQQQTILLKWFDRFLNKGDDCPNIQRAFEIWWRRS  482



>gb|KDO76298.1| hypothetical protein CISIN_1g006210mg [Citrus sinensis]
Length=656

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 76/160 (48%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  +K W++Q    +++  A          P +PAV    V R T
Sbjct  489  NLHWILDILIDRQIAEDFLKIWASQ----SEISEAH---------PKVPAVHRYEVSRVT  535

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +    +LA + VR  L++ WL       D+   M      L   L E+     I
Sbjct  536  ARLFVGIGKAQLLATKDVRCLLLRTWLEPFY---DDFGWMRRASNGLDRHLIEDGLSNTI  592

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  593  LTLPLAWQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  632



>ref|XP_004505925.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Cicer 
arietinum]
Length=495

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFTA---DLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V+ +I  ++ +  VK W+ Q    A    +Q  +R +            + R T +L 
Sbjct  331  WIVDILIGKKMGEEFVKIWAEQKELAALHLKVQTVYRYE------------ISRITAQLC  378

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G +L  +++R  L+  WL  L    ++   M    + L  +L E+   + I TLP
Sbjct  379  IGIGRGHMLVPKEIRFSLLSTWLEALY---EDFGWMRRGSRGLDKKLVEDGLSQTILTLP  435

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q LL           +DCP++  AF  W+RRA
Sbjct  436  LFQQQVLLLNWFDRFLNKGDDCPNIQKAFEIWWRRA  471



>gb|KHN05697.1| BTB/POZ domain-containing protein [Glycine soja]
Length=487

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V+ +I  ++ D  VK W+ Q   V+  + +   +R +            + R T +L 
Sbjct  324  WIVDILIGKKIGDEFVKIWAEQKELVTLHSKVPTVYRHE------------ISRITAQLC  371

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G IL  +++R  L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  372  IGIGRGHILVPKEIRFSLLSTWLEALY---EDFGWMRRASRAVDRKLVEDGLSQTILTLP  428

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +L           +DCP++  AF  W+RRA
Sbjct  429  LLQQQSVLLNWFDRFLSKGDDCPNIQKAFEIWWRRA  464



>dbj|BAJ96039.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 70/157 (45%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ ++E ++A+  ++ W+ Q                   VP +    V R T +L
Sbjct  387  NLHWVLDILVERQIAEDFLRTWAIQNELAE----------MHGKVPAIHRYEVSRVTARL  436

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               V  G IL  ++ R +L+  WL       ++   M    K L   L E+     I TL
Sbjct  437  FVGVGKGQILVSKEARSQLLSTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTILTL  493

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  QE+L    +    + EDCP++   F  W+RRA
Sbjct  494  PLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA  530



>ref|XP_003540755.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=503

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V+ +I  ++ D  VK W+ Q   V+  + +   +R +            + R T +L 
Sbjct  340  WIVDILIGKKIGDEFVKIWAEQKELVTLHSKVPTVYRHE------------ISRITAQLC  387

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G IL  +++R  L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  388  IGIGRGHILVPKEIRFSLLSTWLEALY---EDFGWMRRASRAVDRKLVEDGLSQTILTLP  444

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +L           +DCP++  AF  W+RRA
Sbjct  445  LLQQQSVLLNWFDRFLSKGDDCPNIQKAFEIWWRRA  480



>ref|XP_010313540.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Solanum lycopersicum]
Length=234

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 19/159 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTC  524
            +L WLV+ +I+ ++ D  VK W+ Q   +   + +   +R +            + + T 
Sbjct  71   NLQWLVDILIDRKMGDEFVKLWAEQKELSILHSKILTMYRHE------------ISKITA  118

Query  523  KLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIIS  347
            +L  A+  G +L  + VR  L+  WL  L    D+   M    K +  +L EE   + I 
Sbjct  119  QLCIAIGRGNLLVPKDVRYCLLSTWLESLY---DDFGWMKRAGKSIDKKLVEEGLGQTIL  175

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            TLPL+  Q +L           +D P++  AF  W+RR+
Sbjct  176  TLPLAQQQTILLNWFDRFLNKGDDYPNIQRAFEVWWRRS  214



>ref|XP_009610322.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Nicotiana 
tomentosiformis]
Length=503

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 72/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            +L WLV+ +I+ ++ D  V  W+ Q   +             + +P +    + + T +L
Sbjct  340  NLQWLVDILIDRKMGDEFVNLWAEQKELSV----------LHSKIPTMYRHEISKITAQL  389

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G +L  ++VR  L+  WL  L    ++   M    + +  +L EE   + I TL
Sbjct  390  CVAIGRGNLLVPKEVRYSLLSTWLESLY---EDFGWMKRAGRSIDKKLVEEGLGQTILTL  446

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  Q +L           +DCP++  AF  W+RR+
Sbjct  447  PLAQQQTILLNWFDRFLNKGDDCPNIQRAFEIWWRRS  483



>ref|XP_006650658.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Oryza 
brachyantha]
Length=521

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 70/163 (43%), Gaps = 29/163 (18%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +LLWLVE + +   A      WSNQ    A+L          + +P     ++ C T +L
Sbjct  361  NLLWLVEILADRNAAGEFAVIWSNQGEL-AELH---------SRLPTKSRHLVSCVTARL  410

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE--------LEETF  362
              A+  G +L  +  R  L+  WL           P+M ++  L           +EE  
Sbjct  411  FVAIGKGEMLPSKDTRKLLLDVWL----------QPLMDDYNWLQHGCRSFDRKVVEEGI  460

Query  361  LRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             R I TLPL D Q +L   L    +  + CP+L+ AF  W+RR
Sbjct  461  GRTILTLPLEDQQTILLSWLGSFLKVGDSCPNLLKAFEVWWRR  503



>ref|XP_009407677.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407678.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009407679.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=528

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L+WL+E +I+   AD     W++Q    A+L          + +P +   ++ C T +L
Sbjct  369  NLIWLLEILIDRHAADEFATTWASQHEL-AELH---------SKLPIMSRHLVSCITSRL  418

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQL-YLELEETFLRIISTL  341
               +  G +L  R+ R  L++ WL  LI   D+ + +    +      +EE   + I TL
Sbjct  419  FVGIGRGEMLPSRETRQLLLQIWLQPLI---DDYTWLQHGCRSFDRTVVEEGIGQTILTL  475

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  476  PLEDQQSILLSWLGRFLKVGDNCPNLQRAFEVWWRR  511



>ref|XP_010029862.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029863.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 ref|XP_010029864.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Eucalyptus 
grandis]
 gb|KCW56822.1| hypothetical protein EUGRSUZ_I02489 [Eucalyptus grandis]
Length=526

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 69/156 (44%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L WL+E + + + AD     W+ Q                   +P +    + C T +L
Sbjct  361  NLTWLLEILADRQAADDFAVMWAGQQELAT----------LHGKLPIMSRYHVSCITARL  410

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  ++ R  L+K WL  LI   ++ S +    +    ++ EE   R I TL
Sbjct  411  FVGIGRGQLLPSKETRQMLLKTWLQPLI---NDYSWLQHGCRSFDRKVVEEGIGRTILTL  467

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  468  PLEDQQSILLSWLGSFLKAGDNCPNLQRAFEVWWRR  503



>ref|XP_010680938.1| PREDICTED: BTB/POZ domain-containing protein At3g50780 [Beta 
vulgaris subsp. vulgaris]
Length=532

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 19/158 (12%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L WL+E + E +VAD     W  Q    +  Q+          +P +    + C T +L
Sbjct  368  NLAWLLEILAERQVADEFALMWIRQQELASLHQK----------LPAMTRYHVSCITARL  417

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLE---LEETFLRIIS  347
               +  G +L  + +R  L++ WL  L +    +     NH     +   +EE   R I 
Sbjct  418  FVGIGKGELLPSKDIRQMLLQTWLEPLTSDYSWL-----NHGCRSFDRKVVEEGIGRTIL  472

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            TLPL D + +L   L    +  ++CP+L  AF  W+RR
Sbjct  473  TLPLEDQRSILLSWLGNFLKAGDNCPNLQRAFEVWWRR  510



>ref|XP_002270447.1| PREDICTED: uncharacterized protein LOC100240757 [Vitis vinifera]
Length=420

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/159 (25%), Positives = 75/159 (47%), Gaps = 12/159 (8%)
 Frame = -2

Query  697  RHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKL  518
            + LLW+++++      D A+ +WS    F + L  +F   A     P +   +++ +  L
Sbjct  270  QELLWIMDKLRGCGAVDEALMQWS----FASGLA-SFSLTA----NPRVQGSIVKISAIL  320

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVS-PMMPNHKQLYLELEETFLRIISTL  341
               +S       RQV+ +L+  WLP+     + ++ P +  +++   E E    R+ISTL
Sbjct  321  VEELSRVDFEVPRQVKFRLIGLWLPLFCFAGNGLAFPFLTGYEKA--ETERALDRVISTL  378

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            P +D + +L   L   T +  D P+L  ++  W R   +
Sbjct  379  PATDQEVILTNWLQDFTISASDWPNLQVSYDRWCRSTRK  417



>ref|XP_008783774.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Phoenix 
dactylifera]
Length=517

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 29/164 (18%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            ++ WL+E +I  R+ D  V  W++Q                 + +P +    + R T +L
Sbjct  356  NIQWLLEILISKRMCDEFVTLWADQTELAL----------CHSKIPCMYRYEISRITAQL  405

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLI--------ACKDNVSPMMPNHKQLYLELEETF  362
              A+  G +L  ++ R+ L++ WL  L         AC+     M          +E+  
Sbjct  406  CIAIGKGHLLVSKEARISLLRTWLEALYEDFGWMKRACRIFDKKM----------VEDGL  455

Query  361  LRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             + I TLP++  Q +L +         +DCP++  AF  W+RRA
Sbjct  456  CQTILTLPMAQQQTILLRWFDCFLNKGDDCPNMQRAFEVWWRRA  499



>ref|XP_010685873.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Beta 
vulgaris subsp. vulgaris]
Length=508

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 73/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            ++ W+V+ +I+ ++ D  VK W++Q                 + +P +    + R T +L
Sbjct  343  NMQWIVDILIDKKMGDEFVKLWADQKELAI----------LHSKIPTMYRHEISRVTAQL  392

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G IL  ++ R  L+  WL  L    ++   M   ++ +  ++ E+   + I TL
Sbjct  393  CIAIGRGHILVPKETRYSLLSTWLEPLY---EDFGWMKRANRFVDKKVVEDGLSQTILTL  449

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            P+S  Q +L           +DCP++  AF  W+RRA
Sbjct  450  PISQQQSILMNWFDRFLTKGDDCPNIQKAFEIWWRRA  486



>ref|XP_009400477.1| PREDICTED: BTB/POZ domain-containing protein At1g63850-like [Musa 
acuminata subsp. malaccensis]
Length=643

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/160 (27%), Positives = 71/160 (44%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++AD  ++ W+ Q   +    R             +PA+    V R T
Sbjct  473  NLHWILDILIDRQIADDFLRTWACQAELSEMHSR-------------VPAIHRYEVSRVT  519

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   V  G IL  ++ R  L++ WL       ++   M    K L   L E+     I
Sbjct  520  ARLFVGVGKGHILVSKESRSLLLRTWLEPFY---EDFGWMRRACKGLDRHLIEDGLANTI  576

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL+  QE+L           +DCP++   F  W+RRA
Sbjct  577  LTLPLATQQEILLAWFDRFLNAGDDCPNIQRGFEVWWRRA  616



>ref|XP_010922477.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Elaeis 
guineensis]
Length=544

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 29/164 (18%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            ++ WLVE +I  R+ D  V  W+++    +            + +P +    + R T +L
Sbjct  383  NIQWLVEILINKRMCDEFVTLWADETELAS----------CHSKIPCMYRYEISRITAQL  432

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLI--------ACKDNVSPMMPNHKQLYLELEETF  362
              A+  G +L  +  R+ L++ WL  L         AC+     M          +E+  
Sbjct  433  CIAIGKGHLLVSKDARISLLRTWLEALYEDFGWMKRACRIFDKKM----------VEDGL  482

Query  361  LRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             + I TLP++  Q +L +         +DCP++  AF  W+RRA
Sbjct  483  CQTILTLPMAQQQTILLRWFDCFLNKGDDCPNMQRAFEVWWRRA  526



>ref|XP_009388509.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388510.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388511.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388512.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388513.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Musa 
acuminata subsp. malaccensis]
Length=532

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 75/164 (46%), Gaps = 16/164 (10%)
 Frame = -2

Query  718  HTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVV  539
            H A+    +LLWLVE + +   AD     W+ Q    A+L          + +P +   +
Sbjct  364  HIAL-EADNLLWLVEILADRHAADEFAVLWAGQHEL-AELH---------SKLPIMSRHL  412

Query  538  LRC-TCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EET  365
            + C T +L   +  G IL  R  R  L++ WL  LI    + S +    +    ++ EE 
Sbjct  413  VSCITARLFVGIGKGEILPPRDTRQLLLQVWLQPLIG---DYSWLQHGCRSFDRKVVEEG  469

Query  364  FLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
              + I TLPL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  470  IGQTILTLPLEDQQSILLSWLGSFLKVGDNCPNLQRAFEVWWRR  513



>ref|XP_002521651.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40758.1| conserved hypothetical protein [Ricinus communis]
Length=433

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/172 (23%), Positives = 77/172 (45%), Gaps = 22/172 (13%)
 Frame = -2

Query  733  QRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWS-----NQVSFTADLQRAFRDDAWR  569
            +R++   A    + LLW+ +++      D A+ +WS     N +SF+A+           
Sbjct  271  ERVDDLVAEKFAQELLWITDKLRAYGAVDEAMVQWSSATGLNSLSFSAN-----------  319

Query  568  NYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVS-PMMPNHK  392
               P +   +++ +  L   +S   +   RQV+  L+  W+P+     + +S P + + +
Sbjct  320  ---PRVQGYIVKISAILLADLSGDKVEVPRQVKFGLLALWIPLFCYANNGISYPFLTSFE  376

Query  391  QLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFR  236
            ++  ++E     +ISTLP  D + +L   L   T    D P L  ++  W R
Sbjct  377  KM--QVERAMDEVISTLPAKDQEIILTNWLQDFTVCASDWPDLQVSYDRWCR  426



>ref|XP_009628159.1| PREDICTED: BTB/POZ domain-containing protein At1g63850 [Nicotiana 
tomentosiformis]
Length=667

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 77/160 (48%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L W+++ +I+ ++A+  ++ W++Q    ++L  A          P +PA+    V R T
Sbjct  500  NLHWILDILIDRQIAEDFLRTWASQ----SELSVAH---------PKVPALHRYEVSRVT  546

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +LA +  R  L++ WL   +   ++   M    + L   L E+     I
Sbjct  547  ARLFVGIGKGQLLASKDARCSLLQTWL---LPFYEDFGWMRRASRGLDRHLIEDGLSNTI  603

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLP++  QE+L         + +DCP++   F  W+RRA
Sbjct  604  LTLPMALQQEILTSWFDRFLNSGDDCPNIQRGFEIWWRRA  643



>ref|XP_009590559.1| PREDICTED: uncharacterized protein LOC104087710 [Nicotiana tomentosiformis]
Length=417

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/172 (24%), Positives = 78/172 (45%), Gaps = 15/172 (9%)
 Frame = -2

Query  745  PEAI---QRLNLHTAMTNGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDA  575
            P A+   +R+N   A  + + LLW+  +M+     D A+ +WS    F + L        
Sbjct  248  PSAVPCEERVNDLAAEKHAQELLWITTKMVGCGAVDEALVQWS----FASGLASISLSSN  303

Query  574  WRNYVPGLPAVVLRCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVS-PMMPN  398
             R     +   +++ T  L   + +      RQV+  ++  WLP+     + +S P++  
Sbjct  304  SR-----VQGFIVKITAILFGELKLMKNEVPRQVKFNILVLWLPLFCYADNGLSYPVLTG  358

Query  397  HKQLYLELEETFLRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTW  242
             +++  E+E+T   +IS+LP  D + +L   L   T    D P+L  ++  W
Sbjct  359  FEKV--EMEKTMDELISSLPTIDQEVILTNWLQDFTTTSSDWPNLQKSYDLW  408



>emb|CBI29026.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/159 (25%), Positives = 75/159 (47%), Gaps = 12/159 (8%)
 Frame = -2

Query  697  RHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKL  518
            + LLW+++++      D A+ +WS    F + L  +F   A     P +   +++ +  L
Sbjct  331  QELLWIMDKLRGCGAVDEALMQWS----FASGLA-SFSLTA----NPRVQGSIVKISAIL  381

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVS-PMMPNHKQLYLELEETFLRIISTL  341
               +S       RQV+ +L+  WLP+     + ++ P +  +++   E E    R+ISTL
Sbjct  382  VEELSRVDFEVPRQVKFRLIGLWLPLFCFAGNGLAFPFLTGYEKA--ETERALDRVISTL  439

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRANR  224
            P +D + +L   L   T +  D P+L  ++  W R   +
Sbjct  440  PATDQEVILTNWLQDFTISASDWPNLQVSYDRWCRSTRK  478



>ref|XP_006425769.1| hypothetical protein CICLE_v10026330mg [Citrus clementina]
 gb|ESR39009.1| hypothetical protein CICLE_v10026330mg [Citrus clementina]
Length=254

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 70/156 (45%), Gaps = 15/156 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRC-TCKL  518
            +L WL+E +   + AD     W++Q    A            + +P +    + C T +L
Sbjct  88   NLSWLLEILAIRQAADEFALMWASQQELAA----------LHSKIPVVTRYRISCITARL  137

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +L  +  R  L++ WL  LI   D+ S +    +    ++ EE   R I TL
Sbjct  138  FVGIGRGELLPSKDTRQMLLQTWLQPLI---DDYSWLQHGCRSFDRKVVEEGIGRTILTL  194

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            PL + Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  195  PLEEQQSILLAWLGSFLKAGDNCPNLQRAFEVWWRR  230



>gb|KCW85653.1| hypothetical protein EUGRSUZ_B02440 [Eucalyptus grandis]
Length=539

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 66/156 (42%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+VE +I+  + D  VK W +Q       + +   +R +            + R T +L 
Sbjct  376  WIVEILIDKNMGDEFVKLWGDQKELAILHSKIPTVYRHE------------ISRVTAQLC  423

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
             A+  G IL  +  R+ L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  424  VAMGKGLILVPKNTRLSLLSTWLEALY---EDFGWMRRASRSMDKKLLEDGLGQTILTLP  480

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +            +DCP +  AF  W+RRA
Sbjct  481  LPQQQAIFLNWFDRYLNKGDDCPDIQKAFEIWWRRA  516



>gb|KFK27540.1| hypothetical protein AALP_AA8G396600 [Arabis alpina]
Length=360

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 73/164 (45%), Gaps = 22/164 (13%)
 Frame = -2

Query  703  NGRHLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VL  536
               ++LW+V+ +IE ++ D  VK W++Q                 N    +P +    + 
Sbjct  193  EAENMLWMVDILIEKKMCDEFVKLWADQKELA-------------NLHSKIPTMYRHEIS  239

Query  535  RCTCKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMP-NHKQLYLEL-EETF  362
            + T ++   +  G IL +R+ R  ++  WL  L    D+   M   + + L  +L E+  
Sbjct  240  KITAQICVGIGRGRILVNRETRFAVLNTWLEALY---DDFGWMRRLSSRTLDRKLVEDGL  296

Query  361  LRIISTLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             + I TL L   Q +L +         +DCP++  AF  W+RRA
Sbjct  297  SQTILTLSLRQQQVILMKWFDRFLSKGDDCPNVQRAFEVWWRRA  340



>ref|XP_006828235.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
 gb|ERM95651.1| hypothetical protein AMTR_s00023p00185370 [Amborella trichopoda]
Length=489

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+V+ +++ ++ +  V  W++Q   +A   R          +P +    + + T +L
Sbjct  322  NLQWVVDILVDRQMGEEFVSLWADQSELSALHSR----------IPTMYRYEISKVTAQL  371

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G IL  ++ R  L++ WL  L    D+   M    K +  +L E+   + + TL
Sbjct  372  CVAIGRGQILTSKEARFSLLQTWLEALY---DDFGWMRRAGKPIDKKLVEDGLSQTVLTL  428

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            PL+  Q ++         N +D P+L  AF  W+RRA
Sbjct  429  PLAQQQVIVVNWFDRFLNNGDDYPNLRRAFEVWWRRA  465



>gb|ACR38622.1| unknown [Zea mays]
Length=389

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 66/158 (42%), Gaps = 14/158 (9%)
 Frame = -2

Query  694  HLLWLVERMI-ELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKL  518
            +L+WLVE ++   R  D  V  WS Q    A    A                V R T +L
Sbjct  230  NLVWLVEMLVASQRACDGFVALWSGQAELAASHAGAPAASR---------HAVSRVTARL  280

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLI---ACKDNVSPMMPNHKQLYLELEETFLRIIS  347
               V  G +L  R  R++L++ WL  LI   A         P      L +E+   + I 
Sbjct  281  FVGVGRGEMLPPRDARLRLLQVWLQPLIDDYAWLQRAGGSRPAAFDRRL-VEDGIGQTIL  339

Query  346  TLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
            TLPL D + LL        +  +DCP+L  AF  W+RR
Sbjct  340  TLPLEDQRSLLLAWFGRFLKLGDDCPNLQRAFEVWWRR  377



>ref|XP_010547478.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547479.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010547480.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like isoform 
X2 [Tarenaya hassleriana]
Length=512

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 21/160 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +L WL++ + E R A+     W++Q    A L               LP +    + R +
Sbjct  358  NLSWLLDMLAERRAAEEFAVRWASQKEL-ASLHE------------NLPLMTRFHISRVS  404

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L   +  G +L  ++ R++L++ WL  LI   ++ + +    +    +L EE   R I
Sbjct  405  SRLFIGIGRGEVLPSKETRLELLRRWLQPLI---NDYNWLQHGCRSFDGKLVEEGIGRTI  461

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             TLPL D Q +L   ++      + CP+L  AF  W+RR+
Sbjct  462  LTLPLEDQQSILLSWMASFLTTGDGCPNLQRAFEVWWRRS  501



>ref|XP_010043649.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g60050 [Eucalyptus grandis]
Length=520

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 66/156 (42%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQVSFT---ADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+VE +I+  + D  VK W +Q       + +   +R +            + R T +L 
Sbjct  357  WIVEILIDKNMGDEFVKLWGDQKELAILHSKIPTVYRHE------------ISRVTAQLC  404

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
             A+  G IL  +  R+ L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  405  VAMGKGLILVPKNTRLSLLSTWLEALY---EDFGWMRRASRSMDKKLLEDGLGQTILTLP  461

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +            +DCP +  AF  W+RRA
Sbjct  462  LPQQQAIFLNWFDRYLNKGDDCPDIQKAFEIWWRRA  497



>ref|XP_010941924.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
 ref|XP_010941925.1| PREDICTED: BTB/POZ domain-containing protein At3g50780-like [Elaeis 
guineensis]
Length=526

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 21/159 (13%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV----VLRCT  527
            +LLWLVE + +  +A      WS+Q    A+L               LP V    V   T
Sbjct  365  NLLWLVEILADRHMAGEFAVMWSSQNEL-AELHSK------------LPIVSRHPVSSIT  411

Query  526  CKLANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRII  350
             +L  A+  G +L  +  R +L+  WL  LI   D+ S +    +    ++ EE   + I
Sbjct  412  ARLFVAIGRGEMLPSKDTRQQLLHVWLQPLI---DDYSWLQHGCRSFDRKVVEEGIGQTI  468

Query  349  STLPLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRR  233
             TLPL D Q +L   L    +  ++CP+L  AF  W+RR
Sbjct  469  LTLPLEDQQNILLSWLGSFLKVGDNCPNLQRAFEVWWRR  507



>ref|XP_006591005.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Glycine 
max]
Length=494

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 70/156 (45%), Gaps = 19/156 (12%)
 Frame = -2

Query  685  WLVERMIELRVADTAVKEWSNQ---VSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            W+V+ +I  +++D  VK W+ Q    +  + +   +R +            + R T +L 
Sbjct  331  WIVDILIGKKMSDEFVKIWAEQKELATLHSKISTVYRHE------------ISRITAQLC  378

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTLP  338
              +  G IL  +++R  L+  WL  L    ++   M    + +  +L E+   + I TLP
Sbjct  379  IGIGRGHILVPKEIRFSLLSTWLEALY---EDFGWMRRASRAVDRKLIEDGLSQTILTLP  435

Query  337  LSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            L   Q +L           +DCP++  AF  W+RRA
Sbjct  436  LLQQQSVLLNWFDRFLNKGDDCPNIQKAFEIWWRRA  471



>ref|XP_007016614.1| BTB/POZ domain-containing protein [Theobroma cacao]
 gb|EOY34233.1| BTB/POZ domain-containing protein [Theobroma cacao]
Length=512

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 72/157 (46%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGL-PAVVLRCTCKL  518
            +L W+V+ +I+ R+A+  VK W++Q    A            + +P +    + R T +L
Sbjct  346  NLQWIVDILIDKRMANDFVKLWADQRELAA----------LHSKIPIMYRHEISRITAQL  395

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
              A+  G IL  +  R  L+  WL  L    ++   M    + +  +L E+   + I TL
Sbjct  396  CIAIGRGNILVPKDSRFSLLSTWLEALY---EDFGWMRRASRSVDKKLVEDGLSKTILTL  452

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             L   Q +L           +DCP++ +AF  W+RRA
Sbjct  453  SLRQQQVILLSWFDRFLNKGDDCPNIQTAFEVWWRRA  489



>ref|XP_011073126.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g63850 [Sesamum indicum]
Length=615

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L WL++ +I+ ++A+  +K WS+Q    +DL          + VP +    V R T +L
Sbjct  448  NLHWLLDILIDRQIAEDFLKIWSSQ----SDLAHV------HSKVPPIHRYEVSRVTARL  497

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +    +LA ++ R  L++ WL   +   ++   M    + L   L E+     ISTL
Sbjct  498  FVGIGKRQLLASKEARCMLLQTWL---VPFYEDFGWMRRASRGLDRHLIEDGLSNTISTL  554

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            P++  QE+L         + +DCP++   F  W+RRA
Sbjct  555  PMAWQQEILTSWFDRFLNSGDDCPNIQRGFEVWWRRA  591



>ref|XP_010443796.1| PREDICTED: BTB/POZ domain-containing protein At5g60050-like [Camelina 
sativa]
Length=498

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 75/157 (48%), Gaps = 14/157 (9%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAVVLRCTCKLA  515
            ++LW+V+ +IE R+ D  VK W++Q    A+L        +R+ +        + T ++ 
Sbjct  334  NMLWMVDILIEKRLCDEFVKLWADQKEL-ANLHSKI-PTMYRHEIS-------KVTAQIC  384

Query  514  NAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMP-NHKQLYLEL-EETFLRIISTL  341
              +  G +L +R+ R  ++  WL  L    D+   M   + + L  +L E+   + I TL
Sbjct  385  IGIGKGRVLVNRETRFAVLNTWLEALY---DDFGWMRRLSSRSLDRKLVEDGLSQTILTL  441

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
             L   Q +L +         +DCP++  AF  W+RRA
Sbjct  442  SLRQQQVILMKWFDRFLSKGDDCPNVQRAFEVWWRRA  478



>emb|CDP12055.1| unnamed protein product [Coffea canephora]
Length=648

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 75/157 (48%), Gaps = 15/157 (10%)
 Frame = -2

Query  694  HLLWLVERMIELRVADTAVKEWSNQVSFTADLQRAFRDDAWRNYVPGLPAV-VLRCTCKL  518
            +L W+++ +I+ ++A+  +K W+ Q    ++L  A       + VP +    V R T +L
Sbjct  481  NLHWVLDILIDRQIAEDFLKTWACQ----SELSEA------HSKVPAIHRYEVSRVTARL  530

Query  517  ANAVSMGTILADRQVRMKLVKNWLPVLIACKDNVSPMMPNHKQLYLEL-EETFLRIISTL  341
               +  G +LA +  R  L++ WL   +   ++   M    K L   L E+     I TL
Sbjct  531  FVGIGKGQLLASKDARCLLLQTWL---VPFYEDFGWMRRASKGLDRHLIEDGLCNTILTL  587

Query  340  PLSDAQELLQQCLSFSTRNVEDCPHLISAFTTWFRRA  230
            P++  QE+L         + +DCP++   F  W+RRA
Sbjct  588  PMAWQQEILMSWFDRFLNSGDDCPNIQRGFEVWWRRA  624



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630