BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002F19

Length=731
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAM12952.1|  auxin-regulated protein                                 266   5e-84   Zinnia elegans [garden zinnia]
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      261   3e-82   Sesamum indicum [beniseed]
gb|ABI36491.1|  AUX/IAA8A                                               252   4e-81   Malus domestica [apple tree]
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      257   2e-80   Cicer arietinum [garbanzo]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    258   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             258   2e-80   Prunus persica
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           258   2e-80   Prunus mume [ume]
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    258   3e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    258   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    255   4e-80   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             256   5e-80   Phaseolus vulgaris [French bean]
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    255   1e-79   Cicer arietinum [garbanzo]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             255   1e-79   Phaseolus vulgaris [French bean]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           255   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 254   2e-79   Medicago truncatula
gb|ABY48132.1|  GH1 protein                                             254   2e-79   Medicago truncatula
gb|ADL36578.1|  ARF domain class transcription factor                   255   3e-79   Malus domestica [apple tree]
gb|AGV54485.1|  auxin-responsive protein                                254   3e-79   Phaseolus vulgaris [French bean]
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      254   3e-79   Sesamum indicum [beniseed]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      254   3e-79   Citrus sinensis [apfelsine]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             254   3e-79   Citrus clementina [clementine]
gb|ABW24025.1|  aux/IAA protein                                         246   6e-79   Eucommia ulmoides
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    253   8e-79   Eucalyptus grandis [rose gum]
ref|XP_007047689.1|  Transcription factor, putative isoform 3           252   1e-78   
gb|KHN04889.1|  Auxin-responsive protein IAA8                           249   3e-78   Glycine soja [wild soybean]
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      252   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           251   3e-78   Glycine max [soybeans]
ref|XP_007047687.1|  Transcription factor, putative isoform 1           252   4e-78   Theobroma cacao [chocolate]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           251   4e-78   Fragaria vesca subsp. vesca
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    251   6e-78   
gb|AAB70005.1|  GH1 protein                                             250   7e-78   Glycine max [soybeans]
gb|ACJ84551.1|  unknown                                                 250   8e-78   Medicago truncatula
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             249   2e-77   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                249   2e-77   Erythranthe guttata [common monkey flower]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           248   7e-77   Glycine soja [wild soybean]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    248   7e-77   Glycine max [soybeans]
gb|AFK49626.1|  unknown                                                 248   8e-77   Medicago truncatula
gb|AFK38170.1|  unknown                                                 247   9e-77   Lotus japonicus
gb|KHN22187.1|  Auxin-responsive protein IAA9                           247   1e-76   Glycine soja [wild soybean]
gb|KJB18136.1|  hypothetical protein B456_003G035700                    248   2e-76   Gossypium raimondii
emb|CDP00957.1|  unnamed protein product                                247   2e-76   Coffea canephora [robusta coffee]
ref|XP_002302351.1|  auxin-responsive family protein                    246   7e-76   Populus trichocarpa [western balsam poplar]
emb|CAC84706.1|  aux/IAA protein                                        246   8e-76   Populus tremula x Populus tremuloides
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      246   8e-76   Populus euphratica
gb|AFZ78618.1|  hypothetical protein                                    245   9e-76   Populus tomentosa [Chinese white poplar]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                     245   1e-75   Gossypium arboreum [tree cotton]
gb|KDP32156.1|  hypothetical protein JCGZ_12617                         244   3e-75   Jatropha curcas
emb|CBI19314.3|  unnamed protein product                                242   5e-75   Vitis vinifera
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like      244   7e-75   Cucumis sativus [cucumbers]
gb|AAL92850.1|  Aux/IAA protein                                         243   8e-75   Vitis vinifera
ref|NP_001268170.1|  Aux/IAA protein                                    243   8e-75   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              243   8e-75   Vitis vinifera
ref|XP_002528895.1|  transcription factor, putative                     243   9e-75   Ricinus communis
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     241   2e-74   Gossypium arboreum [tree cotton]
gb|ABM53871.1|  IAA3                                                    234   3e-74   Cestrum elegans
gb|KJB71166.1|  hypothetical protein B456_011G109000                    241   4e-74   Gossypium raimondii
gb|KJB71165.1|  hypothetical protein B456_011G109000                    241   4e-74   Gossypium raimondii
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      240   4e-74   Nicotiana tomentosiformis
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      239   1e-73   Nicotiana sylvestris
gb|ABB55368.1|  Aux/IAA protein-like                                    239   2e-73   Solanum tuberosum [potatoes]
ref|NP_001275473.1|  Aux/IAA protein                                    239   2e-73   Solanum tuberosum [potatoes]
emb|CAI77628.1|  Aux/IAA protein                                        236   6e-73   Solanum lycopersicum
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      238   7e-73   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    237   1e-72   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 237   1e-72   
gb|ABM53870.1|  IAA2                                                    229   2e-72   Cestrum elegans
emb|CAD10639.1|  IAA9 protein                                           236   2e-72   Nicotiana tabacum [American tobacco]
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          237   3e-72   Amborella trichopoda
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like      236   3e-72   Cucumis melo [Oriental melon]
ref|XP_007047688.1|  Transcription factor, putative isoform 2           236   7e-72   Theobroma cacao [chocolate]
gb|KJB64033.1|  hypothetical protein B456_010G031600                    234   7e-72   Gossypium raimondii
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 234   1e-71   Malus domestica [apple tree]
gb|KJB58777.1|  hypothetical protein B456_009G226000                    234   2e-71   Gossypium raimondii
emb|CDP02673.1|  unnamed protein product                                234   2e-71   Coffea canephora [robusta coffee]
gb|KJB58781.1|  hypothetical protein B456_009G226000                    234   3e-71   Gossypium raimondii
gb|KJB64027.1|  hypothetical protein B456_010G031600                    234   3e-71   Gossypium raimondii
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    233   4e-71   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      233   5e-71   Pyrus x bretschneideri [bai li]
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             233   5e-71   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                231   6e-71   Erythranthe guttata [common monkey flower]
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      233   8e-71   Prunus mume [ume]
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         233   8e-71   Jatropha curcas
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             233   1e-70   Prunus persica
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg             231   1e-70   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          232   1e-70   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    231   2e-70   Citrus sinensis [apfelsine]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      231   2e-70   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    231   2e-70   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      231   3e-70   Cucumis melo [Oriental melon]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 231   3e-70   Cucumis sativus [cucumbers]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     231   3e-70   Gossypium arboreum [tree cotton]
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like      230   3e-70   Camelina sativa [gold-of-pleasure]
gb|ABR17764.1|  unknown                                                 230   3e-70   Picea sitchensis
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             231   4e-70   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             231   5e-70   Phaseolus vulgaris [French bean]
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   230   8e-70   Citrus sinensis [apfelsine]
ref|NP_179852.1|  auxin-responsive protein IAA8                         229   8e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047690.1|  Transcription factor, putative isoform 4           230   8e-70   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               230   8e-70   Glycine max [soybeans]
gb|ACJ84768.1|  unknown                                                 224   9e-70   Medicago truncatula
gb|KJB18140.1|  hypothetical protein B456_003G035700                    231   9e-70   Gossypium raimondii
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    229   1e-69   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           229   1e-69   Glycine soja [wild soybean]
ref|XP_003543635.1|  PREDICTED: auxin-responsive protein IAA27-like     228   1e-69   Glycine max [soybeans]
ref|NP_001189579.1|  auxin-responsive protein IAA8                      229   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    229   1e-69   Fragaria vesca subsp. vesca
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like      228   1e-69   Camelina sativa [gold-of-pleasure]
gb|AEI70507.1|  auxin-responsive protein                                229   1e-69   Gossypium hirsutum [American cotton]
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8           228   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    229   1e-69   Fragaria vesca subsp. vesca
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg             228   2e-69   Eutrema salsugineum [saltwater cress]
ref|XP_007150643.1|  hypothetical protein PHAVU_005G169600g             228   2e-69   Phaseolus vulgaris [French bean]
gb|ABR16139.1|  unknown                                                 231   4e-69   Picea sitchensis
gb|KHN32629.1|  Auxin-responsive protein IAA27                          226   4e-69   Glycine soja [wild soybean]
gb|KHN09036.1|  Auxin-responsive protein IAA8                           228   7e-69   Glycine soja [wild soybean]
gb|AFK41338.1|  unknown                                                 221   9e-69   Medicago truncatula
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      227   1e-68   Glycine max [soybeans]
ref|NP_001240013.1|  uncharacterized protein LOC100804423               226   1e-68   Glycine max [soybeans]
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                225   1e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     226   1e-68   Nelumbo nucifera [Indian lotus]
emb|CBI36106.3|  unnamed protein product                                224   1e-68   Vitis vinifera
emb|CAN77436.1|  hypothetical protein VITISV_007399                     226   2e-68   Vitis vinifera
ref|XP_003597715.1|  Auxin-responsive protein IAA                       225   3e-68   Medicago truncatula
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     224   6e-68   Vitis vinifera
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                223   9e-68   Erythranthe guttata [common monkey flower]
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           224   1e-67   Ricinus communis
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    224   1e-67   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          223   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           224   2e-67   Glycine max [soybeans]
ref|XP_002303297.1|  auxin-responsive protein IAA27                     224   2e-67   Populus trichocarpa [western balsam poplar]
emb|CBI28036.3|  unnamed protein product                                218   2e-67   Vitis vinifera
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8           224   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             223   2e-67   Eutrema salsugineum [saltwater cress]
ref|NP_850028.1|  auxin-responsive protein IAA8                         222   2e-67   
gb|ABK24636.1|  unknown                                                 224   3e-67   Picea sitchensis
ref|NP_569017.2|  auxin-responsive protein IAA9                         223   3e-67   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     221   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    221   4e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK38538.1|  unknown                                                 221   5e-67   Lotus japonicus
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     221   1e-66   Elaeis guineensis
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    221   1e-66   Populus euphratica
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     220   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   221   2e-66   Citrus sinensis [apfelsine]
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    221   2e-66   Citrus sinensis [apfelsine]
gb|KJB71172.1|  hypothetical protein B456_011G109000                    220   3e-66   Gossypium raimondii
ref|XP_002864969.1|  auxin-induced protein IAA9                         219   4e-66   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             219   5e-66   Citrus clementina [clementine]
ref|XP_011009359.1|  PREDICTED: auxin-responsive protein IAA27-like     219   6e-66   Populus euphratica
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like      220   6e-66   Tarenaya hassleriana [spider flower]
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...    218   6e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             218   7e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           218   7e-66   Ricinus communis
gb|AEV89263.1|  IAA9                                                    218   1e-65   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    219   1e-65   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     218   1e-65   Elaeis guineensis
ref|XP_009130522.1|  PREDICTED: auxin-responsive protein IAA9-lik...    213   1e-65   Brassica rapa
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             218   2e-65   Eutrema salsugineum [saltwater cress]
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          218   2e-65   Vitis vinifera
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...    218   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg             218   2e-65   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...    217   2e-65   Brassica rapa
gb|ABD98054.1|  auxin-regulated protein                                 217   2e-65   Striga asiatica [witchweed]
ref|NP_851275.1|  auxin-responsive protein IAA9                         218   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64650.1|  auxin-induced protein IAA9                              218   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          218   3e-65   Amborella trichopoda
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg             218   3e-65   Capsella rubella
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             216   3e-65   Citrus clementina [clementine]
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg             219   3e-65   Citrus clementina [clementine]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like      216   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     216   4e-65   Nicotiana tomentosiformis
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     216   4e-65   Phoenix dactylifera
emb|CDY68170.1|  BnaCnng57860D                                          216   5e-65   Brassica napus [oilseed rape]
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     216   5e-65   Elaeis guineensis
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like      217   5e-65   
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         217   5e-65   Jatropha curcas
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    216   6e-65   Phoenix dactylifera
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         216   7e-65   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         216   7e-65   
ref|XP_008462174.1|  PREDICTED: auxin-responsive protein IAA27-like     217   8e-65   Cucumis melo [Oriental melon]
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     215   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           216   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          215   1e-64   Cucumis melo [Oriental melon]
ref|XP_002298231.1|  hypothetical protein POPTR_0001s18680g             216   2e-64   
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     214   2e-64   Nicotiana tomentosiformis
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    215   2e-64   Phoenix dactylifera
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           216   2e-64   
emb|CDY18679.1|  BnaA09g07160D                                          214   2e-64   Brassica napus [oilseed rape]
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9           215   2e-64   Camelina sativa [gold-of-pleasure]
emb|CDP03299.1|  unnamed protein product                                215   2e-64   Coffea canephora [robusta coffee]
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     214   2e-64   Phoenix dactylifera
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      216   2e-64   Cicer arietinum [garbanzo]
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     213   4e-64   Nicotiana sylvestris
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      214   4e-64   Medicago truncatula
emb|CDY25617.1|  BnaA04g13090D                                          212   5e-64   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8           212   6e-64   Brassica rapa
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    211   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_009130521.1|  PREDICTED: auxin-responsive protein IAA9-lik...    209   1e-63   Brassica rapa
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     213   1e-63   Elaeis guineensis
ref|XP_002864971.1|  hypothetical protein ARALYDRAFT_358770             216   1e-63   
ref|XP_004141756.1|  PREDICTED: auxin-responsive protein IAA8-like      213   2e-63   Cucumis sativus [cucumbers]
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    211   2e-63   Citrus sinensis [apfelsine]
emb|CDY37837.1|  BnaAnng04980D                                          211   2e-63   Brassica napus [oilseed rape]
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      210   3e-63   Nicotiana sylvestris
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     211   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX89499.1|  BnaC04g35180D                                          210   4e-63   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     209   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     209   6e-63   Nicotiana sylvestris
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     211   6e-63   Cucumis sativus [cucumbers]
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    212   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    212   6e-63   Tarenaya hassleriana [spider flower]
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     211   7e-63   Prunus mume [ume]
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          210   1e-62   Sesamum indicum [beniseed]
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     210   1e-62   Pyrus x bretschneideri [bai li]
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    209   2e-62   Gossypium arboreum [tree cotton]
ref|NP_001280937.1|  auxin-responsive protein IAA27                     209   2e-62   Malus domestica [apple tree]
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like      211   2e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|AEQ94167.1|  auxin induced family protein                            203   2e-62   Elaeis guineensis
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     209   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     209   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_008793077.1|  PREDICTED: auxin-responsive protein IAA27-li...    209   3e-62   Phoenix dactylifera
gb|KEH27147.1|  auxin response factor                                   207   4e-62   Medicago truncatula
gb|AFK45766.1|  unknown                                                 206   4e-62   Medicago truncatula
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             208   5e-62   Phaseolus vulgaris [French bean]
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like     207   5e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABI36495.1|  AUX/IAA27 A                                             201   6e-62   Malus domestica [apple tree]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      209   7e-62   Eucalyptus grandis [rose gum]
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             207   1e-61   Phaseolus vulgaris [French bean]
ref|XP_009380571.1|  PREDICTED: auxin-responsive protein IAA21-li...    207   2e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB54240.1|  hypothetical protein B456_009G026700                    207   2e-61   Gossypium raimondii
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like     207   2e-61   Fragaria vesca subsp. vesca
gb|KHN41649.1|  Auxin-responsive protein IAA27                          206   2e-61   Glycine soja [wild soybean]
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         207   3e-61   Theobroma cacao [chocolate]
ref|NP_001239808.1|  uncharacterized protein LOC100778529               206   3e-61   Glycine max [soybeans]
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          206   4e-61   Prunus mume [ume]
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    207   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_008348504.1|  PREDICTED: auxin-responsive protein IAA21-li...    206   5e-61   Malus domestica [apple tree]
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     204   5e-61   Solanum tuberosum [potatoes]
ref|XP_008348505.1|  PREDICTED: auxin-responsive protein IAA21-li...    206   5e-61   Malus domestica [apple tree]
ref|XP_006584591.1|  PREDICTED: uncharacterized protein LOC100804...    205   5e-61   Glycine max [soybeans]
ref|XP_009377833.1|  PREDICTED: auxin-responsive protein IAA21-like     206   6e-61   Pyrus x bretschneideri [bai li]
gb|KHN16618.1|  Auxin-responsive protein IAA27                          204   6e-61   Glycine soja [wild soybean]
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          205   6e-61   Fragaria vesca subsp. vesca
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             205   8e-61   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    202   8e-61   Gossypium arboreum [tree cotton]
ref|NP_001266034.1|  IAA6 protein                                       204   8e-61   Solanum lycopersicum
ref|XP_003530133.1|  PREDICTED: auxin-responsive protein IAA27-like     205   9e-61   Glycine max [soybeans]
ref|NP_001241183.1|  uncharacterized protein LOC100804782               205   1e-60   Glycine max [soybeans]
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     206   1e-60   Morus notabilis
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     203   1e-60   Nicotiana tomentosiformis
dbj|BAB10673.1|  auxin-induced protein IAA9                             205   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          204   2e-60   Glycine max [soybeans]
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     205   2e-60   Eucalyptus grandis [rose gum]
ref|XP_009353580.1|  PREDICTED: auxin-responsive protein IAA21-like     205   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    205   2e-60   Glycine max [soybeans]
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 203   4e-60   Medicago truncatula
gb|AFK49596.1|  unknown                                                 202   4e-60   Medicago truncatula
ref|XP_006465642.1|  PREDICTED: auxin-responsive protein IAA8-lik...    204   6e-60   Citrus sinensis [apfelsine]
gb|KJB18638.1|  hypothetical protein B456_003G064200                    200   8e-60   Gossypium raimondii
ref|XP_006426927.1|  hypothetical protein CICLE_v10025988mg             203   1e-59   Citrus clementina [clementine]
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    202   1e-59   Gossypium arboreum [tree cotton]
gb|AEI70506.1|  auxin-responsive protein                                202   1e-59   Gossypium hirsutum [American cotton]
gb|KJB56779.1|  hypothetical protein B456_009G135900                    202   1e-59   Gossypium raimondii
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    202   2e-59   Malus domestica [apple tree]
emb|CDY45607.1|  BnaCnng13150D                                          201   4e-59   Brassica napus [oilseed rape]
ref|XP_008783242.1|  PREDICTED: auxin-responsive protein IAA17-li...    201   4e-59   Phoenix dactylifera
gb|AFK35603.1|  unknown                                                 194   4e-59   Lotus japonicus
gb|KJB18635.1|  hypothetical protein B456_003G064200                    201   5e-59   Gossypium raimondii
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...    201   5e-59   Brassica rapa
gb|KJB18637.1|  hypothetical protein B456_003G064200                    201   7e-59   Gossypium raimondii
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          199   8e-59   Tarenaya hassleriana [spider flower]
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like     199   1e-58   Cicer arietinum [garbanzo]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     197   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98008.1|  unnamed protein product                                200   1e-58   Coffea canephora [robusta coffee]
gb|KDP33705.1|  hypothetical protein JCGZ_07276                         199   2e-58   Jatropha curcas
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          200   2e-58   Eucalyptus grandis [rose gum]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     197   2e-58   Elaeis guineensis
gb|EYU21477.1|  hypothetical protein MIMGU_mgv1a011145mg                198   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_002867425.1|  phytochrome-associated protein 2                   198   3e-58   
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          197   3e-58   Brassica rapa
ref|NP_194637.1|  phytochrome-associated protein 2                      198   3e-58   
ref|XP_010107373.1|  Auxin-responsive protein IAA27                     202   4e-58   
gb|AFK41855.1|  unknown                                                 191   6e-58   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     196   6e-58   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     197   7e-58   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    197   7e-58   
gb|AAP44405.1|  auxin-induced protein 2                                 197   8e-58   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    195   1e-57   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     195   1e-57   
ref|XP_007135656.1|  hypothetical protein PHAVU_010G147200g             197   1e-57   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     194   2e-57   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          194   2e-57   
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     194   2e-57   
gb|ACF88333.1|  unknown                                                 195   3e-57   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             193   5e-57   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                            192   5e-57   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg             195   6e-57   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     194   6e-57   
emb|CDY06836.1|  BnaC01g09350D                                          193   6e-57   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     193   7e-57   
ref|XP_007215616.1|  hypothetical protein PRUPE_ppa007893mg             196   8e-57   
dbj|BAJ33683.1|  unnamed protein product                                194   8e-57   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          195   8e-57   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    194   9e-57   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          194   1e-56   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        192   1e-56   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg             196   2e-56   
gb|ABI36497.1|  AUX/IAA27 B                                             187   2e-56   
dbj|BAM10419.1|  Aux/IAA protein                                        187   2e-56   
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     194   2e-56   
dbj|BAJ84870.1|  predicted protein                                      191   3e-56   
gb|EPS59988.1|  auxin-regulated protein                                 193   3e-56   
dbj|BAK01326.1|  predicted protein                                      191   3e-56   
ref|XP_002302075.1|  auxin-induced protein aux28                        191   3e-56   
gb|ADL36587.1|  ARF domain class transcription factor                   189   4e-56   
gb|ABI36496.1|  AUX/IAA26                                               186   4e-56   
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     191   5e-56   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             192   5e-56   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    191   6e-56   
gb|ABI36493.1|  AUX/IAA16 A                                             187   6e-56   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    191   6e-56   
gb|KJB54244.1|  hypothetical protein B456_009G026700                    192   7e-56   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          188   7e-56   
ref|XP_010438351.1|  PREDICTED: auxin-responsive protein IAA27-like     192   8e-56   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     190   1e-55   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          190   1e-55   
gb|KJB42200.1|  hypothetical protein B456_007G141900                    189   2e-55   
emb|CBI35213.3|  unnamed protein product                                187   2e-55   
ref|XP_007024228.1|  Phytochrome-associated protein 2 isoform 1         193   2e-55   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27          191   2e-55   
gb|ACF87179.1|  unknown                                                 190   2e-55   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           189   2e-55   
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             190   2e-55   
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     190   3e-55   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    189   3e-55   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       189   3e-55   
ref|XP_006383686.1|  auxin-induced protein aux28                        189   3e-55   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         189   3e-55   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   189   3e-55   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             189   3e-55   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        189   3e-55   
gb|KJB54243.1|  hypothetical protein B456_009G026700                    190   3e-55   
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...    191   4e-55   
ref|NP_001266049.1|  IAA9 protein                                       189   4e-55   
emb|CDY08767.1|  BnaA06g24570D                                          191   4e-55   
ref|XP_006656052.1|  PREDICTED: auxin-responsive protein IAA21-like     185   4e-55   
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     189   4e-55   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              188   5e-55   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        190   5e-55   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               188   6e-55   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               187   6e-55   
ref|NP_001067209.1|  Os12g0601300                                       189   7e-55   
gb|ABH01143.1|  auxin-regulated protein                                 188   7e-55   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        187   8e-55   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     188   9e-55   
ref|NP_001266052.1|  IAA8                                               189   1e-54   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     187   1e-54   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     187   1e-54   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       187   1e-54   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     187   2e-54   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     187   2e-54   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     187   2e-54   
gb|KJB82525.1|  hypothetical protein B456_013G200700                    186   2e-54   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          187   2e-54   
gb|AEE25654.1|  auxin-responsive protein                                186   3e-54   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    187   3e-54   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                186   3e-54   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          186   3e-54   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     186   4e-54   
gb|AFK44192.1|  unknown                                                 186   4e-54   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like     187   4e-54   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      186   5e-54   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   185   5e-54   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        185   5e-54   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          185   6e-54   
gb|EEC80532.1|  hypothetical protein OsI_22819                          184   6e-54   
gb|KJB11141.1|  hypothetical protein B456_001G242900                    186   6e-54   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          186   6e-54   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 186   7e-54   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          185   7e-54   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             185   9e-54   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     184   9e-54   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    185   9e-54   
gb|KHG04941.1|  Auxin-induced AUX28                                     184   9e-54   
ref|NP_001057554.1|  Os06g0335500                                       186   1e-53   
ref|NP_001242283.1|  uncharacterized protein LOC100795749               186   1e-53   
gb|ACU19136.1|  unknown                                                 184   2e-53   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     184   2e-53   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     184   2e-53   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               183   2e-53   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          183   3e-53   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            183   3e-53   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            181   3e-53   
gb|KJB56782.1|  hypothetical protein B456_009G135900                    186   4e-53   
gb|ABR16302.1|  unknown                                                 186   4e-53   
emb|CDO99148.1|  unnamed protein product                                183   4e-53   
gb|KJB18639.1|  hypothetical protein B456_003G064200                    186   4e-53   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             183   4e-53   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     183   4e-53   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    180   5e-53   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             184   6e-53   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          182   6e-53   
ref|XP_009389389.1|  PREDICTED: auxin-responsive protein IAA17-like     183   1e-52   
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        182   1e-52   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               182   2e-52   
gb|KJB56783.1|  hypothetical protein B456_009G135900                    186   2e-52   
gb|EMS67401.1|  Auxin-responsive protein IAA21                          178   2e-52   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   182   2e-52   
gb|ABI36487.1|  AUX/IAA7 A                                              178   2e-52   
gb|KHN18836.1|  Auxin-induced protein AUX28                             181   3e-52   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         181   3e-52   
gb|ABM53872.1|  IAA4                                                    178   3e-52   
gb|KJB44873.1|  hypothetical protein B456_007G276900                    181   3e-52   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        181   3e-52   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             180   4e-52   
gb|AEE25650.1|  auxin-responsive protein                                181   5e-52   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             180   5e-52   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        181   5e-52   
gb|ACU18407.1|  unknown                                                 180   6e-52   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             180   6e-52   
dbj|BAJ97201.1|  predicted protein                                      180   6e-52   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        180   6e-52   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        180   9e-52   
gb|AGV54230.1|  auxin-induced protein AUX28                             180   9e-52   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     179   1e-51   
emb|CDY40881.1|  BnaCnng09720D                                          177   1e-51   
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like     176   1e-51   
gb|ADN34477.1|  auxin influx carrier                                    174   1e-51   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    179   1e-51   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     179   1e-51   
gb|KCW69644.1|  hypothetical protein EUGRSUZ_F03050                     182   1e-51   
gb|AAV50046.1|  auxin-induced protein                                   177   1e-51   
ref|XP_002311658.1|  aux/IAA family protein                             179   2e-51   
ref|NP_001266070.1|  IAA14                                              179   2e-51   
gb|AFK36086.1|  unknown                                                 179   2e-51   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     179   2e-51   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          179   2e-51   
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     178   2e-51   
gb|AFZ78617.1|  hypothetical protein                                    179   2e-51   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          179   2e-51   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             179   2e-51   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       176   2e-51   
emb|CBI26357.3|  unnamed protein product                                178   3e-51   
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       176   3e-51   
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       176   3e-51   
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                   181   3e-51   
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        178   3e-51   
ref|XP_002315736.1|  aux/IAA family protein                             179   3e-51   
emb|CAH59413.1|  auxin resistance protein                               178   3e-51   
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       176   3e-51   
emb|CDX97478.1|  BnaC08g13430D                                          174   3e-51   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             178   3e-51   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       178   4e-51   
gb|KJB11145.1|  hypothetical protein B456_001G242900                    178   4e-51   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     177   5e-51   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        178   5e-51   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       175   5e-51   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     180   5e-51   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       175   5e-51   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    178   5e-51   
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        178   5e-51   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       175   6e-51   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    177   7e-51   
gb|AAM96891.1|  auxin-responsive protein IAA1                           176   7e-51   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     177   7e-51   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     177   7e-51   
gb|AFK42876.1|  unknown                                                 177   8e-51   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     177   9e-51   
gb|ABM53874.1|  IAA6                                                    174   9e-51   
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          177   9e-51   
emb|CDY41894.1|  BnaC05g47100D                                          177   9e-51   
gb|AFK37379.1|  unknown                                                 177   9e-51   
gb|KJB38280.1|  hypothetical protein B456_006G246000                    177   1e-50   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             177   1e-50   
gb|AEE25653.1|  auxin-responsive protein                                177   1e-50   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     177   1e-50   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     177   1e-50   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          176   1e-50   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    177   1e-50   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    177   1e-50   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    176   1e-50   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590          177   1e-50   
ref|NP_187124.1|  auxin-responsive protein IAA16                        176   1e-50   
gb|ACL81167.1|  auxin-responsive protein IAA1                           177   1e-50   
gb|ADJ68049.1|  auxin responsive protein                                176   1e-50   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      176   2e-50   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     176   2e-50   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          176   2e-50   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    176   2e-50   
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     176   2e-50   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          176   2e-50   
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     176   2e-50   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    176   2e-50   
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          176   2e-50   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    176   2e-50   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             176   2e-50   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     176   2e-50   
gb|ACJ84642.1|  unknown                                                 176   2e-50   
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    176   2e-50   
emb|CDY50750.1|  BnaAnng10570D                                          177   3e-50   
emb|CDP06818.1|  unnamed protein product                                176   3e-50   



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   266 bits (680),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLR+Y++YQ+LSSA+EKMFSCFTIGQCGS
Sbjct  217  SKTNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRSYSTYQQLSSAIEKMFSCFTIGQCGS  276

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            QGAPGRE+LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPWDMFI SCKRLKIMKGSDA
Sbjct  277  QGAPGRESLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIGSCKRLKIMKGSDA  336

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  337  IGLAPRAMEKSKNRN  351



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCG 
Sbjct  212  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGP  271

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            QGAP RE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  272  QGAPSREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  331

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  332  IGLAPRAVEKSKNRN  346



>gb|ABI36491.1| AUX/IAA8A [Malus domestica]
 gb|ABI36492.1| AUX/IAA8 [Malus domestica]
Length=151

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS
Sbjct  17   SKNNDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGS  76

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDA
Sbjct  77   HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDA  136

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  137  IGLAPRAMEKSKNRN  151



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTY +YQELSSALEKMFSCFT+GQCGS GA
Sbjct  217  NDEVDGKPGPTALFVKVSMDGAPYLRKVDLRTYTTYQELSSALEKMFSCFTLGQCGSHGA  276

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMKGSDAIGL
Sbjct  277  PGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKGSDAIGL  336

Query  360  APRAKEKSKSRN  325
            APRA EKSKSR+
Sbjct  337  APRAMEKSKSRS  348



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS
Sbjct  254  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGS  313

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDA
Sbjct  314  HGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDA  373

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  374  IGLAPRAMEKCRNRN  388



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS
Sbjct  244  SKNNDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGS  303

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  304  HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  363

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  364  IGLAPRAMEKSKNRN  378



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQ GS
Sbjct  244  SKNNDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQYGS  303

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  304  HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  363

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  364  IGLAPRAMEKSKNRN  378



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS
Sbjct  275  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGS  334

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDA
Sbjct  335  HGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDA  394

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  395  IGLAPRAMEKCRNRN  409



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS
Sbjct  276  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSAYQELSSALEKMFSCFTIGQCGS  335

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDA
Sbjct  336  HGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDA  395

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  396  IGLAPRAMEKCRNRN  410



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS
Sbjct  192  SKNNDEVDGKPGPTALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGS  251

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  252  HGAPGREMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  311

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSKSR
Sbjct  312  IGLAPRAMEKSKSR  325



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSSALEKMFSCFT+GQCGS
Sbjct  214  SKNNDEVDGKPGPAALFVKVSMDGAPYLRKVDLRNYTTYQELSSALEKMFSCFTLGQCGS  273

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  274  HGVPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  333

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+SR+
Sbjct  334  IGLAPRAMEKSRSRS  348



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGP ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS
Sbjct  219  SKNNDEVDGKPGPTALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGS  278

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  279  HGAPGREMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  338

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSKSR
Sbjct  339  IGLAPRAMEKSKSR  352



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS
Sbjct  216  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGS  275

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDA
Sbjct  276  HGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDA  335

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR 
Sbjct  336  IGLAPRAMEKSKSRT  350



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS
Sbjct  239  SKNNDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGS  298

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDA
Sbjct  299  HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDA  358

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  359  IGLAPRAMEKSKNRN  373



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GA
Sbjct  204  NDEVDGKPGPAALFVKVSMDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGA  263

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGL
Sbjct  264  PGKEMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGL  323

Query  360  APRAKEKSKSRN  325
            APRA EKSKSR+
Sbjct  324  APRAMEKSKSRS  335



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTYA+YQ+LSSALEKMFSCFT+GQCGS GA
Sbjct  204  NDEVDGKPGPAALFVKVSMDGAPYLRKVDLRTYATYQQLSSALEKMFSCFTLGQCGSHGA  263

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C+RLKIMKGSDAIGL
Sbjct  264  PGKEMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCRRLKIMKGSDAIGL  323

Query  360  APRAKEKSKSRN  325
            APRA EKSKSR+
Sbjct  324  APRAMEKSKSRS  335



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEV+GKPGPG LFVKVSMDGAPYLRKVDLRTY++YQ+LSSALEKMFSCFTIGQ GS
Sbjct  239  SKNNDEVNGKPGPGGLFVKVSMDGAPYLRKVDLRTYSTYQDLSSALEKMFSCFTIGQYGS  298

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDA
Sbjct  299  HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDA  358

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  359  IGLAPRAMEKSKNRN  373



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS
Sbjct  218  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGS  277

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSDA
Sbjct  278  HGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSDA  337

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR 
Sbjct  338  IGLAPRAMEKSKSRT  352



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDL+TY++YQELSSALEKMFSCF IGQCGS
Sbjct  225  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLKTYSTYQELSSALEKMFSCFIIGQCGS  284

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +GAP RE LSESKL+D +HGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDA
Sbjct  285  EGAPSRETLSESKLKDLIHGSEYVLTYEDKDGDWMLVGDVPWEMFIASCKRLKIMKGSDA  344

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK RN
Sbjct  345  IGLAPRAVEKSKVRN  359



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS
Sbjct  242  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGS  301

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
              APGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  302  HEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  361

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK RN
Sbjct  362  IGLAPRAMEKSKIRN  376



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY +Y ELSSALEKMFSCFTIGQCGS
Sbjct  242  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYTNYGELSSALEKMFSCFTIGQCGS  301

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
              APGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  302  HEAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  361

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK RN
Sbjct  362  IGLAPRAMEKSKIRN  376



>gb|ABW24025.1| aux/IAA protein [Eucommia ulmoides]
Length=156

 Score =   246 bits (628),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGKPGPG+LFVKVSMDGAPYLRKVDL TY +YQELSSALEKMFSCF IGQC S
Sbjct  22   SKNNEEVDGKPGPGSLFVKVSMDGAPYLRKVDLGTYTTYQELSSALEKMFSCFIIGQCAS  81

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            QGA  +E LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  82   QGASAKEKLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  141

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK++N
Sbjct  142  IGLAPRAMEKSKNKN  156



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   253 bits (647),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGAL+VKVSMDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS
Sbjct  243  SKDNDEVDGKPGPGALYVKVSMDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGS  302

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE L+ESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DA
Sbjct  303  NGTPGREMLNESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADA  362

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  363  IGLAPRALEKSKARN  377



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS
Sbjct  211  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGS  270

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G+PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  271  HGSPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  330

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+ N
Sbjct  331  IGLAPRAMEKSKNSN  345



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCG  553
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCG
Sbjct  154  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCG  213

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSD
Sbjct  214  SHGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSD  273

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EKSKSR+
Sbjct  274  AIGLAPRAMEKSKSRS  289



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS
Sbjct  252  SKNNEEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSNYQELSSALEKMFSCFTIGQCGS  311

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK SDA
Sbjct  312  HGPPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSDA  371

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK + RN
Sbjct  372  IGLAPRAMEKCRKRN  386



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCG  553
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCG
Sbjct  219  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCG  278

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMKGSD
Sbjct  279  SHGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKGSD  338

Query  372  AIGLAPRAKEKSKSR  328
            AIGLAPRA EKSKSR
Sbjct  339  AIGLAPRAMEKSKSR  353



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS
Sbjct  242  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGS  301

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G+PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  302  HGSPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  361

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+ N
Sbjct  362  IGLAPRAMEKSKNSN  376



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY +YQELSSALEKMFSCFTIGQ GS
Sbjct  236  SKNSDEVDGKPGRGALFVKVSMDGAPYLRKVDLRTYGTYQELSSALEKMFSCFTIGQYGS  295

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDA
Sbjct  296  HGAPGRERLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDA  355

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR+ EKSK RN
Sbjct  356  IGLAPRSMEKSKIRN  370



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCG  553
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCG
Sbjct  224  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCG  283

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSD
Sbjct  284  SHGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSD  343

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EKSKSR+
Sbjct  344  AIGLAPRAMEKSKSRS  359



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMF-SCFTIGQCG  553
            +K NDEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMF SCFT+GQCG
Sbjct  204  NKNNDEVDGKPGVGALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCG  263

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S GAPGRE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMKGSD
Sbjct  264  SHGAPGREMLSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKGSD  323

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EKSKSR+
Sbjct  324  AIGLAPRAMEKSKSRS  339



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   250 bits (639),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS
Sbjct  214  SKNNDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGS  273

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  274  HGGPGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  333

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR+
Sbjct  334  IGLAPRAMEKSKSRS  348



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS
Sbjct  222  SKNNDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGS  281

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  282  HGGPGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  341

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR+
Sbjct  342  IGLAPRAMEKSKSRS  356



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGP ALFVKVSMDGAPYLRKVDLRTY++YQELSS LEKMFSCFT+GQCG 
Sbjct  210  SKNNDEVDGKPGPTALFVKVSMDGAPYLRKVDLRTYSTYQELSSGLEKMFSCFTLGQCGP  269

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA  RE +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW MFI SCKRLKIMKGSDA
Sbjct  270  AGAQTREMMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIASCKRLKIMKGSDA  329

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  330  IGLAPRAVEKSKNRN  344



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK G  ALFVKVSMDGAPYLRKVDLR Y  YQELSSALEKMFSCFT+GQCGS
Sbjct  216  SKNNDEVDGKLGAAALFVKVSMDGAPYLRKVDLRNYTMYQELSSALEKMFSCFTLGQCGS  275

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  276  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  335

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKS+SR
Sbjct  336  IGLAPRAMEKSRSR  349



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  A+FVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS
Sbjct  216  SKNNDEVDGKPGAAAIFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGS  275

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  276  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  335

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKS+SR
Sbjct  336  IGLAPRAMEKSRSR  349



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR Y +YQELSS LEKMFSCFT+GQCGS
Sbjct  214  SKNNDEVDGKPGAAALFVKVSMDGAPYLRKVDLRNYTTYQELSSDLEKMFSCFTLGQCGS  273

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+DFLHGSEYV+TYEDKDGDWMLVGDVPWDMFI++CKRLKIMKG DA
Sbjct  274  HGGPGKEMLSESKLKDFLHGSEYVVTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGFDA  333

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR+
Sbjct  334  IGLAPRAMEKSKSRS  348



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score =   247 bits (631),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +YQELSSALEKMFSCFT+GQCGS
Sbjct  213  SKNNDEVDGKPGLSALFVKVSMDGAPYLRKVDLRSYTTYQELSSALEKMFSCFTLGQCGS  272

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKLRD LHGSEYVL+YEDKDGDWMLVGDVPW+MF E+C+RLKIMKGSDA
Sbjct  273  HGAPGRELLSESKLRDLLHGSEYVLSYEDKDGDWMLVGDVPWEMFTETCRRLKIMKGSDA  332

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK R+
Sbjct  333  IGLAPRAMEKSKIRS  347



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS
Sbjct  216  SKNNDEVDGKPGAVALFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGS  275

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  276  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  335

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKS+SR
Sbjct  336  IGLAPRAMEKSRSR  349



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS
Sbjct  235  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGS  294

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  295  NGTAGKETLSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  354

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+ N
Sbjct  355  IGLAPRAMEKSKANN  369



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SKV +EVDGK GPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFTIGQCGS
Sbjct  232  SKVAEEVDGKSGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTIGQCGS  291

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDA
Sbjct  292  HGVEGKEVLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK++SRN
Sbjct  352  IGLAPRAVEKNRSRN  366



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  232  SKNTEEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  291

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  292  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  352  IGLAPRAMEKCKNRN  366



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  231  SKNTEEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  291  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  351  IGLAPRAMEKCKNRN  365



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  232  SKNTEEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  291

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  292  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  352  IGLAPRAMEKCKNRN  366



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  231  SKNTEEVDGKAGPGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  291  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  351  IGLAPRAMEKCKNRN  365



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGA+FVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS
Sbjct  234  SKNNDEVDGKPGPGAVFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGS  293

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  294  HGTAGKEILSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  353

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+ N
Sbjct  354  IGLAPRAVEKSKANN  368



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG GALF+KVSMDGAPYLRKVDLRTY++YQELS ALEKMFSCFTIGQCGS
Sbjct  246  SKNNDEVDGKPGLGALFIKVSMDGAPYLRKVDLRTYSTYQELSCALEKMFSCFTIGQCGS  305

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E LSE KLRD L+GSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMK SDA
Sbjct  306  HGAPGKEKLSEIKLRDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKIMKSSDA  365

Query  369  IGLAPRAKEKSK  334
            IGLAPRA EKSK
Sbjct  366  IGLAPRAMEKSK  377



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   242 bits (618),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  187  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  246

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  247  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  306

Query  360  APRAKEKSKSRN  325
            APRA EK K+RN
Sbjct  307  APRAVEKCKNRN  318



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSM+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS
Sbjct  246  SKNNDEVDGKPGSSALFVKVSMEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGS  305

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GR+ LSESKLRD LHGSEYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDA
Sbjct  306  HGASGRDKLSESKLRDHLHGSEYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDA  365

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA E++K+R
Sbjct  366  IGLAPRATERTKNR  379



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   243 bits (619),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  360  APRAKEKSKSRN  325
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   243 bits (619),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  360  APRAKEKSKSRN  325
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   243 bits (619),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  360  APRAKEKSKSRN  325
            APRA EK K+RN
Sbjct  348  APRAVEKCKNRN  359



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDLRT+++YQELS ALEKMFSCFTIGQCGS
Sbjct  248  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRTHSTYQELSRALEKMFSCFTIGQCGS  307

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAP RE LSESKLRD L+GSEY LTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  308  HGAPEREKLSESKLRDLLNGSEYALTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  367

Query  369  IGLAPRAKEKSK  334
            IGLAPRA EK K
Sbjct  368  IGLAPRAMEKFK  379



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+
Sbjct  217  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGA  276

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DA
Sbjct  277  HGTPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADA  336

Query  369  IGLAPRAKEKSK  334
            IGLAP+A +KSK
Sbjct  337  IGLAPKAMDKSK  348



>gb|ABM53871.1| IAA3 [Cestrum elegans]
Length=153

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EV+GK G  ALF+KVSMDGAPYLRKVDLR Y++Y+ELSSALEKMFSCFTIGQ GS
Sbjct  19   SKNNEEVNGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYRELSSALEKMFSCFTIGQYGS  78

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  79   HGAPGKEMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  138

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  139  IGLAPRAMEKCRSRN  153



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+
Sbjct  217  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGA  276

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DA
Sbjct  277  HGTPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADA  336

Query  369  IGLAPRAKEKSK  334
            IGLAP+A +KSK
Sbjct  337  IGLAPKAMDKSK  348



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+
Sbjct  218  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGA  277

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C+RLKIMK +DA
Sbjct  278  HGTPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRRLKIMKSADA  337

Query  369  IGLAPRAKEKSK  334
            IGLAP+A +KSK
Sbjct  338  IGLAPKAMDKSK  349



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  212  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  271

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  272  HGAPGKEMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  331

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  332  IGLAPRAMEKCRSRN  346



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  212  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  271

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  272  HGAPGKELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  331

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  332  IGLAPRAMEKCRSRN  346



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS
Sbjct  215  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGS  274

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  275  HGAPGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  334

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  335  IGLAPRAMEKCRSRN  349



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLRTY++YQELSSALE MFSCFTIGQ GS
Sbjct  215  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGS  274

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  275  HGAPGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  334

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  335  IGLAPRAMEKCRSRN  349



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score =   236 bits (603),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS
Sbjct  174  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGS  233

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  234  HGAPGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  293

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  294  IGLAPRAMEKCRSRN  308



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGKP PGALF+KVSMDGAPYLRKVDLRTYA+YQELSSALEKMFSCFTIGQCGS
Sbjct  235  SKNNEEVDGKPSPGALFIKVSMDGAPYLRKVDLRTYATYQELSSALEKMFSCFTIGQCGS  294

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E +SESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCK+LKIMKGSDA
Sbjct  295  HGAPGKEKMSESKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKKLKIMKGSDA  354

Query  369  IGLAPRAKE  343
            IGL  ++ +
Sbjct  355  IGLGSKSND  363



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS
Sbjct  215  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGS  274

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  275  HGAPGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  334

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  335  IGLAPRAMEKCRSRN  349



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G  ALF+KVSMDGAPYLRKVDLRT ++YQELSSALEKMFSCFTIGQ GS
Sbjct  215  SKNNEEVDGKAGSPALFIKVSMDGAPYLRKVDLRTCSAYQELSSALEKMFSCFTIGQYGS  274

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMKGSDA
Sbjct  275  HGAPGKDMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKGSDA  334

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  335  IGLAPRAMEKCRSRN  349



>gb|ABM53870.1| IAA2 [Cestrum elegans]
Length=152

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGKPG   L +KVSMDGAPYLRKVDLR Y +YQELSSALE MFSCFTIG+CGS
Sbjct  18   SKTNEEVDGKPGSTVLLIKVSMDGAPYLRKVDLRNYFAYQELSSALENMFSCFTIGECGS  77

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E+LSESKL+D   GSEYVLTYEDKDGDWMLVGDVPW++FI +CKRL+IMK SDA
Sbjct  78   HGAPGKESLSESKLKDLFRGSEYVLTYEDKDGDWMLVGDVPWELFINTCKRLRIMKSSDA  137

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  138  IGLAPRAMEKCRARN  152



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N++VDGK G  ALF+KVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  212  SKNNEKVDGKAGSPALFIKVSMDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGS  271

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG+E LSES+L+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMKGSDA
Sbjct  272  HGAPGKEMLSESQLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKGSDA  331

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR  EK +SRN
Sbjct  332  IGLAPRGMEKCRSRN  346



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K N+EVDGKPG G LFVKVSMDGAPYLRKVDL+TY++YQELS+ALEKMFSCFTIGQCGS 
Sbjct  260  KNNEEVDGKPGFGGLFVKVSMDGAPYLRKVDLKTYSAYQELSTALEKMFSCFTIGQCGSH  319

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G  GR+ LSESKL+D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGSDAI
Sbjct  320  GVSGRDGLSESKLKDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSDAI  379

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK ++RN
Sbjct  380  GLAPRAMEKCRNRN  393



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSM+GAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS
Sbjct  246  SKNNDEVDGKPGSSALFVKVSMEGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGS  305

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GR+ LSESKLRD LHGSEYVLTYED+DGDWMLVG++PW+MFI+SCKRLKI+KGSDA
Sbjct  306  HGVSGRDKLSESKLRDHLHGSEYVLTYEDRDGDWMLVGEIPWEMFIDSCKRLKIVKGSDA  365

Query  369  IGLAPRAKEKSK  334
            IGLAPRA E  K
Sbjct  366  IGLAPRATEIQK  377



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS
Sbjct  242  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGS  301

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G+PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  302  HGSPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  361

Query  369  IGLA  358
            IGLA
Sbjct  362  IGLA  365



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS
Sbjct  196  SKNTDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGS  255

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  256  HGTSGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  315

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  316  IGLAPRAMEKCRNRN  330



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS
Sbjct  230  SKNTEEVDGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFRCFTIGQYGS  289

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDA
Sbjct  290  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDA  348

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  349  IGLAPRAMEKCRNRN  363



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK GP ALFVKVSMDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS
Sbjct  233  SKNTDEVDGKAGPDALFVKVSMDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGS  292

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  293  HGPLGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  352

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  353  IGLAPRAVEKCRNRN  367



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGKP  GALFVKVSM GAPYLRKVDL+TY++YQELSSALEKMFSCFT+GQCG+
Sbjct  240  SKNNNEVDGKPSSGALFVKVSMAGAPYLRKVDLKTYSAYQELSSALEKMFSCFTLGQCGA  299

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +   G+E LSE+KLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+C++LKIMKGSDA
Sbjct  300  EEVSGKEMLSETKLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCRKLKIMKGSDA  359

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR+ EK K+R+
Sbjct  360  IGLAPRSVEKCKNRD  374



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK GP ALFVKVSMDGAPYLRKVDL+ Y+ YQ+LSSALEKMFSCFTIGQCGS
Sbjct  234  SKNTDEVDGKAGPDALFVKVSMDGAPYLRKVDLKNYSKYQDLSSALEKMFSCFTIGQCGS  293

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  294  HGPLGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  353

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  354  IGLAPRAVEKCRNRN  368



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS
Sbjct  223  SKNTDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGS  282

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  283  HGTSGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  342

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  343  IGLAPRAMEKCRNRN  357



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGAL+VKVSMDGAPYLRKVDLR Y++YQELSS+LEKMFS FTIGQCGS
Sbjct  243  SKDNDEVDGKPGPGALYVKVSMDGAPYLRKVDLRNYSTYQELSSSLEKMFSGFTIGQCGS  302

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE L+ESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPW+MFIESCKRLKIMKG+DA
Sbjct  303  NGTPGREMLNESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWEMFIESCKRLKIMKGADA  362

Query  369  IGL  361
            IGL
Sbjct  363  IGL  365



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  230  SKNTEEVDGKSNPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGS  289

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKR++IMK SDA
Sbjct  290  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRMRIMKSSDA  348

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  349  IGLAPRAMEKCRNRN  363



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV+GK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  233  SKNTEEVEGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGS  292

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDA
Sbjct  293  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR+ EK ++RN
Sbjct  352  IGLAPRSMEKCRNRN  366



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 119/135 (88%), Gaps = 8/135 (6%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK ND+V        +FVKVSMDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG 
Sbjct  180  SKKNDDV--------IFVKVSMDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGP  231

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +GAP RE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDA
Sbjct  232  EGAPSREVLSESKLRDILHGSEYVLTYEDKDGDWMLVGDVPWEMFISSCKRLKIMKGSDA  291

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  292  IGLAPRALEKSKNRN  306



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV+GK GPGALFVKVS+DGAPYLRK+DL+ Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  233  SKNTEEVEGKSGPGALFVKVSLDGAPYLRKIDLKNYSAYQELSSALEKMFSCFTIGQYGS  292

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDA
Sbjct  293  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR+ EK ++RN
Sbjct  352  IGLAPRSMEKCRNRN  366



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GP  LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  234  SKNTEEVDGKGGPSGLFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGS  293

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK SDA
Sbjct  294  HGGLGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSSDA  353

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  354  IGLAPRAVEKCKNRN  368



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV+GK GPGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ GS
Sbjct  264  SKNTEEVEGKSGPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGS  323

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++CKR++IMK SDA
Sbjct  324  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWNMFIDTCKRMRIMKSSDA  382

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR+ EK ++RN
Sbjct  383  IGLAPRSMEKCRNRN  397



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG 
Sbjct  187  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGL  246

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  247  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  306

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  307  IGLAPGAVEKSKNKD  321



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK GPGALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS
Sbjct  234  SKNTDEVDGKAGPGALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGS  293

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI +CKRL+IMK SDA
Sbjct  294  HGTLGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWVMFIGTCKRLRIMKSSDA  353

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  354  IGLAPRAVEKCRNRN  368



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS
Sbjct  231  SKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI++CKRL+IMK +DA
Sbjct  291  HGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRIMKSTDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  351  IGLAPRAVEKCRNRN  365



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFT GQ GS
Sbjct  230  SKNTEEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTJGQYGS  289

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDA
Sbjct  290  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDA  348

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  349  IGLAPRAMEKCRNRN  363



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS
Sbjct  230  SKNTEEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGS  289

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDA
Sbjct  290  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDA  348

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  349  IGLAPRAMEKCRNRN  363



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK   GALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+
Sbjct  221  SKNNDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGA  280

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA G E +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDA
Sbjct  281  HGALGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDA  340

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EK ++R
Sbjct  341  IGLAPRAVEKCRNR  354



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK   GALF+KVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+
Sbjct  221  SKNNDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGA  280

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA G E +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK SDA
Sbjct  281  HGALGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSDA  340

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EK ++R
Sbjct  341  IGLAPRAVEKCRNR  354



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGK  PGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS
Sbjct  223  SKNTDEVDGKARPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGS  282

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  283  HGTSGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  342

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  343  IGLAPRAMEKCRNRN  357



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG 
Sbjct  190  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGL  249

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE+KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  250  HGAQGRERMSETKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  309

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  310  IGLAPGAVEKSKNKD  324



>gb|ABR17764.1| unknown [Picea sitchensis]
Length=324

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K NDE DGK G  AL+VKVSMDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS 
Sbjct  191  KTNDEDDGKSGSSALYVKVSMDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSH  250

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PGR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AI
Sbjct  251  GVPGRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAI  310

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  311  GLAPRAMEKCKNRN  324



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS
Sbjct  231  SKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DA
Sbjct  291  HGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  351  IGLAPRAVEKCRNRN  365



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G GALF+KVSMDGAPYLRKVDL  Y++Y ELSSALEKMFSCFTI QCGS
Sbjct  232  SKNNEEVDGKVGVGALFIKVSMDGAPYLRKVDLNNYSTYPELSSALEKMFSCFTISQCGS  291

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK SDA
Sbjct  292  HGILGREMLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSDA  351

Query  369  IGLAPRAKEKSKSR  328
            IGLAPR  EKSKSR
Sbjct  352  IGLAPRTVEKSKSR  365



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTIGQ GS
Sbjct  231  SKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIGQYGS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW+MFI +CKRL+IMK +DA
Sbjct  291  HGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEMFIGTCKRLRIMKSTDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  351  IGLAPRAVEKCRNRN  365



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG 
Sbjct  185  SKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGL  244

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  245  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  304

Query  369  IGLAPRAKEKSKSR  328
            IGLAP A EKSK++
Sbjct  305  IGLAPGAVEKSKNK  318



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALF+KVSMDGAPYLRKVDLRTY++Y+ELSSALEKMFSCFT+GQCGS
Sbjct  242  SKNNDEVDGKPGPGALFIKVSMDGAPYLRKVDLRTYSTYRELSSALEKMFSCFTLGQCGS  301

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G+PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  302  HGSPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  361

Query  369  I  367
            I
Sbjct  362  I  362



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+ VDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS
Sbjct  226  SKNNEVVDGKKGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGS  285

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  286  HGILGREMLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDA  345

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSKSR
Sbjct  346  IGLAPRAVEKSKSR  359



>gb|ACJ84768.1| unknown [Medicago truncatula]
Length=190

 Score =   224 bits (571),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S
Sbjct  56   TKNNDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNS  115

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDA
Sbjct  116  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDA  175

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  176  IGLAPRAMEKSRSQN  190



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTY++YQELSSALEKMFSCFT+GQCGS
Sbjct  235  SKNNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYSTYQELSSALEKMFSCFTLGQCGS  294

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+E LSES+L+D LHGSEYV+TY+DKDGDWMLVGDVPW+MFIE+CKRLKIMK SDA
Sbjct  295  NGTAGKETLSESRLKDLLHGSEYVVTYKDKDGDWMLVGDVPWEMFIETCKRLKIMKSSDA  354

Query  369  IGLAPRAKEKSKSRN  325
            IGL      +S  +N
Sbjct  355  IGLGNYLVSRSLPKN  369



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  A+FVKVSMDGAPYLRKVDL  Y +Y+ELSSALEKMFSCFT+GQCGS
Sbjct  216  SKNNDEVDGKPGAAAIFVKVSMDGAPYLRKVDLTNYTTYRELSSALEKMFSCFTLGQCGS  275

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMFI++CKRLKIMKGSDA
Sbjct  276  HGAPGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRLKIMKGSDA  335

Query  369  IGL  361
            IGL
Sbjct  336  IGL  338



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+ VDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTI +CGS
Sbjct  226  SKNNEVVDGKKGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTISKCGS  285

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE L+E+KL+D LHGSEYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  286  HGILGREMLNETKLKDLLHGSEYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDA  345

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSRN
Sbjct  346  IGLAPRAVEKSKSRN  360



>ref|XP_003543635.1| PREDICTED: auxin-responsive protein IAA27-like [Glycine max]
Length=307

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S
Sbjct  173  TKNNDEAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNS  232

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+A
Sbjct  233  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEA  292

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  293  IGLAPRAMEKSRSQN  307



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG 
Sbjct  202  SKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGL  261

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  262  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  321

Query  369  IGLAPRAKEKSKSR  328
            IGLAP A EKSK++
Sbjct  322  IGLAPGAVEKSKNK  335



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPGPG L+VKVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S
Sbjct  198  SKNADEVDGKPGPGVLYVKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVS  257

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDA
Sbjct  258  HGARGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDA  316

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  317  IGLAPRAMEKCRNRN  331



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG 
Sbjct  191  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGL  250

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  251  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  310

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  311  IGLAPGAVEKSKNKD  325



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  DEVDGK  PGALFVKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFSCFTIGQ GS 
Sbjct  224  KNTDEVDGKARPGALFVKVSMDGAPYLRKVDLKNYTKYQELSSALEKMFSCFTIGQYGSH  283

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDAI
Sbjct  284  GTSGRELLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDAI  343

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK ++RN
Sbjct  344  GLAPRAMEKCRNRN  357



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY  YQ+LSSALEKMFSCFT+GQCG 
Sbjct  190  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTCYQQLSSALEKMFSCFTLGQCGL  249

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  250  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  309

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  310  IGLAPGAVEKSKNKD  324



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPGPG L+VKVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIGQ  S
Sbjct  223  SKNADEVDGKPGPGVLYVKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIGQYVS  282

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI +CKR++IMK SDA
Sbjct  283  HGARGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINTCKRMRIMKSSDA  341

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  342  IGLAPRAMEKCRNRN  356



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SY +LSSALEKMFSCFT+GQCG 
Sbjct  194  SKNTDEVDGKPGLGPLFVKVSMDGAPYLRKVDLRTYTSYPQLSSALEKMFSCFTLGQCGL  253

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE LSE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIM GSD+
Sbjct  254  HGAQGRERLSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCRKLKIMTGSDS  313

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSK++
Sbjct  314  IGLAPRAMEKSKNK  327



>ref|XP_007150643.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
 gb|ESW22637.1| hypothetical protein PHAVU_005G169600g [Phaseolus vulgaris]
Length=334

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GKPG G L+VKVSMDGAPYLRK+DL+TY +Y ELSSALEKMFSCFTIGQC S
Sbjct  200  AKNNDEGEGKPGFGCLYVKVSMDGAPYLRKIDLKTYNNYMELSSALEKMFSCFTIGQCNS  259

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+A
Sbjct  260  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEA  319

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPR  EKS+S+N
Sbjct  320  IGLAPRTMEKSRSQN  334



>gb|ABR16139.1| unknown [Picea sitchensis]
Length=461

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K NDE DGK G  AL+VKVSMDGAPYLRKVDL+ Y  Y +LSSALEKMFSCFTIGQCGS 
Sbjct  328  KTNDEDDGKSGSSALYVKVSMDGAPYLRKVDLKLYNCYLDLSSALEKMFSCFTIGQCGSH  387

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PGR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMKGS+AI
Sbjct  388  GVPGRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAI  447

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  448  GLAPRAMEKCKNRN  461



>gb|KHN32629.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCF+IGQC S
Sbjct  173  TKNNDEAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFSIGQCNS  232

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+A
Sbjct  233  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEA  292

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  293  IGLAPRAMEKSRSQN  307



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK N+EVDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFT+ +CGS
Sbjct  227  SKNNEEVDGKVGVGALFVKVSMDGAPYLRKVDLKNYSTYPELSSALEKMFSCFTMSKCGS  286

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE L+E+KL+D LHGSEYVLTYED++GDWMLVGDVPW+MFIE+CKRL+IMK SDA
Sbjct  287  HGILGREMLNETKLKDLLHGSEYVLTYEDREGDWMLVGDVPWEMFIETCKRLRIMKSSDA  346

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EK KSR
Sbjct  347  IGLAPRAVEKCKSR  360



>gb|AFK41338.1| unknown [Medicago truncatula]
Length=190

 Score =   221 bits (564),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S
Sbjct  56   TKNNDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNS  115

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKG DA
Sbjct  116  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGFDA  175

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  176  IGLAPRAMEKSRSQN  190



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALFVKVSMDGAPYLRKVDL+ Y +Y +LSSALE MFSCFTIG CGS
Sbjct  232  SKNVEEVDGKVGPGALFVKVSMDGAPYLRKVDLKNYNAYADLSSALENMFSCFTIGSCGS  291

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G E L+E+KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF E+CKRL+IMK S+A
Sbjct  292  HGNLGGEVLNETKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTETCKRLRIMKSSEA  351

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSRN
Sbjct  352  IGLAPRAVEKSKSRN  366



>ref|NP_001240013.1| uncharacterized protein LOC100804423 [Glycine max]
 gb|ACU18729.1| unknown [Glycine max]
 gb|KHM98738.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=319

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S
Sbjct  185  TKNNDDDEGKSGFGCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFSCFTIGQCNS  244

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+A
Sbjct  245  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEA  304

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  305  IGLAPRAMEKSRSQN  319



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQ G 
Sbjct  177  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQYGL  236

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  237  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  296

Query  369  IGLAPRAKEKSKSR  328
            IGLAP A EKSK++
Sbjct  297  IGLAPGAVEKSKNK  310



>ref|XP_010254042.1| PREDICTED: auxin-responsive protein IAA27-like [Nelumbo nucifera]
Length=340

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +GK G   L+VKVSMDGAPYLRKVDL+TY SY+ELS+ALEKMFSCFTIGQCGS
Sbjct  206  AKNNDDDEGKSGSACLYVKVSMDGAPYLRKVDLKTYGSYKELSAALEKMFSCFTIGQCGS  265

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+A
Sbjct  266  HGVPGRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEA  325

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  326  IGLAPRAMEKCKNRN  340



>emb|CBI36106.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K N++ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS
Sbjct  158  AKNNEDAEGKSGLGCLYVKVSMDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGS  217

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ L+ES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+A
Sbjct  218  HGLPGRDGLTESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEA  277

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  278  IGLAPRAMEKCKNRN  292



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ GS GA
Sbjct  228  NTEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGA  287

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW MFIE+CKRL+IMK  DAIGL
Sbjct  288  PGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKSCDAIGL  347

Query  360  A  358
            A
Sbjct  348  A  348



>ref|XP_003597715.1| Auxin-responsive protein IAA [Medicago truncatula]
 gb|AES67966.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=326

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K NDE +GKP    L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFTIGQC S
Sbjct  192  TKNNDEAEGKPEFDCLYVKVSMDGAPYLRKVDLKTYNNYMELSSALEKMFTCFTIGQCNS  251

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG++ LSES LRD LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGSDA
Sbjct  252  PGLPGKDGLSESSLRDLLHGSEYVLTYEDKDGDWMLVGDVPWGMFADSCRRLRIMKGSDA  311

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKS+S+N
Sbjct  312  IGLAPRAMEKSRSQN  326



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K N++ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELSSALEKMFSCFTIGQCGS
Sbjct  209  AKNNEDAEGKSGLGCLYVKVSMDGAPYLRKVDLKIYCNYMELSSALEKMFSCFTIGQCGS  268

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ L+ES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMKGS+A
Sbjct  269  HGLPGRDGLTESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKGSEA  328

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  329  IGLAPRAMEKCKNRN  343



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 119/147 (81%), Gaps = 20/147 (14%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK ND+V        +FVKVSMDGAPYLRKVDLRT A+YQELSSALEKMFSCFTIGQCG 
Sbjct  180  SKKNDDV--------IFVKVSMDGAPYLRKVDLRTCATYQELSSALEKMFSCFTIGQCGP  231

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWD------------MFIES  406
            +GAP RE LSESKLRD LHGSEYVLTYEDKDGDWMLVGDVPWD            MFI S
Sbjct  232  EGAPSREVLSESKLRDILHGSEYVLTYEDKDGDWMLVGDVPWDIDYVTDNCCCLRMFISS  291

Query  405  CKRLKIMKGSDAIGLAPRAKEKSKSRN  325
            CKRLKIMKGSDAIGLAPRA EKSK+RN
Sbjct  292  CKRLKIMKGSDAIGLAPRALEKSKNRN  318



>ref|XP_002516003.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF46423.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=373

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K N++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSS LEKMFSCFTIGQCGS
Sbjct  239  AKNNEDAEGKSGSGCLYVKVSMDGAPYLRKVDLKTYSNYVELSSGLEKMFSCFTIGQCGS  298

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSE+ L+D LHGSEYVLTYEDKD DWMLVGDVPW+MF E+C+RL+IMKGS+A
Sbjct  299  HGLPGRDGLSETCLKDLLHGSEYVLTYEDKDSDWMLVGDVPWEMFTETCRRLRIMKGSEA  358

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK KSRN
Sbjct  359  IGLAPRAMEKCKSRN  373



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 120/138 (87%), Gaps = 4/138 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK  PGALFVKVS+DGAPYLRKVDL+ Y++YQELSSALEKMF CFTIGQ GS
Sbjct  230  SKNTEEVDGKSXPGALFVKVSLDGAPYLRKVDLKNYSAYQELSSALEKMFXCFTIGQYGS  289

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGRE +SESKL+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF ++CKRL+IMK SDA
Sbjct  290  HGAPGRE-ISESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTDTCKRLRIMKSSDA  348

Query  369  IGL---APRAKEKSKSRN  325
            IGL    PRA EK ++RN
Sbjct  349  IGLGAHTPRAMEKCRNRN  366



>ref|XP_010249636.1| PREDICTED: auxin-responsive protein IAA27 [Nelumbo nucifera]
Length=343

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            +K ND+ +GK G  G L+VKVSMDGAPYLRKVDL+TY SY ELS+ALEKMFSCFTIGQCG
Sbjct  208  AKNNDDAEGKSGSAGCLYVKVSMDGAPYLRKVDLKTYGSYTELSAALEKMFSCFTIGQCG  267

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S G PGR+ LS S+L D LHGSEYVLTYEDKDGDWMLVGDVPW MF +SC+RL+IMKGS+
Sbjct  268  SHGVPGRDGLSASRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWQMFTDSCRRLRIMKGSE  327

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EK KSRN
Sbjct  328  AIGLAPRAMEKCKSRN  343



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -3

Query  717  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  538
            +EVDGK G GALFVKVSMDGAPYLRKVDL+ Y++Y ELSSALE MFSCFTIG CGS G  
Sbjct  237  EEVDGKAGSGALFVKVSMDGAPYLRKVDLKNYSAYAELSSALENMFSCFTIGSCGSHGNL  296

Query  537  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  358
            G E L+E+KL+D LHGSEYVLTY+DKDGDWMLVGDVPW+MFIE+CKRL+IMK S+AIGLA
Sbjct  297  GGEVLNETKLKDLLHGSEYVLTYKDKDGDWMLVGDVPWEMFIETCKRLRIMKSSEAIGLA  356

Query  357  PRAKEKSKSRN  325
            PRA EKSK RN
Sbjct  357  PRAVEKSKRRN  367



>ref|XP_002303297.1| auxin-responsive protein IAA27 [Populus trichocarpa]
 gb|EEE78276.1| auxin-responsive protein IAA27 [Populus trichocarpa]
Length=349

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K N++V+GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS 
Sbjct  216  KNNEDVEGKSGYGCLYVKVSMDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSH  275

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G  G++ L+ES+L+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF  SC+RL+IMKGS+AI
Sbjct  276  GLRGQDGLTESRLKDILHGSEYVLTYEDKDGDWMLVGDVPWDMFTNSCRRLRIMKGSEAI  335

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  336  GLAPRAMEKCKNRN  349



>emb|CBI28036.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +++ +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS 
Sbjct  37   KNDEDAEGKLGSGCLYVKVSMDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSN  96

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AI
Sbjct  97   GVPIRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAI  156

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK KSRN
Sbjct  157  GLAPRAMEKCKSRN  170



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDG+P  G LFVKVSMDGAPYLRKVDL+TY SY+ELSSALEKMFSCFT+GQ   
Sbjct  220  SKNNDEVDGQPELGPLFVKVSMDGAPYLRKVDLKTYTSYKELSSALEKMFSCFTLGQYRP  279

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE LSE KL+D LH SEYVLTYEDKDGDWMLVGDVPW+MF+E+C++LKIMKGSDA
Sbjct  280  HGIPGRERLSEIKLKDLLHRSEYVLTYEDKDGDWMLVGDVPWEMFMETCRKLKIMKGSDA  339

Query  369  IGLAPRAKEKSKS  331
            IGLAPR  EKSK+
Sbjct  340  IGLAPRETEKSKN  352



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ 
Sbjct  204  KNSDEVDGKPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGTN  263

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  264  GATGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  323

Query  366  GLAPRAKEKSKSR  328
            GLAPRA EKSK R
Sbjct  324  GLAPRAMEKSKMR  336



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG G LFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG 
Sbjct  185  SKNTDEVDGKPGLGVLFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGL  244

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  245  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  304

Query  369  IGLAPRAKEKSKSR  328
            IGL    K K+K R
Sbjct  305  IGLGAVEKSKNKER  318



>gb|ABK24636.1| unknown [Picea sitchensis]
Length=390

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  D+ +GKPG  AL+VKVSMDGAPYLRKVDL+ Y  YQELSSALEKMFS FTIGQ GS
Sbjct  256  SKPADDSEGKPGSNALYVKVSMDGAPYLRKVDLKMYNRYQELSSALEKMFSGFTIGQYGS  315

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSESKL D LHGSEYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMKGSDA
Sbjct  316  HGIPGRDGLSESKLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSDA  375

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK KSR+
Sbjct  376  IGLAPRAMEKCKSRS  390



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  203  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  262

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  263  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  322

Query  366  GLAPRAKEKSKSR  328
            GLAPRA EKSK R
Sbjct  323  GLAPRAMEKSKMR  335



>ref|XP_009421456.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  D+ DGK G G L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS
Sbjct  177  SKNKDDADGKQGLGCLYVKVSMDGAPYLRKVDLKIYKNYKELSSALEKMFSCFTIGQCGS  236

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P ++ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDA
Sbjct  237  HGIPSKDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDA  296

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  297  IGLAPRAMEKCKNRN  311



>ref|XP_009380572.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=292

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++VDGK G G L+VKVSM+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQ
Sbjct  159  KYKEDVDGKLGLGCLYVKVSMEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQ  218

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAI
Sbjct  219  GIPSRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAI  278

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK KSRN
Sbjct  279  GLAPRAMEKCKSRN  292



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV+GK G GA+FVKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS
Sbjct  184  SKNVEEVEGKLGSGAMFVKVSMDGAPYLRKVDLKNYSTYAELSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE ++E+KL+D +HGSE VLTYEDKDGDWMLVGDVPW MFI++C+RL+IMK SDA
Sbjct  244  HGNMGREIMNETKLKDLIHGSENVLTYEDKDGDWMLVGDVPWKMFIDTCRRLRIMKSSDA  303

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSKSR+
Sbjct  304  IGLAPRAVEKSKSRS  318



>ref|XP_010915883.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=332

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS 
Sbjct  199  KNKEDAEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSH  258

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PGR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAI
Sbjct  259  GIPGRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAI  318

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  319  GLAPRAMEKCKNRN  332



>ref|XP_011010527.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Populus 
euphratica]
Length=349

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K N++V+GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS 
Sbjct  216  KNNEDVEGKTGYGCLYVKVSMDGAPYLRKVDLKTYSNYLELSSALEKMFSCFTIGQCGSN  275

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G  G++ L+ES+L+D LHGSEYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGS+AI
Sbjct  276  GLRGQDGLTESRLKDILHGSEYVLTYEDKDDDWMLVGDVPWDMFTDSCRRLRIMKGSEAI  335

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  336  GLAPRAMEKCKNRN  349



>ref|XP_009388718.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ D K GPG L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS
Sbjct  176  SKDKEDADEKQGPGCLYVKVSMDGAPYLRKVDLKAYNNYKELSSALEKMFSCFTIGQCGS  235

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDA
Sbjct  236  HGIPGRDGLSESRLTDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDA  295

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EK K+R
Sbjct  296  IGLAPRAMEKCKNR  309



>gb|KDO56957.1| hypothetical protein CISIN_1g019236mg [Citrus sinensis]
Length=344

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S 
Sbjct  211  KNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSH  270

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PG++ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AI
Sbjct  271  GLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAI  330

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R 
Sbjct  331  GLAPRAMEKCKNRT  344



>ref|XP_006465643.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Citrus 
sinensis]
Length=346

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S 
Sbjct  213  KNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSH  272

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PG++ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPWDMF E+C+RL+IMKGS+AI
Sbjct  273  GLPGQDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWDMFTETCRRLRIMKGSEAI  332

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R 
Sbjct  333  GLAPRAMEKCKNRT  346



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 116/132 (88%), Gaps = 7/132 (5%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPGPG LFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFT+GQCG+
Sbjct  217  SKNNDEVDGKPGPGTLFVKVSMDGAPYLRKVDLRMYSTYQELSSALEKMFSCFTLGQCGA  276

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+       RLKIMK +DA
Sbjct  277  HGTPGKEILSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWE-------RLKIMKSADA  329

Query  369  IGLAPRAKEKSK  334
            IGLAP+A +KSK
Sbjct  330  IGLAPKAMDKSK  341



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 120/135 (89%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+YA+Y ELSSALEKMF+ FT+GQCGS 
Sbjct  203  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYANYGELSSALEKMFTTFTLGQCGSN  262

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  263  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  322

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  323  GLAAAPRAMEKSKMR  337



>ref|XP_006426926.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
 gb|ESR40166.1| hypothetical protein CICLE_v10025988mg [Citrus clementina]
Length=344

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K ND  +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQC S 
Sbjct  211  KNNDAAEGKSGSGCLYVKVSMDGAPYLRKVDLKIYSNYMELSSALEKMFSCFTIGQCDSH  270

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G PG++ LSES+L D LHGSEYVLTYED+DGDWMLVGDVPWDMF E+C+RL+IMKGS+AI
Sbjct  271  GLPGQDGLSESRLMDLLHGSEYVLTYEDRDGDWMLVGDVPWDMFTETCRRLRIMKGSEAI  330

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R 
Sbjct  331  GLAPRAMEKCKNRT  344



>ref|XP_011009359.1| PREDICTED: auxin-responsive protein IAA27-like [Populus euphratica]
Length=347

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K N++VDGK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS 
Sbjct  215  KNNEDVDGKSGYGYLYVKVSMDGAPYLRKVDLKTYGNYVELSSALEKMFGCFTIGQCGSH  274

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ L+ES L+D LHGSEYVLTYEDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+AI
Sbjct  275  GLPARDGLTESCLKD-LHGSEYVLTYEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEAI  333

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  334  GLAPRAMEKCKNRN  347



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 116/134 (87%), Gaps = 5/134 (4%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDE       GALFVKVSMDGAPYLRKVDLRTY  Y+ELSSALEKMFSCFT+GQCG+
Sbjct  231  SKNNDE-----AAGALFVKVSMDGAPYLRKVDLRTYTCYKELSSALEKMFSCFTLGQCGT  285

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSE KL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI++C +LKIMKGSDA
Sbjct  286  HGIQGRERLSEIKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCCKLKIMKGSDA  345

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSK++
Sbjct  346  IGLAPRAMEKSKNK  359



>ref|XP_010463453.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Camelina 
sativa]
Length=304

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  169  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  228

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  229  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  288

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  289  GLAAAPRAVEKSKMR  303



>ref|XP_006381732.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
 gb|ERP59529.1| hypothetical protein POPTR_0006s16640g [Populus trichocarpa]
Length=307

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +D  + K G G L+VKVSMDGAPYLRKVDL+T+ SY ELSSALEKMFSCFTIGQCGS
Sbjct  173  SKNDDGAEVKSGSGCLYVKVSMDGAPYLRKVDLKTFGSYMELSSALEKMFSCFTIGQCGS  232

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               PG++ LSES+L D LHGSEYVLTYEDKD DWMLVGDVPW MF +SC+RL+IMKGS+A
Sbjct  233  HVVPGQDGLSESRLMDLLHGSEYVLTYEDKDNDWMLVGDVPWKMFTDSCRRLRIMKGSEA  292

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK KSRN
Sbjct  293  IGLAPRAMEKCKSRN  307



>ref|XP_002514266.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
 gb|EEF48220.1| Auxin-responsive protein IAA27, putative [Ricinus communis]
Length=297

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            +D+ + K G G L++KVSMDGAPYLRKVDL+TY+SY ELSS LEKMFSCFTIGQCGS G 
Sbjct  166  DDDAEAKTGSGCLYIKVSMDGAPYLRKVDLKTYSSYMELSSGLEKMFSCFTIGQCGSHGV  225

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW MF ++C+RL+IMK S+AIGL
Sbjct  226  PSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFTDTCRRLRIMKSSEAIGL  285

Query  360  APRAKEKSKSRN  325
            APRA EK K+RN
Sbjct  286  APRAMEKCKNRN  297



>gb|AEV89263.1| IAA9 [Musa acuminata AAA Group]
Length=314

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +  D K GPG L+VKVSMDGAPYLRKVDL+ Y +Y+ELS ALEKMFSCFTIGQCGS
Sbjct  176  SKDKENADEKQGPGCLYVKVSMDGAPYLRKVDLKAYNNYKELSPALEKMFSCFTIGQCGS  235

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF  SCKR++IMKGSDA
Sbjct  236  HGIPGRDGLSESRLTDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTNSCKRMRIMKGSDA  295

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EK K+R
Sbjct  296  IGLAPRAMEKCKNR  309



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDE DGKPG GALFVKVSMDGAPYLRKVDLR+ ASY+ELSSALEKMF+ FT+GQCGS
Sbjct  206  SKNNDEGDGKPGAGALFVKVSMDGAPYLRKVDLRSCASYRELSSALEKMFTTFTLGQCGS  265

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAP ++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CKRLKIMK SDA
Sbjct  266  HGAPVKDILRETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKRLKIMKSSDA  325

Query  369  IGL--APRAKEKSKSR  328
            IGL  APRA EKSK R
Sbjct  326  IGLAAAPRAMEKSKIR  341



>ref|XP_010924571.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS
Sbjct  184  SKNKEDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A
Sbjct  244  HGIPGRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEA  303

Query  369  IGLAPRAKEKSKSRN  325
             G+APRA EK KSR+
Sbjct  304  TGIAPRAMEKCKSRS  318



>ref|XP_009130522.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=193

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -3

Query  726  KVNDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            K +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+
Sbjct  59   KNSDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGA  118

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDA
Sbjct  119  NGAAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDA  178

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA EKSK R
Sbjct  179  IGLAPRAMEKSKMR  192



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDGKPG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+ 
Sbjct  204  KNSDEVDGKPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGTN  263

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  264  GATGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  323

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  324  GLAAAPRAMEKSKMR  338



>ref|XP_002284118.1| PREDICTED: auxin-responsive protein IAA27 [Vitis vinifera]
Length=320

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +++ +GK G G L+VKVSMDGAPYLRKVDL+ Y++Y ELSSALEKMFSCFTIGQCGS 
Sbjct  187  KNDEDAEGKLGSGCLYVKVSMDGAPYLRKVDLKLYSTYMELSSALEKMFSCFTIGQCGSN  246

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+AI
Sbjct  247  GVPIRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEAI  306

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK KSRN
Sbjct  307  GLAPRAMEKCKSRN  320



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  204  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  263

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  264  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  323

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  324  GLAAAPRAVEKSKMR  338



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DEVDGKPG GALFVKVSMDGAPYLRKVDLRTY SYQ+LSSALEKMFSCFT+GQCG 
Sbjct  187  SKNTDEVDGKPGLGALFVKVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGL  246

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F E+C++LKIMKGSD+
Sbjct  247  HGAQGRERMSEIKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDS  306

Query  369  IGL  361
            IGL
Sbjct  307  IGL  309



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  177  KNSDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYGNYGELSSALEKMFTTFTLGQCGSN  236

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ L E+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG+DAI
Sbjct  237  GAAGKDMLRETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGADAI  296

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  297  GLAAAPRAMEKSKMR  311



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 113/135 (84%), Gaps = 18/135 (13%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SKVNDEVDGKPGP AL+VKVSMDGAPYLRKVDLR+YA+YQELSSALEKMFSCFTIGQCG+
Sbjct  189  SKVNDEVDGKPGPSALYVKVSMDGAPYLRKVDLRSYATYQELSSALEKMFSCFTIGQCGA  248

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            Q                  G+E VLTYEDKDGDWMLVGDVPW+MFI SCKRLKIMKGSDA
Sbjct  249  Q------------------GTENVLTYEDKDGDWMLVGDVPWEMFIASCKRLKIMKGSDA  290

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK+RN
Sbjct  291  IGLAPRAVEKSKNRN  305



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  203  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  262

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  263  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  322

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  323  GLAAAPRAMEKSKMR  337



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  203  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  262

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  263  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  322

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  323  GLAAAPRAMEKSKMR  337



>ref|XP_006833393.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
 gb|ERM98671.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
Length=347

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ++E +GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQ G 
Sbjct  213  AKNSEEGEGKQGLGCLYVKVSMDGAPYLRKVDLKTYLTYTELSSALEKMFSCFTIGQYGP  272

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPGR+ L+ES+L D L+GSEYVLTYEDKDGDWMLVGDVPWDMFI SC+RL+IMKGS+A
Sbjct  273  HGAPGRDGLTESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWDMFIGSCRRLRIMKGSEA  332

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  333  IGLAPRAMEKCKARN  347



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  204  KNSDEVDGRPGAGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  263

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  264  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  323

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  324  GLAAAPRAVEKSKMR  338



>ref|XP_006451212.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 ref|XP_006475666.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Citrus 
sinensis]
 gb|ESR64452.1| hypothetical protein CICLE_v10009070mg [Citrus clementina]
 gb|KDO66456.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=292

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +D+ + K G G L+VKVSMDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTIGQC S
Sbjct  158  SKNDDDSEAKLGLGCLYVKVSMDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIGQCSS  217

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK SDA
Sbjct  218  HNVPSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSSDA  277

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  278  IGLAPRAMEKCKNRN  292



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 120/153 (78%), Gaps = 18/153 (12%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI-----  565
            SK NDEVDGK G  ALFVKVSMDGAPYLRKVDL+ Y+ YQELSSALEKMFSCFTI     
Sbjct  231  SKNNDEVDGKAGSSALFVKVSMDGAPYLRKVDLKNYSKYQELSSALEKMFSCFTIDAHSG  290

Query  564  -------------GQCGSQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPW  424
                         GQ GS GA GRE LSESKL+D LHGSE+VLTYEDKDGDWMLVGDVPW
Sbjct  291  LYGFSCCCFHLLSGQYGSHGALGREMLSESKLKDLLHGSEFVLTYEDKDGDWMLVGDVPW  350

Query  423  DMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  325
            +MFI +CKRL+IMK +DAIGLAPRA EK ++RN
Sbjct  351  EMFIGTCKRLRIMKSTDAIGLAPRAVEKCRNRN  383



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 2/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDEVDGKPG  ALFVKVSMDGAPYLRKVDL +Y SY+ELSSALEK+F+ FT+GQCGS
Sbjct  176  SKNNDEVDGKPGSAALFVKVSMDGAPYLRKVDLTSYTSYRELSSALEKLFTTFTLGQCGS  235

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAPG++ +  ++L+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI++CKRLKIMK SDA
Sbjct  236  HGAPGKDMVGRTELKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDACKRLKIMKSSDA  295

Query  369  IGL--APRAKEKSKSR  328
            IGL  APRA EKSK R
Sbjct  296  IGLAAAPRAMEKSKIR  311



>ref|XP_009617338.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=285

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            S  N+E +GK G G L+VKVSMDGAPYLRKVD++TY +Y ELSSALEKMFSCFTIGQC S
Sbjct  149  SSKNNETEGKSGAGCLYVKVSMDGAPYLRKVDVKTYTNYAELSSALEKMFSCFTIGQCTS  208

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGRE LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+A
Sbjct  209  DGLPGREGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEA  268

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRA  + K++
Sbjct  269  IGLAPRAISRCKNQ  282



>ref|XP_008789309.1| PREDICTED: auxin-responsive protein IAA27-like [Phoenix dactylifera]
Length=318

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GK G G L+VKVS+DGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIGQCGS
Sbjct  184  SKNKEDTEGKQGTGCLYVKVSLDGAPYLRKVDLKKYLNYKELSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A
Sbjct  244  HGIPGRDGLSESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEA  303

Query  369  IGLAPRAKEKSKSRN  325
            +G+APRA EK KSRN
Sbjct  304  VGIAPRAMEKCKSRN  318



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score =   216 bits (550),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  176  KNSDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  235

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  236  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGPDAI  295

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  296  GLAAAPRAMEKSKMR  310



>ref|XP_010917562.1| PREDICTED: auxin-responsive protein IAA27-like [Elaeis guineensis]
Length=318

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS
Sbjct  184  SKNKEDTEGKQGTGCLYVKVSMDGAPYLRKVDLKTYLNYKELSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               PGR+ LSES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IM+GS+A
Sbjct  244  HEIPGRDGLSESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDSCRRLRIMRGSEA  303

Query  369  IGLAPRAKEKSKSRN  325
            +G+APRA EK KSRN
Sbjct  304  VGIAPRAMEKCKSRN  318



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  206  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  265

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  266  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  325

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  326  GLAAAPRAVEKSKMR  340



>gb|KDP37265.1| hypothetical protein JCGZ_06321 [Jatropha curcas]
Length=342

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K  ++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQCGS
Sbjct  209  AKNTEDAEGKSGFGCLYVKVSMDGAPYLRKVDLKTYSNYVELSSALEKMFSCFTIGQCGS  268

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSE+ L+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A
Sbjct  269  -GFPGRDGLSETCLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSEA  327

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  328  IGLAPRAMEKCKNRN  342



>ref|XP_008793078.1| PREDICTED: auxin-responsive protein IAA27-like isoform X2 [Phoenix 
dactylifera]
Length=318

 Score =   216 bits (550),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS
Sbjct  184  SKNKEDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A
Sbjct  244  HGIPSRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEA  303

Query  369  IGLAPRAKEKSKSRN  325
            IG+APR  EK KSR+
Sbjct  304  IGIAPRVMEKCKSRS  318



>ref|XP_007013107.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY30726.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=313

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +D+ + K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS 
Sbjct  180  KNDDDAEAKLGSGCLYVKVSMDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSH  239

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AI
Sbjct  240  GVPSRDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAI  299

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R 
Sbjct  300  GLAPRAMEKCKNRT  313



>ref|XP_007013106.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30725.1| Phytochrome-associated protein 2 isoform 1 [Theobroma cacao]
Length=312

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +D+ + K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCGS 
Sbjct  179  KNDDDAEAKLGSGCLYVKVSMDGAPYLRKVDLKFYGSYKELSSALEKMFSCFTIGQCGSH  238

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AI
Sbjct  239  GVPSRDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAI  298

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R 
Sbjct  299  GLAPRAMEKCKNRT  312



>ref|XP_008462174.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis melo]
Length=356

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGP-GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            +K  DE +GK GP G L+VKVSM+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG
Sbjct  221  TKNTDEGEGKSGPSGCLYVKVSMEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCG  280

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            ++G P +E LSES  +DFLHGSEYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+
Sbjct  281  TEGHPTKERLSESNSKDFLHGSEYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSE  340

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EK K+RN
Sbjct  341  AIGLAPRATEKCKNRN  356



>ref|XP_009381047.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GK G G L+VKVSMDGAPYLRKVDL+TY++Y+E S ALEKMFS FTIGQCGS
Sbjct  175  SKNKEDANGKQGLGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSLALEKMFSGFTIGQCGS  234

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PGR+ LSES+L DFL GSEYVLTYED+DGDWMLVGDVPW+MF +SC+RL+IMKGSDA
Sbjct  235  HGIPGRDGLSESRLMDFLSGSEYVLTYEDRDGDWMLVGDVPWEMFTDSCRRLRIMKGSDA  294

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  295  IGLAPRAMEKCRNRN  309



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 7/120 (6%)
 Frame = -3

Query  684  LFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLR  505
            LFVKVSMDGAPYLRKVDLR YA+YQELSS LEKMFSCFT+GQCGS       N+SE+KLR
Sbjct  227  LFVKVSMDGAPYLRKVDLRAYATYQELSSGLEKMFSCFTLGQCGS-------NMSETKLR  279

Query  504  DFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  325
            D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRLKIMKGSDAIGLAPRA EKSKSRN
Sbjct  280  DLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLKIMKGSDAIGLAPRAMEKSKSRN  339



>ref|XP_008462746.1| PREDICTED: auxin-responsive protein IAA27 [Cucumis melo]
Length=307

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  D+ DGK G G L+VKVSMDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG CGS 
Sbjct  174  KNTDDADGKLGSGCLYVKVSMDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHCGSN  233

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AI
Sbjct  234  GVPNRDALNESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAI  293

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  294  GLAPRAMEKCKNRN  307



>ref|XP_002298231.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
 gb|EEE83036.1| hypothetical protein POPTR_0001s18680g [Populus trichocarpa]
Length=335

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K N++VDGK G G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF CFTIGQCGS
Sbjct  202  AKNNEDVDGKSGYGYLYVKVSMDGAPYLRKVDLKTYGNYLELSSALEKMFGCFTIGQCGS  261

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G   R+ L+ES L+D LHGSEYVLT+EDKDGDWMLVGDVPWDMF +SC+RL+IMKGS+A
Sbjct  262  HGLAARDGLTESCLKD-LHGSEYVLTFEDKDGDWMLVGDVPWDMFTDSCRRLRIMKGSEA  320

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  321  IGLAPRAMEKCKNRN  335



>ref|XP_009612337.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=315

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++VDGK G   ++VKVSMDGAPYLRKVDL+ Y SY +LSSALEKMFSCFTIGQCG++
Sbjct  183  KTEEDVDGKLGSACVYVKVSMDGAPYLRKVDLKIYKSYNDLSSALEKMFSCFTIGQCGTE  242

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF  SCKRLKIMK SDAI
Sbjct  243  GIPIRDGLTESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTGSCKRLKIMKSSDAI  302

Query  366  GLAPRAKEKSKSR  328
            GLAPRA EK K+R
Sbjct  303  GLAPRAMEKYKNR  315



>ref|XP_008783241.1| PREDICTED: auxin-responsive protein IAA17-like isoform X1 [Phoenix 
dactylifera]
Length=326

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  720  NDEV-DGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  544
            N EV +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSALEKMFSCFTIGQCGS G
Sbjct  194  NKEVAEGKHGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALEKMFSCFTIGQCGSHG  253

Query  543  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  364
             PGR+ LSES+L D L+GSE+VLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAIG
Sbjct  254  IPGRDGLSESRLMDLLNGSEFVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIG  313

Query  363  LAPRAKEKSKSRN  325
            LAP A EK K+R+
Sbjct  314  LAPTAMEKCKNRS  326



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK GPGALFVKVSMDGAPYLRKVDLR Y++YQELSSALEKMFSCFTIGQ G+
Sbjct  228  SKKTEEVDGKAGPGALFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGA  287

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE LSESKL+D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ++CKRL+IMK SDA
Sbjct  288  HGPLGREMLSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRLRIMKSSDA  347

Query  369  IGL  361
            IGL
Sbjct  348  IGL  350



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDGKPG  ALFVKVSMDGAPYLRKVDLR+Y  Y ELSSALEKMF+ FT+GQCGS 
Sbjct  177  KNSDEVDGKPGSAALFVKVSMDGAPYLRKVDLRSYGKYGELSSALEKMFTTFTLGQCGSN  236

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ L E+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG+DAI
Sbjct  237  GAAGKDMLRETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGADAI  296

Query  366  GL--APRAKEKSKSR  328
            GL  APR  EKSK R
Sbjct  297  GLTSAPRGMEKSKMR  311



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG G LFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  208  KNSDEVDGRPGSGVLFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  267

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  268  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  327

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  328  GLAAAPRAVEKSKMR  342



>emb|CDP03299.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +++ D K G G L+VKVSMDGAPYLRKVD++ Y+SY++LSSALEKMFSCFTIGQCGS 
Sbjct  204  KTDEDADAKLGTGCLYVKVSMDGAPYLRKVDIKIYSSYKDLSSALEKMFSCFTIGQCGSH  263

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G   R+ +SES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF++SCKRL+IMK SDAI
Sbjct  264  GVHIRDGMSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFMDSCKRLRIMKSSDAI  323

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  324  GLAPRAMEKCKNRN  337



>ref|XP_008802939.1| PREDICTED: auxin-responsive protein IAA17-like [Phoenix dactylifera]
Length=320

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++V+GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS 
Sbjct  187  KNKEDVEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSH  246

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAI
Sbjct  247  GIPCRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAI  306

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R+
Sbjct  307  GLAPRAMEKCKNRD  320



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = -3

Query  729  SKVNDEVDGKPGP--GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQC  556
            SK N+EVD K G   GA+FVKVSMDGAPYLRKVDL+ Y +Y +LSSALEKMFSCFTIGQC
Sbjct  225  SKNNEEVDEKMGSAGGAVFVKVSMDGAPYLRKVDLKNYTAYSQLSSALEKMFSCFTIGQC  284

Query  555  GSQGAPGRENL-SESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKG  379
             S G  GRE + +E+KLRD LHGSEYV+TYEDKDGDWMLVGDVPW MFI++CKRL+IMK 
Sbjct  285  ESHGNLGREMMMNETKLRDLLHGSEYVITYEDKDGDWMLVGDVPWVMFIDTCKRLRIMKS  344

Query  378  SDAIGLAPRAKEKSKSRN  325
            SDAIGLAPRA EK+KSRN
Sbjct  345  SDAIGLAPRAVEKNKSRN  362



>ref|XP_009793769.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=298

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N+E +GK G G L+VKVSMDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIGQC S G 
Sbjct  165  NNETEGKSGAGCLYVKVSMDGAPYLRKVDVKIYTNYAELSSALEKMFSCFTIGQCTSDGL  224

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
            PGRE LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+AIGL
Sbjct  225  PGREGLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEAIGL  284

Query  360  APRAKEKSKSR  328
            APRA  K K++
Sbjct  285  APRAISKCKNQ  295



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 118/136 (87%), Gaps = 4/136 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPG-ALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            SK  +EVDGK G G A+FVKVSMDGAPYLRKVDL+ Y +Y ELSS+LEKMFSCFTIGQC 
Sbjct  215  SKNTEEVDGKLGSGGAVFVKVSMDGAPYLRKVDLKNYTAYSELSSSLEKMFSCFTIGQCE  274

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S G    + L+E+KLRD LHGSEYV+TYEDKDGDWMLVGDVPW+MFI++C+RL+IMK SD
Sbjct  275  SHG---NQMLNETKLRDLLHGSEYVITYEDKDGDWMLVGDVPWEMFIDTCRRLRIMKSSD  331

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EKSKSRN
Sbjct  332  AIGLAPRAVEKSKSRN  347



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score =   212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 4/135 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV    G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG 
Sbjct  136  SKNTNEV----GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGL  191

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+
Sbjct  192  HGAHGRERMSEVKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDS  251

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  252  IGLAPSAVEKSKNKD  266



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 115/135 (85%), Gaps = 4/135 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV    G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG 
Sbjct  136  SKNTNEV----GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGL  191

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMKGSD+
Sbjct  192  HGAHGRERMSEVKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKGSDS  251

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  252  IGLAPSAVEKSKNKD  266



>ref|XP_010521483.1| PREDICTED: auxin-responsive protein IAA27-like isoform X3 [Tarenaya 
hassleriana]
Length=239

 Score =   211 bits (536),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS
Sbjct  105  SKNGDEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGS  164

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
                G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDA
Sbjct  165  HETSGKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDA  224

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  225  IGLAPRAMEKCRSRN  239



>ref|XP_009130521.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=195

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = -3

Query  726  KVNDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            K +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELS ALEKMF+ FT+GQCG+
Sbjct  59   KNSDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSLALEKMFTTFTLGQCGA  118

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDA
Sbjct  119  NGAAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDA  178

Query  369  IGL--APRAKEKSKSR  328
            IGL  APRA EKSK R
Sbjct  179  IGLAAAPRAMEKSKMR  194



>ref|XP_010925905.1| PREDICTED: auxin-responsive protein IAA17-like [Elaeis guineensis]
Length=323

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++ +GK G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS 
Sbjct  190  KNKEDAEGKQGFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSH  249

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDAI
Sbjct  250  GIPCRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAI  309

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+R+
Sbjct  310  GLAPRAMEKCKNRD  323



>ref|XP_002864971.1| hypothetical protein ARALYDRAFT_358770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41230.1| hypothetical protein ARALYDRAFT_358770 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PGPGA+FVKVSMDGAP LRKVDLR+YA+Y ELSSALEKMF+  T+GQCGS 
Sbjct  273  KNSDEVDGRPGPGAMFVKVSMDGAPCLRKVDLRSYANYGELSSALEKMFTTLTLGQCGSN  332

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+DFL+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK LKIMKG DAI
Sbjct  333  GAAGKDMLSETKLKDFLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKMLKIMKGCDAI  392

Query  366  GL--APRAKEKSKSR  328
            GL  APRA EKSK R
Sbjct  393  GLAAAPRAMEKSKMR  407



>ref|XP_004141756.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 ref|XP_004158995.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 gb|KGN45391.1| hypothetical protein Csa_7G447060 [Cucumis sativus]
Length=356

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 117/136 (86%), Gaps = 1/136 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGP-GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            +K  DE +GK G  G L+VKVSM+GAPYLRKVDL+ Y++Y ELS ALEKMFSCFTIGQCG
Sbjct  221  TKNTDEGEGKSGSSGCLYVKVSMEGAPYLRKVDLKLYSNYSELSLALEKMFSCFTIGQCG  280

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            ++G P +E LSES  +DFLHGSEYVLT EDKDGDWMLVGDVPW+MF ESC+RL+IMKGS+
Sbjct  281  TEGLPTKERLSESNSKDFLHGSEYVLTCEDKDGDWMLVGDVPWEMFTESCRRLRIMKGSE  340

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EK K+RN
Sbjct  341  AIGLAPRATEKCKNRN  356



>ref|XP_006475665.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Citrus 
sinensis]
 gb|KDO66455.1| hypothetical protein CISIN_1g022618mg [Citrus sinensis]
Length=294

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTI--GQC  556
            SK +D+ + K G G L+VKVSMDGAPYLRKVDL+TY+SY +LSSALEKMFSCFTI  GQC
Sbjct  158  SKNDDDSEAKLGLGCLYVKVSMDGAPYLRKVDLKTYSSYIDLSSALEKMFSCFTIVSGQC  217

Query  555  GSQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGS  376
             S   P R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMK S
Sbjct  218  SSHNVPSRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKSS  277

Query  375  DAIGLAPRAKEKSKSRN  325
            DAIGLAPRA EK K+RN
Sbjct  278  DAIGLAPRAMEKCKNRN  294



>emb|CDY37837.1| BnaAnng04980D [Brassica napus]
Length=296

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = -3

Query  726  KVNDEVDGKPG-PGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            K +DEVDGKPG   ALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCG+
Sbjct  160  KNSDEVDGKPGSAAALFVKVSMDGAPYLRKVDLRSYTNYMELSSALEKMFTTFTLGQCGA  219

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA G++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKGSDA
Sbjct  220  NGAAGKDKLCETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGSDA  279

Query  369  IGL--APRAKEKSKSR  328
            IGL  APRA EKSK R
Sbjct  280  IGLAAAPRAMEKSKMR  295



>ref|XP_009771095.1| PREDICTED: auxin-responsive protein IAA8-like, partial [Nicotiana 
sylvestris]
Length=277

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++VDG  G   ++VKVSMD APYLRKVDLR Y SY +LS ALEKMFSCFTIGQCG++
Sbjct  145  KTEEDVDGTLGSACVYVKVSMDDAPYLRKVDLRIYKSYNDLSLALEKMFSCFTIGQCGTE  204

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK SDAI
Sbjct  205  GIPIRDGLTESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSDAI  264

Query  366  GLAPRAKEKSKSR  328
            GLAPRA EK K+R
Sbjct  265  GLAPRAMEKYKNR  277



>ref|XP_009390697.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  D+ DGK G G L+VKVSMDGAPYLRKVDL+ Y +Y+ELSSALEKMFSCFTIG CGS
Sbjct  178  SKSKDDADGKQGLGCLYVKVSMDGAPYLRKVDLKMYDNYKELSSALEKMFSCFTIGPCGS  237

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P  + LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGSDA
Sbjct  238  HGIPNSDGLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDTCRRLRIMKGSDA  297

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+ N
Sbjct  298  IGLAPRAMEKCKNWN  312



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 114/135 (84%), Gaps = 4/135 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EV    G G LFVKVSMDGAPYLRKVDLRTY  YQ LSSALEKMFSCFT+GQCG 
Sbjct  141  SKNTNEV----GLGPLFVKVSMDGAPYLRKVDLRTYTCYQHLSSALEKMFSCFTLGQCGL  196

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA GRE +SE KL+D LHGSE+VLTYEDKDGDWMLVGDVPW++F ESC++LKIMK SD+
Sbjct  197  HGAHGRERMSEVKLKDLLHGSEFVLTYEDKDGDWMLVGDVPWEIFTESCRKLKIMKSSDS  256

Query  369  IGLAPRAKEKSKSRN  325
            IGLAP A EKSK+++
Sbjct  257  IGLAPSAVEKSKNKD  271



>ref|XP_009416499.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  D+  GK G   L+VKVSMDGAPYLRKVDL+TY++Y+ELS ALEKMF+CFTIGQCGS
Sbjct  140  SKNKDDAKGKQGLECLYVKVSMDGAPYLRKVDLKTYSNYKELSLALEKMFTCFTIGQCGS  199

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  GRE L+E ++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGSDA
Sbjct  200  YGMTGREILTEGRVMDLLLGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDA  259

Query  369  IGLAPRAKEKSKSRN  325
            IG+APRA EKSKSRN
Sbjct  260  IGIAPRAMEKSKSRN  274



>ref|XP_009786555.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=269

 Score =   209 bits (533),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND  +GK G G L+VKV MDGAPYLRKVD++TY+ Y ELSSALEKMFSCF+IGQC S
Sbjct  136  TKKND-AEGKSGSGCLYVKVRMDGAPYLRKVDIKTYSDYGELSSALEKMFSCFSIGQCAS  194

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G PG+E LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+A
Sbjct  195  DGLPGQEELSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEA  254

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA  K K++N
Sbjct  255  IGLAPRAIHKCKNKN  269



>ref|XP_004150556.1| PREDICTED: auxin-responsive protein IAA27-like [Cucumis sativus]
 gb|KGN65095.1| hypothetical protein Csa_1G207820 [Cucumis sativus]
Length=306

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  D+ DGK G G L+VKVSMDGAPYLRKVDL+TY SY +LSSALEKMFS FTIG  GS 
Sbjct  173  KNTDDADGKLGSGCLYVKVSMDGAPYLRKVDLKTYVSYVDLSSALEKMFSSFTIGHYGSN  232

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G P R+ L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESC R++IMK S+AI
Sbjct  233  GVPNRDALNESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCTRMRIMKSSEAI  292

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK K+RN
Sbjct  293  GLAPRAMEKCKNRN  306



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS
Sbjct  218  SKNGDEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGS  277

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
                G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDA
Sbjct  278  HETSGKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDA  337

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  338  IGLAPRAMEKCRSRN  352



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  DE +GK G GAL+VKVSMDGAPYLRK DL+ Y  YQELSS LEKMFSCFTIGQ GS
Sbjct  218  SKNGDEPEGKSGAGALYVKVSMDGAPYLRKTDLKNYGKYQELSSGLEKMFSCFTIGQFGS  277

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
                G+  ++E  L+D LHGSEYVLTYEDKDGDWMLVGDVPW MFI++CKRL+IMK SDA
Sbjct  278  HETSGKGAINEGNLKDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDTCKRLRIMKSSDA  337

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK +SRN
Sbjct  338  IGLAPRAMEKCRSRN  352



>ref|XP_008228477.1| PREDICTED: auxin-responsive protein IAA27-like [Prunus mume]
Length=343

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +GK   G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCFTIGQC S
Sbjct  209  AKNNDDAEGKQESGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFTIGQCSS  268

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ LS S+L D LHGSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+A
Sbjct  269  NGIPERDGLSASRLMDLLHGSEFVLTYEDKDDDWMLVGDVPWKMFTETCRRLRIMKGSEA  328

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  329  IGLAPRAVEKCKNRN  343



>ref|XP_011072390.1| PREDICTED: auxin-responsive protein IAA27 [Sesamum indicum]
Length=327

 Score =   210 bits (535),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N EV GK G G L+VKVSM+GAPYLRK+DL+TY  Y ELSSALEKMFSCFTIGQ G QG 
Sbjct  197  NSEVAGKSGSGCLYVKVSMEGAPYLRKIDLKTYRCYAELSSALEKMFSCFTIGQYG-QGL  255

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
             G+E LSES L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMKGSDAIGL
Sbjct  256  AGQERLSESHLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAIGL  315

Query  360  APRAKEKSKSRN  325
            APR  +K KS+N
Sbjct  316  APRTMQKCKSQN  327



>ref|XP_009352507.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=318

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +DE +GK G G L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIG CGS
Sbjct  185  SKNDDEAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLELSLALEKMFSCFTIGHCGS  244

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA  R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A
Sbjct  245  HGA-SRDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEA  303

Query  369  IGLAPRAKEKSKSRN  325
            +GLAPRA +K K+ N
Sbjct  304  MGLAPRAMQKCKNSN  318



>gb|KHG03466.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=310

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  720  NDEVDG----KPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            ND+ DG    K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCG
Sbjct  175  NDDGDGNAEAKLGSGCLYVKVSMDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCG  234

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S G  G + LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++
Sbjct  235  SHGVSGGDGLSESRLIDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTE  294

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EK K+R 
Sbjct  295  AIGLAPRAMEKCKNRT  310



>ref|NP_001280937.1| auxin-responsive protein IAA27 [Malus domestica]
 gb|ADL36581.1| ARF domain class transcription factor [Malus domestica]
Length=319

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  D+ +GK G G L+VKVSMDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS
Sbjct  186  SKNGDDAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGS  245

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA  R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A
Sbjct  246  HGAS-RDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEA  304

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA +K K+ N
Sbjct  305  IGLAPRAMQKCKNSN  319



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK + EVDGK G G  FVKVSMDGAPYLRKVD++ Y +Y ELSSALEKMFSCFTIG C S
Sbjct  231  SKNSGEVDGKAGIGVCFVKVSMDGAPYLRKVDIKAYMTYHELSSALEKMFSCFTIGHCTS  290

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
                GRE LS +KL+D +HGSEYVLTY+DKDGDWMLVGDVPW+MF++SC+RL+IMK SDA
Sbjct  291  HMTTGREMLSINKLKDLVHGSEYVLTYKDKDGDWMLVGDVPWEMFVDSCRRLRIMKSSDA  350

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++R+
Sbjct  351  IGLAPRAVEKCRNRS  365



>gb|AEQ94167.1| auxin induced family protein [Elaeis guineensis]
Length=124

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -3

Query  696  GPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSE  517
            G G L+VKVSMDGAPYLRKVDL+TY +Y+ELSSAL KMFSCFTIGQCGS G P R+ L E
Sbjct  1    GFGCLYVKVSMDGAPYLRKVDLKTYNNYKELSSALGKMFSCFTIGQCGSHGIPCRDGLFE  60

Query  516  SKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKS  337
            S+L D L+GSEYVLTYEDKDGDWML GDVPW+MF +SC+RL+IMKGSDAIGLAPRA EK 
Sbjct  61   SRLMDLLNGSEYVLTYEDKDGDWMLFGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAMEKC  120

Query  336  KSRN  325
            K+R+
Sbjct  121  KNRD  124



>ref|XP_009409066.1| PREDICTED: auxin-responsive protein IAA17-like [Musa acuminata 
subsp. malaccensis]
Length=322

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ DGK G G L+VKVSMDGAPYLRKVDL+TY +Y E S ALEKMFS FTIGQCGS
Sbjct  188  SKNKEDADGKQGLGCLYVKVSMDGAPYLRKVDLKTYNNYNEFSVALEKMFSGFTIGQCGS  247

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               P R+ LSES+L D L GSEYVLT EDKDGDWMLVGDVPW+MFI+SC+RL+IMKGSDA
Sbjct  248  HAIPSRDGLSESRLMDLLSGSEYVLTCEDKDGDWMLVGDVPWEMFIDSCRRLRIMKGSDA  307

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  308  IGLAPRAMEKCKNRN  322



>ref|XP_009336858.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=319

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +D+ +GK G G L+VKVSMDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCGS
Sbjct  186  SKNDDDAEGKMGAGCLYVKVSMDGAPYLRKVDLKTYGSYLDLSLALEKMFSCFTIGQCGS  245

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GA  R+ LSES+L D LHG+EYVLTYEDKDGDWMLVGDVPW+MF +SCKR++IMK S+A
Sbjct  246  HGA-SRDGLSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRMRIMKSSEA  304

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA +K K+ N
Sbjct  305  IGLAPRAMQKCKNGN  319



>ref|XP_008793077.1| PREDICTED: auxin-responsive protein IAA27-like isoform X1 [Phoenix 
dactylifera]
Length=322

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 4/139 (3%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GKPG G L+VKVSMDGAPYLRKVDL+TY++Y+E SSALEKMFSCFTIGQCGS
Sbjct  184  SKNKEDTEGKPGTGCLYVKVSMDGAPYLRKVDLKTYSNYKEFSSALEKMFSCFTIGQCGS  243

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ L ES++ D L GSEYVLTYEDKDGDWMLVGDVPW+MF ++C+RL+IMKGS+A
Sbjct  244  HGIPSRDGLGESRMMDLLQGSEYVLTYEDKDGDWMLVGDVPWNMFTDTCRRLRIMKGSEA  303

Query  369  IGL----APRAKEKSKSRN  325
            IG+    +PR  EK KSR+
Sbjct  304  IGIGTCKSPRVMEKCKSRS  322



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            S+ ND  D +   G L+VKVSMDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS
Sbjct  120  SQKNDNDDVEAKSGCLYVKVSMDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGS  179

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+ N+ ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK S+A
Sbjct  180  HGVFGQGNVCESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSSEA  239

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK KSRN
Sbjct  240  IGLAPRAMEKCKSRN  254



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            S+ ND  D +   G L+VKVSMDGAPYLRKVDL+ + +Y+ELSSALEKMFSCFTI Q GS
Sbjct  120  SQKNDNDDVEAKSGCLYVKVSMDGAPYLRKVDLKIFGTYKELSSALEKMFSCFTISQFGS  179

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G  G+ N+ ES+L DFLHGSEYVLTYEDKDGDWMLVGDVPW MFI+SCKRL+IMK  +A
Sbjct  180  HGVFGQGNVCESRLMDFLHGSEYVLTYEDKDGDWMLVGDVPWKMFIDSCKRLRIMKSFEA  239

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK KSRN
Sbjct  240  IGLAPRAMEKCKSRN  254



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +D+ + K G   L+VKVSMDGAPYLRKVDL+ + +Y ELSSALEKMF+CFTI QCGS 
Sbjct  176  KKDDDAEAKSG--GLYVKVSMDGAPYLRKVDLKIFGTYMELSSALEKMFTCFTISQCGSH  233

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G  GR+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK S+AI
Sbjct  234  GVSGRDKLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSSEAI  293

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA EK KSRN
Sbjct  294  GLAPRAMEKCKSRN  307



>ref|XP_009406220.1| PREDICTED: auxin-responsive protein IAA21-like [Musa acuminata 
subsp. malaccensis]
Length=279

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  ++ +GK G   L++KVSMDGAPYLRKVDL+TYA+Y+ELS AL KMF+CFTIGQCG+
Sbjct  145  SKNKEDAEGKQGVDCLYIKVSMDGAPYLRKVDLKTYANYKELSLALAKMFTCFTIGQCGA  204

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G   RE L+E ++ D L GSEYVLTYEDKD DWMLVGDVPWDMF +SC+RL+IMKGSDA
Sbjct  205  HGMSSRETLTEGRVMDLLQGSEYVLTYEDKDSDWMLVGDVPWDMFTDSCRRLRIMKGSDA  264

Query  369  IGLAPRAKEKSKSRN  325
            IG+APRA EKSKS+N
Sbjct  265  IGIAPRAMEKSKSQN  279



>gb|ABI36495.1| AUX/IAA27 A [Malus domestica]
Length=115

 Score =   201 bits (512),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -3

Query  672  VSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESKLRDFLH  493
            VSMDGAPYL+KVDL+ Y++YQELSSALEKMF CFT+GQ GS GAPGRE +SESKL+D LH
Sbjct  1    VSMDGAPYLKKVDLKNYSAYQELSSALEKMFRCFTLGQYGSHGAPGRE-ISESKLKDLLH  59

Query  492  GSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKSRN  325
            GSEYVLTYEDKDGDWMLVGDVPWDMFI++CKR++IMK SDAIGLAPRA EK ++RN
Sbjct  60   GSEYVLTYEDKDGDWMLVGDVPWDMFIDTCKRMRIMKSSDAIGLAPRAMEKCRNRN  115



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 117/135 (87%), Gaps = 6/135 (4%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK  +EVDGK G GALF+KVSMDGAPYLRKVDL+ Y++YQELSSALEKMFSCFTIG    
Sbjct  231  SKNAEEVDGKLGSGALFIKVSMDGAPYLRKVDLKHYSAYQELSSALEKMFSCFTIG----  286

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
              A GRE LSESKL+D L G+EYVLTYEDKDGDWMLVGDVPW+MF+++CKRL+IMK  DA
Sbjct  287  --ALGREMLSESKLKDLLDGAEYVLTYEDKDGDWMLVGDVPWEMFLDTCKRLRIMKSCDA  344

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EKSK++N
Sbjct  345  IGLAPRAVEKSKNKN  359



>ref|XP_007160318.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
 gb|ESW32312.1| hypothetical protein PHAVU_002G311500g [Phaseolus vulgaris]
Length=291

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG-  544
            ND+ + +     L+VKVSM+GAPYLRKVDL ++ +Y+ELS ALEKMFSCFTI QCGS G 
Sbjct  159  NDDAEAEAKSECLYVKVSMEGAPYLRKVDLNSFGTYKELSLALEKMFSCFTISQCGSYGV  218

Query  543  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  364
            + GRENLSES+L D LHGSEYVLTYED+DGDWMLVGDVPW+MF ESCKRL+IMK S+AIG
Sbjct  219  SSGRENLSESRLMDLLHGSEYVLTYEDRDGDWMLVGDVPWEMFTESCKRLRIMKSSEAIG  278

Query  363  LAPRAKEKSKSRN  325
            LAPRA EK KSRN
Sbjct  279  LAPRAVEKCKSRN  291



>ref|XP_009380571.1| PREDICTED: auxin-responsive protein IAA21-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 118/159 (74%), Gaps = 25/159 (16%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K  ++VDGK G G L+VKVSM+GAPYLRKVDL+TY  Y+ELSSALEKMFSCFTIGQC SQ
Sbjct  159  KYKEDVDGKLGLGCLYVKVSMEGAPYLRKVDLKTYKDYRELSSALEKMFSCFTIGQCNSQ  218

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIM------  385
            G P R+ LSES+L D L+GSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IM      
Sbjct  219  GIPSRDGLSESRLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKGSDAI  278

Query  384  -------------------KGSDAIGLAPRAKEKSKSRN  325
                               KGSDAIGLAPRA EK KSRN
Sbjct  279  GLGKFRQTEILNNLQSELLKGSDAIGLAPRAMEKCKSRN  317



>gb|KJB54240.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
 gb|KJB54245.1| hypothetical protein B456_009G026700 [Gossypium raimondii]
Length=310

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = -3

Query  720  NDEVDG----KPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCG  553
            ND+ DG    K G G L+VKVSMDGAPYLRKVDL+ Y SY+ELSSALEKMFSCFTIGQCG
Sbjct  175  NDDGDGNAEAKLGSGCLYVKVSMDGAPYLRKVDLKIYGSYKELSSALEKMFSCFTIGQCG  234

Query  552  SQGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSD  373
            S G    + L+ES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SCKRL+IMK ++
Sbjct  235  SHGVSSGDGLTESRLVDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCKRLRIMKSTE  294

Query  372  AIGLAPRAKEKSKSRN  325
            AIGLAPRA EK K+R 
Sbjct  295  AIGLAPRAMEKCKNRT  310



>ref|XP_004302884.1| PREDICTED: auxin-responsive protein IAA27-like [Fragaria vesca 
subsp. vesca]
Length=338

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +GK G G L+VKVSMDGAPYLRKVDL+ Y +Y ELS ALEKMFSCF IGQC S
Sbjct  204  AKNNDDAEGKQGSGCLYVKVSMDGAPYLRKVDLKMYNNYMELSMALEKMFSCFIIGQCSS  263

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P ++ LSES+L D LHGSEYVLT+EDKD DWMLVGDVPW MF E+C++L+IMKGS+A
Sbjct  264  NGFPKKDGLSESRLMDLLHGSEYVLTFEDKDDDWMLVGDVPWGMFTETCRKLRIMKGSEA  323

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK ++RN
Sbjct  324  IGLAPRAMEKCRNRN  338



>gb|KHN41649.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=287

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  723  VNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQG  544
            + ++ D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G
Sbjct  155  LKNDTDAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYG  214

Query  543  APGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIG  364
               RENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIG
Sbjct  215  VSSRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIG  274

Query  363  LAPRAKEKSKSRN  325
            LAPRA EK KSRN
Sbjct  275  LAPRAMEKCKSRN  287



>ref|XP_007024229.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
 gb|EOY26851.1| Phytochrome-associated protein 2 isoform 2 [Theobroma cacao]
Length=339

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  690  GALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAPGRENLSESK  511
            G L+VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMFSCFTIGQC S G P R+ L+ES+
Sbjct  218  GCLYVKVSMDGAPYLRKVDLKTYKNYTELSSALEKMFSCFTIGQCSSHGLPVRDGLTESR  277

Query  510  LRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLAPRAKEKSKS  331
            L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF +SC+RL+IMKGS+AIGLAPRA EK K+
Sbjct  278  LMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSEAIGLAPRAMEKCKN  337

Query  330  RN  325
            + 
Sbjct  338  QT  339



>ref|NP_001239808.1| uncharacterized protein LOC100778529 [Glycine max]
 gb|ACU23444.1| unknown [Glycine max]
Length=287

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  717  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  538
            ++ D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS G  
Sbjct  157  NDTDAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVS  216

Query  537  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  358
             RENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK  +AIGLA
Sbjct  217  SRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSFEAIGLA  276

Query  357  PRAKEKSKSRN  325
            PRA EK KSRN
Sbjct  277  PRAMEKCKSRN  287



>ref|XP_008242568.1| PREDICTED: auxin-responsive protein IAA27 [Prunus mume]
Length=319

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +D+ +GK GPG L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIGQCGS 
Sbjct  187  KNDDDAEGKMGPGCLYVKVSMDGAPYLRKVDLKTYGSYVELSLALEKMFSCFTIGQCGSH  246

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G   R+ LSES+L D L+G+EYVLTYEDKDGDWMLVGDVPW+MF ++CKR++IMK S+AI
Sbjct  247  GVS-RDGLSESRLMDLLNGAEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRMRIMKSSEAI  305

Query  366  GLAPRAKEKSKSRN  325
            GLAPRA +K K  N
Sbjct  306  GLAPRAVQKCKKSN  319



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK NDE DGKPG GALFVKVSMDGAPYLRKVDLR+ ASY+ELSSALEKMF+ FT+GQCGS
Sbjct  206  SKNNDEGDGKPGAGALFVKVSMDGAPYLRKVDLRSCASYRELSSALEKMFTTFTLGQCGS  265

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             GAP ++ L E+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CKRLKIMK SDA
Sbjct  266  HGAPVKDILRETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKRLKIMKSSDA  325

Query  369  IGL  361
            IGL
Sbjct  326  IGL  328



>ref|XP_008348504.1| PREDICTED: auxin-responsive protein IAA21-like isoform X1 [Malus 
domestica]
Length=322

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+  GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCF IGQC S
Sbjct  188  AKNNDDAAGKQGSGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFNIGQCSS  247

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ LS S+L D L+GSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+A
Sbjct  248  NGLPERDGLSASRLMDLLNGSEFVLTYEDKDDDWMLVGDVPWQMFTETCRRLRIMKGSEA  307

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA  K K+RN
Sbjct  308  IGLAPRAAGKCKNRN  322



>ref|XP_006343091.1| PREDICTED: auxin-responsive protein IAA27-like [Solanum tuberosum]
Length=278

 Score =   204 bits (520),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND  +GK G   L+VKVSMDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S
Sbjct  145  TKKNDG-EGKTGSSCLYVKVSMDGAPYLRKVDIKTYSNYAELSSALEKMFSCFSIGQCAS  203

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               PG+E LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+A
Sbjct  204  DRLPGQEKLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEA  263

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA  K K++N
Sbjct  264  IGLAPRAINKCKNQN  278



>ref|XP_008348505.1| PREDICTED: auxin-responsive protein IAA21-like isoform X2 [Malus 
domestica]
Length=321

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+  GK G G L+VKVSMDGAPYLRKVDL+TY +Y ELS ALEKMFSCF IGQC S
Sbjct  187  AKNNDDAAGKQGSGCLYVKVSMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFNIGQCSS  246

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ LS S+L D L+GSE+VLTYEDKD DWMLVGDVPW MF E+C+RL+IMKGS+A
Sbjct  247  NGLPERDGLSASRLMDLLNGSEFVLTYEDKDDDWMLVGDVPWQMFTETCRRLRIMKGSEA  306

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA  K K+RN
Sbjct  307  IGLAPRAAGKCKNRN  321



>ref|XP_006584591.1| PREDICTED: uncharacterized protein LOC100804782 isoform X1 [Glycine 
max]
 gb|KHN05349.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=305

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ++E + K G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQC S
Sbjct  171  AKCDNEAEEKSGVGCLYVKVSMDGAPYLRKVDLKTYSNYIELSSALEKMFSCFTIGQCNS  230

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +  PG++ LSES  RD + GSEYVLTYEDK+GDWMLVGDVPW MF ESCK+L+IMKGS+A
Sbjct  231  RALPGKDGLSESAFRDLVDGSEYVLTYEDKEGDWMLVGDVPWKMFTESCKKLRIMKGSEA  290

Query  369  IGLAPRAKEKSKSR  328
            IGLAPR  EK +S+
Sbjct  291  IGLAPRGMEKFRSQ  304



>ref|XP_009377833.1| PREDICTED: auxin-responsive protein IAA21-like [Pyrus x bretschneideri]
 ref|XP_009346094.1| PREDICTED: auxin-responsive protein IAA21-like [Pyrus x bretschneideri]
Length=331

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +GK G G L+VKV MDGAPYLRKVDL+TY +Y ELS ALEKMFSCFTIGQC  
Sbjct  197  AKNNDDAEGKQGSGCLYVKVGMDGAPYLRKVDLKTYNNYTELSMALEKMFSCFTIGQCSC  256

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G P R+ LS S+L D L+GSE+VLTYED+D DWMLVGDVPW MF E+C+RL+IMKGS+A
Sbjct  257  NGLPERDGLSASRLMDLLNGSEFVLTYEDRDDDWMLVGDVPWQMFTETCRRLRIMKGSEA  316

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA EK K+RN
Sbjct  317  IGLAPRAVEKCKNRN  331



>gb|KHN16618.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=283

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +   D +   G L+VKVSM+GAPYLRKVDL ++ +Y++LS ALEKMFSCFT+ QCGS 
Sbjct  150  KNDAAADAEAKSGCLYVKVSMEGAPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSY  209

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            G   RENLSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MF ESCKRL+IMK S+AI
Sbjct  210  GVSSRENLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFTESCKRLRIMKSSEAI  269

Query  366  GLAPRAKEKSKSR  328
            GLAPRA EK KSR
Sbjct  270  GLAPRAMEKCKSR  282



>ref|XP_004287443.1| PREDICTED: auxin-responsive protein IAA27 [Fragaria vesca subsp. 
vesca]
Length=303

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            SK +D+ +GK G G L++KVSMDGAPYLRKVDL+TY SY +LS ALEKMFSCFTIGQCG 
Sbjct  169  SKKDDDAEGKMGAGCLYIKVSMDGAPYLRKVDLKTYGSYVDLSLALEKMFSCFTIGQCGP  228

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
             G   ++ +SES+L D LHG+EYVLTYEDKDGDWMLVGDVPW MF +SC+R++IMK S+A
Sbjct  229  HGVSSQDGMSESRLMDLLHGAEYVLTYEDKDGDWMLVGDVPWQMFTDSCRRMRIMKSSEA  288

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA +K K+ N
Sbjct  289  IGLAPRAMQKCKNSN  303



>ref|XP_007203891.1| hypothetical protein PRUPE_ppa009134mg [Prunus persica]
 gb|EMJ05090.1| hypothetical protein PRUPE_ppa009134mg [Prunus persica]
Length=305

 Score =   205 bits (521),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            +D+ +GK GPG L+VKVSMDGAPYLRKVDL+TY SY ELS ALEKMFSCFTIGQCGS G 
Sbjct  175  DDDAEGKMGPGCLYVKVSMDGAPYLRKVDLKTYGSYVELSLALEKMFSCFTIGQCGSHGV  234

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
              R+ LSES+L D L+G+EYVLTYEDKDGDWMLVGDVPW+MF ++CKR++IMK S+AIGL
Sbjct  235  -SRDGLSESRLMDLLNGAEYVLTYEDKDGDWMLVGDVPWEMFTDTCKRMRIMKSSEAIGL  293

Query  360  APRAKEKSKSRN  325
            APRA +K K  N
Sbjct  294  APRAMQKCKKSN  305



>gb|KHG27397.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=237

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -3

Query  720  NDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGA  541
            N E +G+   G  +VKVSMDGAPYLRKVDL+TY +Y ELSSALEKMF+CFT+G C S G 
Sbjct  106  NSEKNGEDAAGCHYVKVSMDGAPYLRKVDLKTYKTYMELSSALEKMFTCFTLGHCSSNGL  165

Query  540  PGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGL  361
              R+ LSES+L D LHGSEYVLTYEDKDGDWMLVGDVPW+MFI SCKRL+I+KGS+AIGL
Sbjct  166  AVRDGLSESRLMDLLHGSEYVLTYEDKDGDWMLVGDVPWEMFINSCKRLRIVKGSEAIGL  225

Query  360  APRAKEKSKSRN  325
            APRA EK K+++
Sbjct  226  APRAMEKCKNQS  237



>ref|NP_001266034.1| IAA6 protein [Solanum lycopersicum]
 gb|AEX00366.1| IAA27 [Solanum lycopersicum]
Length=278

 Score =   204 bits (519),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND+ +G+ G   L+VKVSMDGAPYLRKVD++TY++Y  LSSALEKMFSCF+IGQC S
Sbjct  145  TKKNDD-EGRTGSSCLYVKVSMDGAPYLRKVDIKTYSNYAALSSALEKMFSCFSIGQCAS  203

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               PG+E LSES L D L+GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+A
Sbjct  204  DKIPGQEKLSESHLMDLLNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEA  263

Query  369  IGLAPRAKEKSKSRN  325
            IGLAPRA  K K++N
Sbjct  264  IGLAPRAINKCKNQN  278



>ref|XP_003530133.1| PREDICTED: auxin-responsive protein IAA27-like [Glycine max]
 gb|KHN04226.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=319

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K N+E + KPG   L+VKVSMDGAPYLRKVDL+TY++Y ELSS LEKMFSCFTIGQC S
Sbjct  185  AKCNNETEEKPGVACLYVKVSMDGAPYLRKVDLKTYSNYIELSSGLEKMFSCFTIGQCNS  244

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +  PG++ LSES  RD + GSEYVLTY DK+GDWMLVGDVPW+MF ESC +L+IMKGS+A
Sbjct  245  RALPGKDGLSESAFRDIVDGSEYVLTYVDKEGDWMLVGDVPWEMFTESCNKLRIMKGSEA  304

Query  369  IGLAPRAKEKSKSR  328
            IGLAPR  EK +S+
Sbjct  305  IGLAPRGMEKCRSQ  318



>ref|NP_001241183.1| uncharacterized protein LOC100804782 [Glycine max]
 gb|ACU20310.1| unknown [Glycine max]
Length=322

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ++E + K G G L+VKVSMDGAPYLRKVDL+TY++Y ELSSALEKMFSCFTIGQC S
Sbjct  188  AKCDNEAEEKSGVGCLYVKVSMDGAPYLRKVDLKTYSNYIELSSALEKMFSCFTIGQCNS  247

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
            +  PG++ LSES  RD + GSEYVLTYEDK+GDWMLVGDVPW MF ESCK+L+IMKGS+A
Sbjct  248  RALPGKDGLSESAFRDLVDGSEYVLTYEDKEGDWMLVGDVPWKMFTESCKKLRIMKGSEA  307

Query  369  IGLAPRAKEKSKSR  328
            IGLAPR  EK +S+
Sbjct  308  IGLAPRGMEKFRSQ  321



>ref|XP_010098105.1| Auxin-responsive protein IAA27 [Morus notabilis]
 gb|EXB74542.1| Auxin-responsive protein IAA27 [Morus notabilis]
Length=344

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  717  DEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQGAP  538
            +E   K G G L+VKVSMDGAPYLRKVDL+T  +Y+ELS ALEKMFSCFTIGQCG+ G P
Sbjct  214  EETQDKSGSGCLYVKVSMDGAPYLRKVDLKTCTNYRELSLALEKMFSCFTIGQCGASGLP  273

Query  537  GRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAIGLA  358
             R+ L+ES+L D LHGSEYV+TYEDKD DWMLVGDVPWDMF ++C+RL+IMKGS+AIGLA
Sbjct  274  ERKGLTESRLMDLLHGSEYVVTYEDKDEDWMLVGDVPWDMFTDTCRRLRIMKGSEAIGLA  333

Query  357  PRAKEKSKSRN  325
            PRA EK K++N
Sbjct  334  PRAMEKCKNQN  344



>ref|XP_009614298.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=269

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 114/134 (85%), Gaps = 1/134 (1%)
 Frame = -3

Query  729  SKVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGS  550
            +K ND  +GK G   L+VKV MDGAPYLRKVD++TY++Y ELSSALEKMFSCF+IGQC S
Sbjct  136  TKKND-AEGKSGSSCLYVKVRMDGAPYLRKVDIKTYSNYGELSSALEKMFSCFSIGQCTS  194

Query  549  QGAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDA  370
               PG+E LSES L D ++GSEYVLTYEDKDGDWMLVGDVPW+MFI+SCKRL+IMK S+A
Sbjct  195  DRLPGQEELSESHLMDLVNGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKSSEA  254

Query  369  IGLAPRAKEKSKSR  328
            IGLAPRAK K K++
Sbjct  255  IGLAPRAKNKCKNQ  268



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  726  KVNDEVDGKPGPGALFVKVSMDGAPYLRKVDLRTYASYQELSSALEKMFSCFTIGQCGSQ  547
            K +DEVDG+PG GALFVKVSMDGAPYLRKVDLR+Y +Y ELSSALEKMF+ FT+GQCGS 
Sbjct  203  KNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSN  262

Query  546  GAPGRENLSESKLRDFLHGSEYVLTYEDKDGDWMLVGDVPWDMFIESCKRLKIMKGSDAI  367
            GA G++ LSE+KL+D L+G +YVLTYEDKDGDWMLVGDVPW+MFI+ CK+LKIMKG DAI
Sbjct  263  GAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAI  322

Query  366  GL  361
            GL
Sbjct  323  GL  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470