BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF002C24

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006348585.1|  PREDICTED: protein MIZU-KUSSEI 1-like              197   4e-66   Solanum tuberosum [potatoes]
ref|XP_004238977.1|  PREDICTED: protein MIZU-KUSSEI 1                   197   5e-66   Solanum lycopersicum
emb|CDP00556.1|  unnamed protein product                                191   1e-64   Coffea canephora [robusta coffee]
ref|XP_009595333.1|  PREDICTED: protein MIZU-KUSSEI 1                   191   3e-64   Nicotiana tomentosiformis
ref|XP_009789140.1|  PREDICTED: protein MIZU-KUSSEI 1                   190   6e-64   Nicotiana sylvestris
ref|XP_011077413.1|  PREDICTED: protein MIZU-KUSSEI 1-like              189   3e-63   Sesamum indicum [beniseed]
ref|XP_008243149.1|  PREDICTED: protein MIZU-KUSSEI 1                   187   2e-62   Prunus mume [ume]
ref|XP_007226866.1|  hypothetical protein PRUPE_ppa017045mg             187   2e-62   Prunus persica
ref|XP_011070851.1|  PREDICTED: protein MIZU-KUSSEI 1-like              187   2e-62   Sesamum indicum [beniseed]
ref|XP_004297152.1|  PREDICTED: protein MIZU-KUSSEI 1                   184   7e-61   Fragaria vesca subsp. vesca
ref|XP_003518017.1|  PREDICTED: protein MIZU-KUSSEI 1-like              181   1e-60   Glycine max [soybeans]
ref|XP_006437758.1|  hypothetical protein CICLE_v10032404mg             187   1e-60   Citrus clementina [clementine]
ref|XP_007153317.1|  hypothetical protein PHAVU_003G025000g             182   5e-60   Phaseolus vulgaris [French bean]
ref|XP_007046347.1|  Uncharacterized protein TCM_011889                 180   7e-60   
gb|KJB50810.1|  hypothetical protein B456_008G187800                    178   1e-59   Gossypium raimondii
ref|XP_007138351.1|  hypothetical protein PHAVU_009G201400g             180   2e-59   Phaseolus vulgaris [French bean]
emb|CAN74875.1|  hypothetical protein VITISV_038922                     177   5e-59   Vitis vinifera
ref|XP_003631229.1|  PREDICTED: protein MIZU-KUSSEI 1                   177   5e-59   Vitis vinifera
ref|XP_010262483.1|  PREDICTED: protein MIZU-KUSSEI 1-like              174   5e-59   Nelumbo nucifera [Indian lotus]
emb|CDO98489.1|  unnamed protein product                                173   2e-58   Coffea canephora [robusta coffee]
ref|XP_002315967.1|  hypothetical protein POPTR_0010s14150g             174   4e-58   Populus trichocarpa [western balsam poplar]
gb|KDP20067.1|  hypothetical protein JCGZ_05836                         174   5e-58   Jatropha curcas
gb|EPS63970.1|  hypothetical protein M569_10812                         174   7e-58   Genlisea aurea
ref|XP_002524384.1|  conserved hypothetical protein                     173   1e-57   
ref|XP_009336646.1|  PREDICTED: protein MIZU-KUSSEI 1-like              172   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008389331.1|  PREDICTED: protein MIZU-KUSSEI 1-like              172   2e-57   
gb|KEH38015.1|  DUF617 family protein                                   172   3e-57   Medicago truncatula
ref|XP_006582045.1|  PREDICTED: protein MIZU-KUSSEI 1-like              172   3e-57   Glycine max [soybeans]
ref|XP_002311427.2|  hypothetical protein POPTR_0008s11360g             172   3e-57   
ref|XP_010681395.1|  PREDICTED: protein MIZU-KUSSEI 1                   170   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011021376.1|  PREDICTED: protein MIZU-KUSSEI 1-like              171   4e-57   Populus euphratica
ref|XP_002511997.1|  conserved hypothetical protein                     172   4e-57   Ricinus communis
ref|XP_004508591.1|  PREDICTED: uncharacterized protein LOC101512123    173   6e-57   Cicer arietinum [garbanzo]
ref|XP_004488352.1|  PREDICTED: uncharacterized protein LOC101507963    171   6e-57   Cicer arietinum [garbanzo]
ref|XP_008339717.1|  PREDICTED: protein MIZU-KUSSEI 1                   170   8e-57   
ref|XP_002272298.2|  PREDICTED: protein MIZU-KUSSEI 1                   169   9e-57   Vitis vinifera
ref|XP_009356069.1|  PREDICTED: protein MIZU-KUSSEI 1                   170   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_010096715.1|  hypothetical protein L484_025833                   180   1e-56   
ref|XP_006602419.1|  PREDICTED: protein MIZU-KUSSEI 1-like              171   1e-56   Glycine max [soybeans]
emb|CBI15396.3|  unnamed protein product                                169   1e-56   Vitis vinifera
gb|KHN15653.1|  hypothetical protein glysoja_045736                     170   2e-56   Glycine soja [wild soybean]
gb|KJB51115.1|  hypothetical protein B456_008G201700                    169   3e-56   Gossypium raimondii
ref|XP_007037756.1|  Dr1                                                169   3e-56   Theobroma cacao [chocolate]
ref|XP_003549815.1|  PREDICTED: protein MIZU-KUSSEI 1-like              170   3e-56   Glycine max [soybeans]
gb|KDP29344.1|  hypothetical protein JCGZ_18265                         169   5e-56   Jatropha curcas
ref|XP_003518832.1|  PREDICTED: protein MIZU-KUSSEI 1-like              166   5e-56   Glycine max [soybeans]
ref|XP_003524508.1|  PREDICTED: protein MIZU-KUSSEI 1-like              169   1e-55   Glycine max [soybeans]
ref|XP_003609136.1|  hypothetical protein MTR_4g112370                  168   1e-55   
ref|XP_010110773.1|  hypothetical protein L484_022271                   167   2e-55   
ref|XP_006440890.1|  hypothetical protein CICLE_v10021702mg             167   2e-55   Citrus clementina [clementine]
ref|XP_011008958.1|  PREDICTED: protein MIZU-KUSSEI 1                   166   2e-55   Populus euphratica
ref|XP_011008762.1|  PREDICTED: protein MIZU-KUSSEI 1                   173   2e-55   Populus euphratica
ref|XP_006374348.1|  hypothetical protein POPTR_0015s06300g             165   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008800890.1|  PREDICTED: protein MIZU-KUSSEI 1-like              167   3e-55   
gb|AES91333.2|  DUF617 family protein                                   168   3e-55   Medicago truncatula
ref|XP_007155168.1|  hypothetical protein PHAVU_003G179200g             167   4e-55   Phaseolus vulgaris [French bean]
gb|ACJ84318.1|  unknown                                                 166   1e-54   Medicago truncatula
ref|XP_008801965.1|  PREDICTED: protein MIZU-KUSSEI 1                   165   1e-54   Phoenix dactylifera
ref|XP_004138221.1|  PREDICTED: uncharacterized protein LOC101214386    162   1e-54   
ref|XP_009617994.1|  PREDICTED: protein MIZU-KUSSEI 1                   162   2e-54   Nicotiana tomentosiformis
ref|XP_004135413.1|  PREDICTED: uncharacterized protein LOC101215336    165   2e-54   Cucumis sativus [cucumbers]
ref|XP_004168743.1|  PREDICTED: uncharacterized LOC101215336            165   2e-54   
ref|XP_010924207.1|  PREDICTED: protein MIZU-KUSSEI 1-like              166   2e-54   
ref|XP_009764631.1|  PREDICTED: protein MIZU-KUSSEI 1                   161   3e-54   Nicotiana sylvestris
ref|XP_008453350.1|  PREDICTED: protein MIZU-KUSSEI 1                   162   4e-54   Cucumis melo [Oriental melon]
ref|XP_008244055.1|  PREDICTED: protein MIZU-KUSSEI 1-like              161   4e-54   Prunus mume [ume]
ref|XP_004236101.1|  PREDICTED: protein MIZU-KUSSEI 1                   160   4e-54   
ref|XP_002317922.1|  hypothetical protein POPTR_0012s05480g             161   4e-54   Populus trichocarpa [western balsam poplar]
ref|XP_007209453.1|  hypothetical protein PRUPE_ppa009748mg             161   4e-54   Prunus persica
ref|XP_006494262.1|  PREDICTED: protein MIZU-KUSSEI 1-like isofor...    162   6e-54   
ref|XP_010925133.1|  PREDICTED: protein MIZU-KUSSEI 1-like              163   6e-54   Elaeis guineensis
ref|XP_006345062.1|  PREDICTED: protein MIZU-KUSSEI 1-like              159   7e-54   Solanum tuberosum [potatoes]
ref|XP_009782370.1|  PREDICTED: protein MIZU-KUSSEI 1-like              162   1e-53   Nicotiana sylvestris
ref|XP_009346641.1|  PREDICTED: protein MIZU-KUSSEI 1-like              160   1e-53   Pyrus x bretschneideri [bai li]
ref|XP_008367570.1|  PREDICTED: LOW QUALITY PROTEIN: protein MIZU...    159   1e-53   
ref|XP_008374708.1|  PREDICTED: protein MIZU-KUSSEI 1                   160   2e-53   Malus domestica [apple tree]
ref|XP_008446535.1|  PREDICTED: protein MIZU-KUSSEI 1                   160   2e-53   Cucumis melo [Oriental melon]
ref|XP_004299248.1|  PREDICTED: protein MIZU-KUSSEI 1                   158   2e-53   Fragaria vesca subsp. vesca
gb|KEH37940.1|  plant-specific domain TIGR01570 family protein          164   4e-53   Medicago truncatula
ref|XP_009392909.1|  PREDICTED: protein MIZU-KUSSEI 1-like              158   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936793.1|  PREDICTED: protein MIZU-KUSSEI 1-like              161   8e-53   Elaeis guineensis
ref|XP_009610371.1|  PREDICTED: protein MIZU-KUSSEI 1-like              160   8e-53   Nicotiana tomentosiformis
gb|KJB39902.1|  hypothetical protein B456_007G041200                    157   1e-52   Gossypium raimondii
ref|XP_004241620.2|  PREDICTED: protein MIZU-KUSSEI 1-like              160   1e-52   Solanum lycopersicum
ref|XP_010265326.1|  PREDICTED: protein MIZU-KUSSEI 1                   152   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009792099.1|  PREDICTED: protein MIZU-KUSSEI 1-like              156   2e-52   Nicotiana sylvestris
ref|XP_004137460.1|  PREDICTED: uncharacterized protein LOC101209919    155   3e-52   Cucumis sativus [cucumbers]
ref|XP_006354738.1|  PREDICTED: protein MIZU-KUSSEI 1-like              159   3e-52   Solanum tuberosum [potatoes]
ref|XP_009416767.1|  PREDICTED: protein MIZU-KUSSEI 1-like              159   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008455509.1|  PREDICTED: protein MIZU-KUSSEI 1-like              155   4e-52   
emb|CDX87184.1|  BnaC09g04990D                                          155   4e-52   
gb|EPS74122.1|  hypothetical protein M569_00633                         154   5e-52   Genlisea aurea
ref|XP_010554247.1|  PREDICTED: protein MIZU-KUSSEI 1                   160   7e-52   Tarenaya hassleriana [spider flower]
ref|XP_009337564.1|  PREDICTED: protein MIZU-KUSSEI 1                   153   8e-52   
gb|EYU28944.1|  hypothetical protein MIMGU_mgv1a023336mg                179   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_009390202.1|  PREDICTED: protein MIZU-KUSSEI 1-like              154   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY48081.1|  BnaA06g33470D                                          160   2e-51   Brassica napus [oilseed rape]
ref|XP_009597987.1|  PREDICTED: protein MIZU-KUSSEI 1-like              153   3e-51   Nicotiana tomentosiformis
ref|XP_009412425.1|  PREDICTED: protein MIZU-KUSSEI 1-like              157   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16840.1|  BnaA09g05420D                                          154   4e-51   Brassica napus [oilseed rape]
dbj|BAB03084.1|  unnamed protein product                                156   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111953.1|  PREDICTED: protein MIZU-KUSSEI 1-like              153   6e-51   Brassica rapa
ref|XP_009152125.1|  PREDICTED: protein MIZU-KUSSEI 1                   159   7e-51   Brassica rapa
ref|XP_010514181.1|  PREDICTED: protein MIZU-KUSSEI 1-like isofor...    157   9e-51   
ref|XP_004488528.1|  PREDICTED: uncharacterized protein LOC101498450    152   1e-50   Cicer arietinum [garbanzo]
ref|XP_002875266.1|  hypothetical protein ARALYDRAFT_904728             156   1e-50   
ref|NP_189192.1|  uncharacterized protein                               155   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425215.1|  PREDICTED: protein MIZU-KUSSEI 1-like              156   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010502442.1|  PREDICTED: protein MIZU-KUSSEI 1-like              155   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002458221.1|  hypothetical protein SORBIDRAFT_03g029300          155   3e-50   Sorghum bicolor [broomcorn]
gb|EYU22616.1|  hypothetical protein MIMGU_mgv1a011113mg                161   3e-50   Erythranthe guttata [common monkey flower]
emb|CDY65924.1|  BnaCnng49120D                                          159   8e-50   Brassica napus [oilseed rape]
ref|XP_009395091.1|  PREDICTED: protein MIZU-KUSSEI 1-like              151   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395638.1|  hypothetical protein EUTSA_v10004775mg             150   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_004953646.1|  PREDICTED: uncharacterized protein LOC101766682    145   1e-49   Setaria italica
ref|XP_010547720.1|  PREDICTED: protein MIZU-KUSSEI 1-like              152   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_008799422.1|  PREDICTED: protein MIZU-KUSSEI 1-like              151   1e-49   
ref|XP_002454406.1|  hypothetical protein SORBIDRAFT_04g030260          144   3e-49   Sorghum bicolor [broomcorn]
ref|XP_009129038.1|  PREDICTED: protein MIZU-KUSSEI 1-like              150   4e-49   Brassica rapa
ref|XP_002872035.1|  hypothetical protein ARALYDRAFT_910318             146   5e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_006394578.1|  hypothetical protein EUTSA_v10004740mg             146   5e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010695769.1|  PREDICTED: protein MIZU-KUSSEI 1                   143   6e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK27633.1|  hypothetical protein AALP_AA8G408600                    146   7e-49   Arabis alpina [alpine rockcress]
ref|XP_006290275.1|  hypothetical protein CARUB_v10017795mg             150   8e-49   
emb|CDX99760.1|  BnaC02g35600D                                          150   8e-49   
ref|XP_008675294.1|  PREDICTED: protein MIZU-KUSSEI 1-like              149   9e-49   Zea mays [maize]
ref|XP_010454591.1|  PREDICTED: protein MIZU-KUSSEI 1-like              146   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009136391.1|  PREDICTED: protein MIZU-KUSSEI 1                   145   1e-48   Brassica rapa
dbj|BAK00452.1|  predicted protein                                      141   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001151133.1|  LOC100284766                                       142   1e-48   Zea mays [maize]
ref|NP_197701.1|  uncharacterized protein                               145   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393601.1|  PREDICTED: protein MIZU-KUSSEI 1-like              146   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010522225.1|  PREDICTED: protein MIZU-KUSSEI 1-like              145   2e-48   Tarenaya hassleriana [spider flower]
gb|KFK35071.1|  hypothetical protein AALP_AA5G231600                    150   2e-48   Arabis alpina [alpine rockcress]
ref|XP_002436989.1|  hypothetical protein SORBIDRAFT_10g013960          142   2e-48   
ref|XP_004969290.1|  PREDICTED: uncharacterized protein LOC101782167    148   2e-48   Setaria italica
dbj|BAD07762.1|  unknown protein                                        141   2e-48   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ95925.1|  predicted protein                                      157   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ24353.1|  hypothetical protein OsJ_08106                          141   3e-48   Oryza sativa Japonica Group [Japonica rice]
emb|CDM83526.1|  unnamed protein product                                154   3e-48   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001056405.2|  Os05g0577100                                       157   4e-48   
ref|XP_009390951.1|  PREDICTED: protein MIZU-KUSSEI 1-like              144   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006288391.1|  hypothetical protein CARUB_v10001643mg             144   7e-48   Capsella rubella
ref|XP_003567838.1|  PREDICTED: protein MIZU-KUSSEI 1-like              157   7e-48   Brachypodium distachyon [annual false brome]
ref|XP_008659519.1|  PREDICTED: protein MIZU-KUSSEI 1                   142   8e-48   
ref|XP_010493423.1|  PREDICTED: protein MIZU-KUSSEI 1-like              143   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004961132.1|  PREDICTED: uncharacterized protein LOC101773620    154   1e-47   Setaria italica
ref|XP_003569437.1|  PREDICTED: protein MIZU-KUSSEI 1-like              153   1e-47   Brachypodium distachyon [annual false brome]
dbj|BAJ99442.1|  predicted protein                                      155   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002533439.1|  conserved hypothetical protein                     139   2e-47   Ricinus communis
ref|XP_002441565.1|  hypothetical protein SORBIDRAFT_09g029410          154   2e-47   Sorghum bicolor [broomcorn]
emb|CDY02205.1|  BnaA03g39620D                                          140   2e-47   
ref|XP_010044306.1|  PREDICTED: protein MIZU-KUSSEI 1                   144   3e-47   Eucalyptus grandis [rose gum]
gb|AFW86551.1|  hypothetical protein ZEAMMB73_410633                    141   3e-47   
ref|XP_006350176.1|  PREDICTED: protein MIZU-KUSSEI 1-like              135   4e-47   Solanum tuberosum [potatoes]
ref|XP_004236600.1|  PREDICTED: protein MIZU-KUSSEI 1-like              135   4e-47   Solanum lycopersicum
gb|EEE64799.1|  hypothetical protein OsJ_19655                          154   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008650054.1|  PREDICTED: protein MIZU-KUSSEI 1-like              153   6e-47   Zea mays [maize]
ref|XP_006849759.1|  hypothetical protein AMTR_s00024p00251250          139   1e-46   Amborella trichopoda
ref|XP_010672869.1|  PREDICTED: protein MIZU-KUSSEI 1                   136   1e-46   
ref|XP_004965367.1|  PREDICTED: uncharacterized protein LOC101760957    137   1e-46   
ref|XP_010424246.1|  PREDICTED: protein MIZU-KUSSEI 1-like              139   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010037336.1|  PREDICTED: protein MIZU-KUSSEI 1                   140   1e-46   Eucalyptus grandis [rose gum]
ref|XP_010279509.1|  PREDICTED: protein MIZU-KUSSEI 1-like              133   3e-46   Nelumbo nucifera [Indian lotus]
emb|CDP14124.1|  unnamed protein product                                134   3e-46   Coffea canephora [robusta coffee]
dbj|BAD46510.1|  unknown protein                                        137   3e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563885.1|  PREDICTED: protein MIZU-KUSSEI 1-like              138   3e-46   Brachypodium distachyon [annual false brome]
ref|NP_001151601.1|  plant-specific domain TIGR01570 family protein     140   6e-46   Zea mays [maize]
ref|NP_001149649.1|  plant-specific domain TIGR01570 family protein     142   7e-46   
ref|XP_003570211.1|  PREDICTED: protein MIZU-KUSSEI 1-like              134   8e-46   Brachypodium distachyon [annual false brome]
gb|AFW86550.1|  hypothetical protein ZEAMMB73_410633                    136   9e-46   
ref|XP_009599704.1|  PREDICTED: protein MIZU-KUSSEI 1-like              130   1e-45   Nicotiana tomentosiformis
ref|XP_010456653.1|  PREDICTED: protein MIZU-KUSSEI 1-like              135   3e-45   Camelina sativa [gold-of-pleasure]
emb|CDY66471.1|  BnaC07g49860D                                          134   3e-45   Brassica napus [oilseed rape]
ref|XP_009758656.1|  PREDICTED: protein MIZU-KUSSEI 1-like              129   3e-45   Nicotiana sylvestris
ref|XP_011078478.1|  PREDICTED: protein MIZU-KUSSEI 1-like              162   4e-45   
ref|XP_007204835.1|  hypothetical protein PRUPE_ppa027006mg             134   4e-45   Prunus persica
gb|KDO45924.1|  hypothetical protein CISIN_1g039343mg                   134   4e-45   Citrus sinensis [apfelsine]
ref|XP_011075338.1|  PREDICTED: protein MIZU-KUSSEI 1-like              132   7e-45   Sesamum indicum [beniseed]
ref|XP_007028679.1|  Acetoin:2,6-dichlorophenolindophenol oxidore...    130   9e-45   Theobroma cacao [chocolate]
ref|XP_006492939.1|  PREDICTED: protein MIZU-KUSSEI 1-like              132   1e-44   Citrus sinensis [apfelsine]
ref|XP_008387312.1|  PREDICTED: protein MIZU-KUSSEI 1                   132   1e-44   
ref|XP_002966034.1|  hypothetical protein SELMODRAFT_167931             130   1e-44   
ref|XP_006421312.1|  hypothetical protein CICLE_v10006416mg             132   1e-44   Citrus clementina [clementine]
ref|XP_010108210.1|  hypothetical protein L484_003407                   126   3e-44   Morus notabilis
ref|XP_004513863.1|  PREDICTED: uncharacterized protein LOC101513022    127   5e-44   Cicer arietinum [garbanzo]
ref|XP_008392242.1|  PREDICTED: protein MIZU-KUSSEI 1-like              133   5e-44   
gb|KHN10435.1|  hypothetical protein glysoja_030871                     129   5e-44   Glycine soja [wild soybean]
ref|XP_011078992.1|  PREDICTED: protein MIZU-KUSSEI 1-like              130   6e-44   Sesamum indicum [beniseed]
emb|CBI29820.3|  unnamed protein product                                129   6e-44   Vitis vinifera
ref|XP_010056931.1|  PREDICTED: LOW QUALITY PROTEIN: protein MIZU...    127   6e-44   
ref|XP_009363198.1|  PREDICTED: protein MIZU-KUSSEI 1-like              130   8e-44   Pyrus x bretschneideri [bai li]
dbj|BAB90468.1|  hypothetical protein                                   143   8e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284235.1|  PREDICTED: protein MIZU-KUSSEI 1                   129   8e-44   Vitis vinifera
ref|NP_001043690.1|  Os01g0642600                                       143   8e-44   
gb|KJB19243.1|  hypothetical protein B456_003G090900                    128   9e-44   Gossypium raimondii
ref|XP_009339447.1|  PREDICTED: protein MIZU-KUSSEI 1-like              129   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010517659.1|  PREDICTED: protein MIZU-KUSSEI 1-like              131   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003535869.1|  PREDICTED: protein MIZU-KUSSEI 1-like              127   2e-43   Glycine max [soybeans]
ref|XP_008467200.1|  PREDICTED: protein MIZU-KUSSEI 1-like              132   2e-43   Cucumis melo [Oriental melon]
gb|EYU18721.1|  hypothetical protein MIMGU_mgv1a020836mg                127   2e-43   Erythranthe guttata [common monkey flower]
ref|XP_010269747.1|  PREDICTED: protein MIZU-KUSSEI 1-like              124   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010508693.1|  PREDICTED: protein MIZU-KUSSEI 1                   130   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006294692.1|  hypothetical protein CARUB_v10023729mg             130   3e-43   Capsella rubella
ref|XP_003518131.1|  PREDICTED: protein MIZU-KUSSEI 1-like              126   3e-43   Glycine max [soybeans]
ref|XP_009133503.1|  PREDICTED: protein MIZU-KUSSEI 1-like              129   5e-43   Brassica rapa
ref|XP_008244250.1|  PREDICTED: protein MIZU-KUSSEI 1                   127   5e-43   Prunus mume [ume]
ref|XP_002879946.1|  predicted protein                                  127   6e-43   
ref|XP_007145593.1|  hypothetical protein PHAVU_007G251700g             125   6e-43   Phaseolus vulgaris [French bean]
ref|XP_006411429.1|  hypothetical protein EUTSA_v10016988mg             128   7e-43   Eutrema salsugineum [saltwater cress]
emb|CDY35406.1|  BnaA03g19540D                                          129   7e-43   Brassica napus [oilseed rape]
ref|XP_009142002.1|  PREDICTED: protein MIZU-KUSSEI 1-like              128   8e-43   Brassica rapa
emb|CDY06912.1|  BnaA04g24030D                                          127   9e-43   
gb|KGN51547.1|  hypothetical protein Csa_5G577380                       130   9e-43   Cucumis sativus [cucumbers]
ref|XP_004147139.1|  PREDICTED: uncharacterized protein LOC101223057    129   1e-42   
emb|CDY14782.1|  BnaC04g47790D                                          127   2e-42   Brassica napus [oilseed rape]
emb|CDX79925.1|  BnaA05g02310D                                          126   3e-42   
ref|XP_009142763.1|  PREDICTED: protein MIZU-KUSSEI 1-like              126   3e-42   Brassica rapa
ref|XP_008457962.1|  PREDICTED: protein MIZU-KUSSEI 1-like              135   3e-42   Cucumis melo [Oriental melon]
emb|CDY23837.1|  BnaC04g02000D                                          126   3e-42   Brassica napus [oilseed rape]
ref|NP_565953.1|  uncharacterized protein                               125   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004164472.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   5e-42   
ref|XP_004148469.1|  PREDICTED: uncharacterized protein LOC101216750    134   5e-42   Cucumis sativus [cucumbers]
ref|XP_002308021.2|  hypothetical protein POPTR_0006s04740g             121   6e-42   
gb|KEH41636.1|  DUF617 family protein                                   120   6e-42   Medicago truncatula
ref|XP_004304339.1|  PREDICTED: protein MIZU-KUSSEI 1                   125   7e-42   Fragaria vesca subsp. vesca
ref|XP_011048082.1|  PREDICTED: protein MIZU-KUSSEI 1                   120   8e-42   Populus euphratica
gb|KFK37008.1|  hypothetical protein AALP_AA4G200300                    124   1e-41   Arabis alpina [alpine rockcress]
gb|AAM64986.1|  unknown                                                 122   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006843508.1|  hypothetical protein AMTR_s00053p00226450          119   2e-41   Amborella trichopoda
ref|XP_010555003.1|  PREDICTED: protein MIZU-KUSSEI 1                   128   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_009767122.1|  PREDICTED: protein MIZU-KUSSEI 1                   120   4e-41   Nicotiana sylvestris
ref|XP_010099883.1|  hypothetical protein L484_020066                   128   8e-41   Morus notabilis
emb|CDY22533.1|  BnaC03g23430D                                          121   3e-40   Brassica napus [oilseed rape]
ref|XP_002975521.1|  hypothetical protein SELMODRAFT_35960              125   3e-40   
ref|XP_002993523.1|  hypothetical protein SELMODRAFT_25526              124   3e-40   
ref|XP_002323323.2|  hypothetical protein POPTR_0016s05720g             117   5e-40   
ref|XP_008246160.1|  PREDICTED: protein MIZU-KUSSEI 1                   128   5e-40   Prunus mume [ume]
ref|XP_007207067.1|  hypothetical protein PRUPE_ppa026544mg             127   7e-40   Prunus persica
ref|XP_009334887.1|  PREDICTED: protein MIZU-KUSSEI 1                   127   8e-40   Pyrus x bretschneideri [bai li]
ref|XP_010030390.1|  PREDICTED: protein MIZU-KUSSEI 1                   128   8e-40   Eucalyptus grandis [rose gum]
gb|EYU20757.1|  hypothetical protein MIMGU_mgv1a020233mg                115   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_008359614.1|  PREDICTED: LOW QUALITY PROTEIN: protein MIZU...    127   2e-39   
ref|XP_006827095.1|  hypothetical protein AMTR_s00010p00241490          119   3e-39   Amborella trichopoda
ref|XP_009589332.1|  PREDICTED: protein MIZU-KUSSEI 1-like              115   4e-39   Nicotiana tomentosiformis
ref|XP_004302225.1|  PREDICTED: protein MIZU-KUSSEI 1                   125   4e-39   Fragaria vesca subsp. vesca
ref|XP_008465295.1|  PREDICTED: protein MIZU-KUSSEI 1-like              113   4e-39   Cucumis melo [Oriental melon]
ref|XP_008359600.1|  PREDICTED: protein MIZU-KUSSEI 1-like              124   8e-39   
ref|XP_006294693.1|  hypothetical protein CARUB_v10023729mg             130   9e-39   
ref|XP_009764440.1|  PREDICTED: protein MIZU-KUSSEI 1-like              127   1e-38   Nicotiana sylvestris
ref|XP_009603070.1|  PREDICTED: protein MIZU-KUSSEI 1-like              127   1e-38   Nicotiana tomentosiformis
ref|XP_011079455.1|  PREDICTED: protein MIZU-KUSSEI 1-like              120   1e-38   
ref|XP_006648974.1|  PREDICTED: protein MIZU-KUSSEI 1-like              109   1e-38   
ref|XP_011078690.1|  PREDICTED: protein MIZU-KUSSEI 1-like              120   1e-38   Sesamum indicum [beniseed]
emb|CDP12914.1|  unnamed protein product                                125   2e-38   Coffea canephora [robusta coffee]
ref|NP_001047891.1|  Os02g0709600                                       108   2e-38   
ref|XP_010670535.1|  PREDICTED: protein MIZU-KUSSEI 1                   120   3e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB49119.1|  hypothetical protein B456_008G101800                    119   4e-38   Gossypium raimondii
ref|XP_009142762.1|  PREDICTED: protein MIZU-KUSSEI 1-like              118   4e-38   Brassica rapa
ref|XP_004240003.1|  PREDICTED: protein MIZU-KUSSEI 1-like              125   5e-38   Solanum lycopersicum
ref|XP_006285428.1|  hypothetical protein CARUB_v10006845mg             122   6e-38   Capsella rubella
ref|XP_011090612.1|  PREDICTED: protein MIZU-KUSSEI 1                   119   7e-38   Sesamum indicum [beniseed]
ref|XP_010067695.1|  PREDICTED: protein MIZU-KUSSEI 1                   114   1e-37   
ref|XP_011039443.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   1e-37   Populus euphratica
ref|XP_006428035.1|  hypothetical protein CICLE_v10027107mg             121   1e-37   Citrus clementina [clementine]
ref|XP_001782204.1|  predicted protein                                  115   2e-37   
ref|XP_010261312.1|  PREDICTED: protein MIZU-KUSSEI 1                   121   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002265066.1|  PREDICTED: protein MIZU-KUSSEI 1                   120   2e-37   Vitis vinifera
ref|XP_010557905.1|  PREDICTED: protein MIZU-KUSSEI 1-like              113   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_006404651.1|  hypothetical protein EUTSA_v10000297mg             117   5e-37   Eutrema salsugineum [saltwater cress]
ref|XP_001755979.1|  predicted protein                                  114   5e-37   
ref|XP_010939762.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   5e-37   Elaeis guineensis
gb|KFK32849.1|  hypothetical protein AALP_AA6G295000                    117   6e-37   Arabis alpina [alpine rockcress]
ref|XP_010416955.1|  PREDICTED: protein MIZU-KUSSEI 1-like isofor...    116   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010416956.1|  PREDICTED: protein MIZU-KUSSEI 1-like isofor...    116   6e-37   
gb|EYU31083.1|  hypothetical protein MIMGU_mgv1a012909mg                115   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_011021932.1|  PREDICTED: protein MIZU-KUSSEI 1                   119   7e-37   Populus euphratica
ref|XP_010429117.1|  PREDICTED: protein MIZU-KUSSEI 1-like              115   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002306350.2|  hypothetical protein POPTR_0005s08590g             118   9e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010437078.1|  PREDICTED: protein MIZU-KUSSEI 1-like              117   1e-36   
ref|XP_006346148.1|  PREDICTED: protein MIZU-KUSSEI 1-like              118   1e-36   
ref|XP_010095976.1|  hypothetical protein L484_023965                   123   1e-36   
ref|XP_002880412.1|  hypothetical protein ARALYDRAFT_481063             115   1e-36   
ref|XP_008392540.1|  PREDICTED: protein MIZU-KUSSEI 1                   122   2e-36   
ref|XP_009407603.1|  PREDICTED: protein MIZU-KUSSEI 1-like              123   2e-36   
ref|XP_007048107.1|  Uncharacterized protein isoform 1                  117   2e-36   
ref|XP_002868920.1|  hypothetical protein ARALYDRAFT_490740             116   2e-36   
ref|XP_006296067.1|  hypothetical protein CARUB_v10025217mg             114   2e-36   
gb|KDP35237.1|  hypothetical protein JCGZ_09396                         117   2e-36   
gb|EPS67774.1|  hypothetical protein M569_07000                         114   2e-36   
gb|KHN37521.1|  hypothetical protein glysoja_034387                     101   2e-36   
ref|XP_009800749.1|  PREDICTED: protein MIZU-KUSSEI 1                   118   3e-36   
ref|XP_009615855.1|  PREDICTED: protein MIZU-KUSSEI 1                   117   3e-36   
ref|XP_009125670.1|  PREDICTED: protein MIZU-KUSSEI 1-like              113   3e-36   
emb|CDY14060.1|  BnaC02g01770D                                          113   3e-36   
ref|XP_010491299.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   3e-36   
gb|KFK25091.1|  hypothetical protein AALP_AA8G065100                    112   4e-36   
ref|XP_010423268.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   4e-36   
ref|XP_006351404.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   4e-36   
ref|XP_008445952.1|  PREDICTED: protein MIZU-KUSSEI 1                   120   4e-36   
ref|XP_010431935.1|  PREDICTED: protein MIZU-KUSSEI 1-like              115   4e-36   
ref|XP_004308662.1|  PREDICTED: protein MIZU-KUSSEI 1                   112   4e-36   
emb|CDY05011.1|  BnaAnng01930D                                          112   4e-36   
ref|XP_010452647.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   4e-36   
gb|KFK30531.1|  hypothetical protein AALP_AA7G274500                    115   5e-36   
ref|XP_010531413.1|  PREDICTED: protein MIZU-KUSSEI 1                   113   5e-36   
ref|XP_007048108.1|  Uncharacterized protein isoform 2                  117   5e-36   
ref|XP_010520089.1|  PREDICTED: protein MIZU-KUSSEI 1-like              110   5e-36   
ref|XP_006289710.1|  hypothetical protein CARUB_v10003275mg             112   6e-36   
ref|NP_196316.1|  uncharacterized protein                               112   6e-36   
ref|XP_004249257.1|  PREDICTED: protein MIZU-KUSSEI 1-like              107   6e-36   
ref|XP_006399178.1|  hypothetical protein EUTSA_v10016081mg             112   6e-36   
ref|XP_002871245.1|  hypothetical protein ARALYDRAFT_487519             112   7e-36   
ref|XP_009370677.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   7e-36   
ref|XP_003602481.1|  Plant-specific domain TIGR01570 family protein     119   7e-36   
ref|XP_007010823.1|  NADPH-dependent diflavin oxidoreductase 1          112   8e-36   
ref|XP_001752190.1|  predicted protein                                  116   8e-36   
ref|XP_008796576.1|  PREDICTED: protein MIZU-KUSSEI 1                   108   9e-36   
ref|XP_010474405.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   1e-35   
ref|XP_008348668.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   1e-35   
ref|XP_008231658.1|  PREDICTED: protein MIZU-KUSSEI 1                   109   1e-35   
ref|XP_007221069.1|  hypothetical protein PRUPE_ppa016312mg             108   1e-35   
ref|NP_195671.1|  uncharacterized protein                               114   1e-35   
gb|KHN03686.1|  hypothetical protein glysoja_041233                     102   1e-35   
ref|XP_002528678.1|  conserved hypothetical protein                     116   1e-35   
gb|KDP42032.1|  hypothetical protein JCGZ_03095                         111   2e-35   
ref|XP_002276210.1|  PREDICTED: protein MIZU-KUSSEI 1                   114   2e-35   
gb|KJB75027.1|  hypothetical protein B456_012G019400                    110   2e-35   
ref|XP_004173191.1|  PREDICTED: uncharacterized LOC101223093            117   2e-35   
ref|XP_004135361.1|  PREDICTED: uncharacterized protein LOC101223093    117   2e-35   
gb|AAM67173.1|  unknown                                                 114   2e-35   
ref|NP_179790.1|  uncharacterized protein                               111   3e-35   
gb|EYU42916.1|  hypothetical protein MIMGU_mgv1a014039mg                110   3e-35   
ref|XP_006581738.1|  PREDICTED: protein MIZU-KUSSEI 1-like              118   3e-35   
ref|XP_002969498.1|  hypothetical protein SELMODRAFT_91391              108   4e-35   
ref|XP_002986790.1|  hypothetical protein SELMODRAFT_124756             108   4e-35   
ref|XP_007223872.1|  hypothetical protein PRUPE_ppa010854mg             108   5e-35   
ref|XP_010446513.1|  PREDICTED: protein MIZU-KUSSEI 1-like              112   5e-35   
ref|XP_010909343.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   7e-35   
emb|CDP01625.1|  unnamed protein product                                111   8e-35   
ref|XP_010526634.1|  PREDICTED: protein MIZU-KUSSEI 1                   110   8e-35   
ref|XP_011034730.1|  PREDICTED: protein MIZU-KUSSEI 1-like              111   1e-34   
ref|XP_006466129.1|  PREDICTED: protein MIZU-KUSSEI 1-like              109   1e-34   
ref|XP_004249754.2|  PREDICTED: protein MIZU-KUSSEI 1-like              109   2e-34   
ref|XP_010937340.1|  PREDICTED: protein MIZU-KUSSEI 1                   118   2e-34   
ref|XP_004502865.1|  PREDICTED: uncharacterized protein LOC101492225    115   2e-34   
gb|KDO44371.1|  hypothetical protein CISIN_1g046777mg                   109   2e-34   
gb|KJB58409.1|  hypothetical protein B456_009G209000                    106   2e-34   
ref|XP_008375489.1|  PREDICTED: protein MIZU-KUSSEI 1-like              104   2e-34   
ref|XP_009122390.1|  PREDICTED: protein MIZU-KUSSEI 1-like              107   2e-34   
ref|XP_009367402.1|  PREDICTED: protein MIZU-KUSSEI 1-like              107   3e-34   
ref|XP_011100890.1|  PREDICTED: protein MIZU-KUSSEI 1-like              109   3e-34   
ref|XP_008789831.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   3e-34   
ref|XP_006432401.1|  hypothetical protein CICLE_v10003339mg             109   3e-34   
gb|AFK42335.1|  unknown                                                 107   4e-34   
emb|CDX99018.1|  BnaC09g48170D                                          106   4e-34   
ref|XP_002299186.2|  hypothetical protein POPTR_0001s06920g             112   5e-34   
ref|XP_004237443.1|  PREDICTED: protein MIZU-KUSSEI 1                   110   5e-34   
ref|XP_010907874.1|  PREDICTED: protein MIZU-KUSSEI 1-like              104   6e-34   
gb|KJB71224.1|  hypothetical protein B456_011G111600                    110   7e-34   
ref|XP_006411754.1|  hypothetical protein EUTSA_v10025971mg             109   8e-34   
ref|XP_009409300.1|  PREDICTED: protein MIZU-KUSSEI 1-like              104   8e-34   
ref|XP_009109460.1|  PREDICTED: protein MIZU-KUSSEI 1                   108   8e-34   
ref|XP_009362001.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   8e-34   
gb|EYU24041.1|  hypothetical protein MIMGU_mgv1a012851mg                110   9e-34   
ref|XP_009140318.1|  PREDICTED: protein MIZU-KUSSEI 1                   105   1e-33   
ref|XP_006351405.1|  PREDICTED: protein MIZU-KUSSEI 1-like              103   1e-33   
ref|XP_003545815.1|  PREDICTED: protein MIZU-KUSSEI 1-like              111   1e-33   
ref|XP_003627973.1|  hypothetical protein MTR_8g040690                  110   1e-33   
ref|XP_006434841.1|  hypothetical protein CICLE_v10002336mg             105   1e-33   
ref|XP_007133681.1|  hypothetical protein PHAVU_011G200100g             112   2e-33   
ref|XP_006354725.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   2e-33   
ref|NP_001241228.1|  uncharacterized protein LOC100782262               108   2e-33   
ref|XP_008378058.1|  PREDICTED: protein MIZU-KUSSEI 1                   104   2e-33   
gb|KHN04521.1|  hypothetical protein glysoja_019608                     108   2e-33   
ref|XP_007137598.1|  hypothetical protein PHAVU_009G139800g             113   2e-33   
emb|CAN67637.1|  hypothetical protein VITISV_044256                     110   2e-33   
ref|XP_008352003.1|  PREDICTED: protein MIZU-KUSSEI 1-like              103   3e-33   
ref|XP_009385314.1|  PREDICTED: protein MIZU-KUSSEI 1-like              117   3e-33   
ref|XP_007136656.1|  hypothetical protein PHAVU_009G062800g             105   3e-33   
ref|XP_002301199.1|  hypothetical protein POPTR_0002s13020g             103   3e-33   
ref|XP_004291140.1|  PREDICTED: protein MIZU-KUSSEI 1                   106   3e-33   
ref|XP_007017353.1|  Uncharacterized protein TCM_033904                 103   3e-33   
ref|XP_006374996.1|  hypothetical protein POPTR_0014s03430g             104   4e-33   
ref|XP_009417614.1|  PREDICTED: protein MIZU-KUSSEI 1                   103   4e-33   
ref|XP_010270615.1|  PREDICTED: protein MIZU-KUSSEI 1                   106   4e-33   
ref|XP_002284248.1|  PREDICTED: protein MIZU-KUSSEI 1                   103   5e-33   
emb|CDY23838.1|  BnaC04g01990D                                          118   6e-33   
ref|XP_009370159.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   6e-33   
ref|XP_011020442.1|  PREDICTED: protein MIZU-KUSSEI 1                   106   6e-33   
ref|XP_002303945.1|  hypothetical protein POPTR_0003s19310g             105   7e-33   
ref|XP_003627972.1|  hypothetical protein MTR_8g040680                  107   9e-33   
ref|XP_009408769.1|  PREDICTED: protein MIZU-KUSSEI 1-like              107   9e-33   
ref|XP_004511097.1|  PREDICTED: uncharacterized protein LOC101488580    107   1e-32   
ref|XP_009382481.1|  PREDICTED: protein MIZU-KUSSEI 1-like              103   1e-32   
ref|XP_011017240.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   1e-32   
ref|XP_002277140.1|  PREDICTED: protein MIZU-KUSSEI 1                   109   1e-32   
ref|XP_009630849.1|  PREDICTED: protein MIZU-KUSSEI 1-like              105   1e-32   
ref|XP_010505952.1|  PREDICTED: protein MIZU-KUSSEI 1-like              130   1e-32   
emb|CBI40793.3|  unnamed protein product                                109   1e-32   
ref|XP_009412919.1|  PREDICTED: protein MIZU-KUSSEI 1-like              101   1e-32   
gb|KDP38396.1|  hypothetical protein JCGZ_04321                         101   2e-32   
ref|XP_002510272.1|  conserved hypothetical protein                     102   2e-32   
ref|XP_011030567.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   2e-32   
ref|XP_003603001.1|  hypothetical protein MTR_3g101300                  109   2e-32   
gb|AET02448.2|  DUF617 family protein                                   106   2e-32   
ref|XP_008452504.1|  PREDICTED: protein MIZU-KUSSEI 1                   102   2e-32   
gb|KJB14550.1|  hypothetical protein B456_002G130800                    102   2e-32   
ref|XP_010268622.1|  PREDICTED: protein MIZU-KUSSEI 1-like            99.8    2e-32   
ref|XP_004141242.1|  PREDICTED: uncharacterized protein LOC101210761    101   2e-32   
ref|XP_007018631.1|  Uncharacterized protein TCM_034800                 107   2e-32   
ref|XP_006829917.1|  hypothetical protein AMTR_s00073p00132390          101   3e-32   
gb|KFK31831.1|  hypothetical protein AALP_AA6G164000                    107   3e-32   
ref|XP_010245860.1|  PREDICTED: protein MIZU-KUSSEI 1-like              115   4e-32   
ref|XP_008775558.1|  PREDICTED: protein MIZU-KUSSEI 1-like              105   5e-32   
ref|XP_006403364.1|  hypothetical protein EUTSA_v10003333mg             105   5e-32   
gb|KDP36718.1|  hypothetical protein JCGZ_08009                         105   7e-32   
ref|XP_008787269.1|  PREDICTED: protein MIZU-KUSSEI 1                   108   7e-32   
ref|NP_199082.1|  uncharacterized protein                               106   7e-32   
ref|XP_002865496.1|  hypothetical protein ARALYDRAFT_494768             105   8e-32   
ref|XP_006281812.1|  hypothetical protein CARUB_v10027988mg             105   9e-32   
ref|XP_010495619.1|  PREDICTED: protein MIZU-KUSSEI 1-like              105   1e-31   
ref|XP_010484889.1|  PREDICTED: protein MIZU-KUSSEI 1-like              105   1e-31   
ref|XP_010268712.1|  PREDICTED: protein MIZU-KUSSEI 1-like              105   1e-31   
ref|XP_002510752.1|  conserved hypothetical protein                     105   2e-31   
emb|CDM84604.1|  unnamed protein product                              99.4    2e-31   
dbj|BAD68061.1|  hypothetical protein                                 96.3    2e-31   
gb|AFW84812.1|  hypothetical protein ZEAMMB73_483487                  99.0    2e-31   
ref|XP_008657142.1|  PREDICTED: protein MIZU-KUSSEI 1-like            98.2    3e-31   
ref|NP_001172610.1|  Os01g0806400                                     96.3    3e-31   
ref|XP_011083804.1|  PREDICTED: protein MIZU-KUSSEI 1                   107   3e-31   
ref|XP_008361138.1|  PREDICTED: uncharacterized protein LOC103424823    100   3e-31   
gb|EAY76198.1|  hypothetical protein OsI_04133                        96.3    3e-31   
ref|XP_010245849.1|  PREDICTED: protein MIZU-KUSSEI 1-like              101   3e-31   
ref|XP_009612047.1|  PREDICTED: protein MIZU-KUSSEI 1                   100   3e-31   
ref|XP_002456504.1|  hypothetical protein SORBIDRAFT_03g037520        96.7    4e-31   
ref|XP_008788151.1|  PREDICTED: protein MIZU-KUSSEI 1-like              110   4e-31   
ref|XP_009801061.1|  PREDICTED: protein MIZU-KUSSEI 1 isoform X1        100   4e-31   
ref|XP_009399696.1|  PREDICTED: protein MIZU-KUSSEI 1-like              100   5e-31   
ref|XP_009114052.1|  PREDICTED: protein MIZU-KUSSEI 1                   103   5e-31   
ref|XP_004972223.1|  PREDICTED: uncharacterized protein LOC101762742  96.3    6e-31   
ref|XP_003528240.1|  PREDICTED: protein MIZU-KUSSEI 1-like              108   6e-31   
ref|XP_010445904.1|  PREDICTED: protein MIZU-KUSSEI 1-like              106   7e-31   
ref|XP_010098720.1|  hypothetical protein L484_026099                 96.3    7e-31   
ref|XP_009803462.1|  PREDICTED: protein MIZU-KUSSEI 1-like              103   1e-30   
gb|KDP26076.1|  hypothetical protein JCGZ_21109                         125   1e-30   
gb|EYU25388.1|  hypothetical protein MIMGU_mgv1a012805mg                100   1e-30   
emb|CDX69999.1|  BnaA10g23480D                                        93.2    3e-30   
ref|XP_008796350.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   4e-30   
ref|XP_002463663.1|  hypothetical protein SORBIDRAFT_01g003810          102   4e-30   
ref|XP_010681089.1|  PREDICTED: protein MIZU-KUSSEI 1                   104   4e-30   
ref|XP_010059770.1|  PREDICTED: protein MIZU-KUSSEI 1                 95.1    5e-30   
ref|XP_007205789.1|  hypothetical protein PRUPE_ppa010574mg             105   5e-30   
dbj|BAJ95891.1|  predicted protein                                      102   5e-30   
ref|XP_010922384.1|  PREDICTED: protein MIZU-KUSSEI 1-like              103   6e-30   
ref|XP_011034768.1|  PREDICTED: protein MIZU-KUSSEI 1                   100   7e-30   
ref|XP_004986163.1|  PREDICTED: uncharacterized protein LOC101779349    101   8e-30   
ref|XP_003579366.1|  PREDICTED: protein MIZU-KUSSEI 1-like              107   8e-30   
ref|XP_008779537.1|  PREDICTED: protein MIZU-KUSSEI 1-like              101   9e-30   
ref|XP_010061342.1|  PREDICTED: protein MIZU-KUSSEI 1                   101   9e-30   
ref|XP_004252775.1|  PREDICTED: protein MIZU-KUSSEI 1                 97.1    1e-29   
ref|XP_010539062.1|  PREDICTED: protein MIZU-KUSSEI 1                 99.8    1e-29   
gb|KGN59496.1|  hypothetical protein Csa_3G822475                     96.7    1e-29   
gb|EPS66948.1|  hypothetical protein M569_07826                         100   1e-29   
ref|NP_001175627.1|  Os08g0476600                                       100   2e-29   
ref|XP_002301888.1|  hypothetical protein POPTR_0002s00410g           99.4    2e-29   
ref|XP_008443324.1|  PREDICTED: protein MIZU-KUSSEI 1                 96.7    2e-29   
emb|CCI55412.1|  PH01B015M02.13                                         102   2e-29   
ref|XP_006342610.1|  PREDICTED: protein MIZU-KUSSEI 1-like            97.1    2e-29   
ref|XP_006849844.1|  hypothetical protein AMTR_s00022p00044860        95.5    3e-29   
ref|XP_004973686.1|  PREDICTED: uncharacterized protein LOC101774113  96.3    4e-29   
ref|XP_008664526.1|  PREDICTED: protein MIZU-KUSSEI 1-like              101   4e-29   
ref|XP_010920771.1|  PREDICTED: protein MIZU-KUSSEI 1                   101   4e-29   
ref|XP_010539748.1|  PREDICTED: protein MIZU-KUSSEI 1                   100   5e-29   
ref|XP_010927439.1|  PREDICTED: protein MIZU-KUSSEI 1-like            97.4    5e-29   
ref|XP_002307012.1|  hypothetical protein POPTR_0005s28070g           97.4    6e-29   
gb|ABK21635.1|  unknown                                               95.1    6e-29   
ref|XP_008235311.1|  PREDICTED: protein MIZU-KUSSEI 1-like              102   6e-29   
ref|XP_008794229.1|  PREDICTED: protein MIZU-KUSSEI 1-like            96.3    7e-29   
gb|KJB29516.1|  hypothetical protein B456_005G104800                  90.9    7e-29   
emb|CDX96608.1|  BnaA08g21510D                                        95.9    8e-29   
emb|CDX68091.1|  BnaA07g21310D                                        94.7    1e-28   
ref|XP_002272579.1|  PREDICTED: protein MIZU-KUSSEI 1                 94.7    1e-28   
ref|XP_009104664.1|  PREDICTED: protein MIZU-KUSSEI 1                 94.7    1e-28   
ref|XP_004972735.1|  PREDICTED: uncharacterized protein LOC101773968    103   1e-28   
ref|XP_009110199.1|  PREDICTED: protein MIZU-KUSSEI 1-like            95.9    1e-28   
ref|XP_006466566.1|  PREDICTED: protein MIZU-KUSSEI 1-like            97.4    2e-28   
ref|XP_011041116.1|  PREDICTED: protein MIZU-KUSSEI 1                 95.9    2e-28   
ref|XP_010907600.1|  PREDICTED: protein MIZU-KUSSEI 1-like            95.1    2e-28   
ref|XP_002444525.1|  hypothetical protein SORBIDRAFT_07g023190        97.4    2e-28   
ref|XP_006426311.1|  hypothetical protein CICLE_v10027358mg           97.1    3e-28   
ref|NP_001061099.1|  Os08g0171800                                       103   3e-28   
ref|XP_010548823.1|  PREDICTED: protein MIZU-KUSSEI 1                   102   3e-28   
ref|XP_009418229.1|  PREDICTED: protein MIZU-KUSSEI 1-like            96.3    3e-28   
ref|XP_010273895.1|  PREDICTED: protein MIZU-KUSSEI 1                   103   3e-28   
dbj|BAD09202.1|  hypothetical protein                                 97.4    4e-28   
ref|XP_006429210.1|  hypothetical protein CICLE_v10013699mg           99.0    5e-28   
gb|KDO57947.1|  hypothetical protein CISIN_1g025738mg                 99.0    6e-28   
ref|XP_006481391.1|  PREDICTED: protein MIZU-KUSSEI 1-like            98.6    6e-28   
ref|XP_010257111.1|  PREDICTED: protein MIZU-KUSSEI 1                 93.2    6e-28   



>ref|XP_006348585.1| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum tuberosum]
Length=253

 Score =   197 bits (502),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 117/149 (79%), Gaps = 11/149 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFG---IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            ++ VSKLRSALTFG    +  LG++VVGTLFG+RRG VHFAFQEDP+LGPAF VE+A PT
Sbjct  69   RSTVSKLRSALTFGKSRTQIGLGSKVVGTLFGYRRGHVHFAFQEDPKLGPAFFVEMATPT  128

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
              LVREMASG VRIALE +  T         K  KLLEEP WRTYCNGRKCG+A +RECG
Sbjct  129  SHLVREMASGLVRIALESDKRTGK-------KGVKLLEEPIWRTYCNGRKCGYAMKRECG  181

Query  228  PDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            PD+W++LNSIGP++MGAGVLP  + DGIG
Sbjct  182  PDEWKILNSIGPVSMGAGVLPS-DGDGIG  209


 Score = 81.6 bits (200),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDGHGGPELS+YLLR 
Sbjct  213  ELMYMRAKFERVVGSKDSEAFYMMNPDGHGGPELSLYLLRV  253



>ref|XP_004238977.1| PREDICTED: protein MIZU-KUSSEI 1 [Solanum lycopersicum]
Length=258

 Score =   197 bits (501),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 117/149 (79%), Gaps = 11/149 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFG---IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            ++ VSKLRSALTFG    +  LG +V+GTLFG+RRG VHFAFQEDP+LGPAF VE+A PT
Sbjct  74   RSTVSKLRSALTFGKSRTQIGLGTKVIGTLFGYRRGHVHFAFQEDPKLGPAFFVEMATPT  133

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
              LVREMASG VRIALE +  T        KK  KLLEEP WRTYCNGRKCG+A +RECG
Sbjct  134  SHLVREMASGLVRIALESDKRTG-------KKGVKLLEEPNWRTYCNGRKCGYAMKRECG  186

Query  228  PDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            PD+W++LNSIGP++MGAGVLP  + DGIG
Sbjct  187  PDEWKILNSIGPVSMGAGVLP-SDGDGIG  214


 Score = 81.6 bits (200),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDGHGGPELS+YLLR 
Sbjct  218  ELMYMRAKFERVVGSKDSEAFYMMNPDGHGGPELSLYLLRV  258



>emb|CDP00556.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   191 bits (485),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 109/142 (77%), Gaps = 10/142 (7%)
 Frame = -2

Query  573  AVSKLRSALTFGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            AVSKLR+A  FG K     S LG +VVGTLFG+RRG VHFAFQEDP+L PAFLVELA PT
Sbjct  76   AVSKLRAAFAFGNKNRSRFSGLGTKVVGTLFGYRRGHVHFAFQEDPKLSPAFLVELATPT  135

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
             VL++EMASG VRIALEC+  T   +         LLEE  WRTYCNGRKCG+A RRECG
Sbjct  136  SVLIKEMASGLVRIALECDRKTTEKK-----NVKPLLEEQIWRTYCNGRKCGYATRRECG  190

Query  228  PDDWRVLNSIGPITMGAGVLPG  163
             ++W+VLNSIGPI+MGAGVLPG
Sbjct  191  AEEWKVLNSIGPISMGAGVLPG  212


 Score = 83.2 bits (204),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDGHGGPELSIYLLR 
Sbjct  222  ELMYMRAKFERVVGSKDSEAFYMMNPDGHGGPELSIYLLRV  262



>ref|XP_009595333.1| PREDICTED: protein MIZU-KUSSEI 1 [Nicotiana tomentosiformis]
Length=256

 Score =   191 bits (485),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 114/151 (75%), Gaps = 13/151 (9%)
 Frame = -2

Query  579  KTAVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            ++ VS LRSALTFG       S LG +VVGTLFG+RRG VHFAFQEDP+L PAF VELA 
Sbjct  70   RSTVSILRSALTFGKSRTHFSSGLGTKVVGTLFGYRRGHVHFAFQEDPKLSPAFFVELAT  129

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            PT  LVREMASG VRIALE +  T        KK  KLLEEP WRTYCNGRKCG+  +RE
Sbjct  130  PTSHLVREMASGLVRIALEADKRTG-------KKAVKLLEEPIWRTYCNGRKCGYGMKRE  182

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            CGP++W++LNSIGP++MGAGVLP  + DGIG
Sbjct  183  CGPEEWKILNSIGPVSMGAGVLPS-DGDGIG  212


 Score = 81.6 bits (200),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDGHGGPELS+YLLR 
Sbjct  216  ELMYMRAKFERVVGSKDSEAFYMMNPDGHGGPELSLYLLRV  256



>ref|XP_009789140.1| PREDICTED: protein MIZU-KUSSEI 1 [Nicotiana sylvestris]
Length=257

 Score =   190 bits (483),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 114/151 (75%), Gaps = 13/151 (9%)
 Frame = -2

Query  579  KTAVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            ++ VS LRSALTFG       S LG +VVGTLFG+RRG VHFAFQEDP+L PAF VELA 
Sbjct  71   RSTVSILRSALTFGKSRTHFSSGLGTKVVGTLFGYRRGHVHFAFQEDPKLSPAFFVELAT  130

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            PT  LVREMASG VRIALE +  T        KK  KLLEEP WRTYCNGRKCG+  +RE
Sbjct  131  PTSHLVREMASGLVRIALEADKRTG-------KKAVKLLEEPIWRTYCNGRKCGYGMKRE  183

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            CGP++W++LNSIGP++MGAGVLP  + DGIG
Sbjct  184  CGPEEWKILNSIGPVSMGAGVLPS-DGDGIG  213


 Score = 81.6 bits (200),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDGHGGPELS+YLLR 
Sbjct  217  ELMYMRAKFERVVGSKDSEAFYMMNPDGHGGPELSLYLLRV  257



>ref|XP_011077413.1| PREDICTED: protein MIZU-KUSSEI 1-like [Sesamum indicum]
Length=269

 Score =   189 bits (479),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 109/142 (77%), Gaps = 12/142 (8%)
 Frame = -2

Query  573  AVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            AVSKLRSAL  G       S LG +VVGTLFG RRG VHFAFQED +L PAFLVELA PT
Sbjct  85   AVSKLRSALALGRARTHFSSGLGTKVVGTLFGHRRGHVHFAFQEDFKLNPAFLVELATPT  144

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
             +LV+EMASG VRIALEC+  T         K  KLLEEP WRTYCNG+KCG+A +RECG
Sbjct  145  SILVKEMASGLVRIALECDKKTEK-------KGFKLLEEPIWRTYCNGKKCGYAMKRECG  197

Query  228  PDDWRVLNSIGPITMGAGVLPG  163
            P++W+VLN+IGPI+MGAGVLPG
Sbjct  198  PEEWKVLNAIGPISMGAGVLPG  219


 Score = 80.9 bits (198),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDG+GGPELSIYLLR 
Sbjct  229  ELMYMRAKFERVVGSKDSEAFYMMNPDGNGGPELSIYLLRV  269



>ref|XP_008243149.1| PREDICTED: protein MIZU-KUSSEI 1 [Prunus mume]
Length=265

 Score =   187 bits (475),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 115/148 (78%), Gaps = 12/148 (8%)
 Frame = -2

Query  573  AVSKLRSALT-FG---IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTG  406
            +VSKLRSALT FG    +S LG RV+GTLFG+RRG VH AFQE+P+L PAFL+ELA PT 
Sbjct  82   SVSKLRSALTVFGKSRSRSGLGTRVMGTLFGYRRGHVHLAFQEEPKLSPAFLIELATPTS  141

Query  405  VLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGP  226
            VLVREMASG VRIALECE  T         K  K+LEEP WRTYCNG+KCGFA +R+CGP
Sbjct  142  VLVREMASGLVRIALECEKKTEK-------KGLKMLEEPLWRTYCNGKKCGFAMKRDCGP  194

Query  225  DDWRVLNSIGPITMGAGVLPGKEDDGIG  142
             +W+VL ++ PI+MGAGVLPG E DG+G
Sbjct  195  GEWKVLKALEPISMGAGVLPGSE-DGVG  221


 Score = 79.7 bits (195),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVVGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>ref|XP_007226866.1| hypothetical protein PRUPE_ppa017045mg [Prunus persica]
 gb|EMJ28065.1| hypothetical protein PRUPE_ppa017045mg [Prunus persica]
Length=265

 Score =   187 bits (475),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 115/148 (78%), Gaps = 12/148 (8%)
 Frame = -2

Query  573  AVSKLRSALT-FG---IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTG  406
            +VSK+RSALT FG    +S LG RV+GTLFG+RRG VH AFQE+P+L PAFL+ELA PT 
Sbjct  82   SVSKIRSALTVFGKRRSRSGLGTRVMGTLFGYRRGHVHLAFQEEPKLSPAFLIELATPTS  141

Query  405  VLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGP  226
            VLVREMASG VRIALECE  T         K  K+LEEP WRTYCNG+KCGFA +R+CGP
Sbjct  142  VLVREMASGLVRIALECEKKTEK-------KGLKMLEEPLWRTYCNGKKCGFAMKRDCGP  194

Query  225  DDWRVLNSIGPITMGAGVLPGKEDDGIG  142
             +W+VL ++ PI+MGAGVLPG E DG+G
Sbjct  195  GEWKVLKALEPISMGAGVLPGSE-DGVG  221


 Score = 79.7 bits (195),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVVGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>ref|XP_011070851.1| PREDICTED: protein MIZU-KUSSEI 1-like [Sesamum indicum]
Length=264

 Score =   187 bits (474),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 110/152 (72%), Gaps = 16/152 (11%)
 Frame = -2

Query  576  TAVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             AVSKLRSAL  G       S LG +VVGTLFG RRG VHFAFQED +L PAFLVELA P
Sbjct  79   VAVSKLRSALAIGRARNHFSSGLGTKVVGTLFGHRRGHVHFAFQEDFKLNPAFLVELATP  138

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLV+EMASG VRIALEC+            K  KLLEEP WRTYCNG+KCG+A RR+C
Sbjct  139  TSVLVKEMASGLVRIALECDKKVEK-------KGFKLLEEPIWRTYCNGKKCGYAMRRDC  191

Query  231  GPDDWRVLNSIGPITMGAGVLP----GKEDDG  148
            GP++W VLNSIGPI+MGAGVLP    G E DG
Sbjct  192  GPEEWSVLNSIGPISMGAGVLPGTGNGTESDG  223


 Score = 79.7 bits (195),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERVVGS+DSEAFYMM+PDG+GGPELSIYLLR 
Sbjct  224  EMMYMRAKFERVVGSKDSEAFYMMNPDGNGGPELSIYLLRV  264



>ref|XP_004297152.1| PREDICTED: protein MIZU-KUSSEI 1 [Fragaria vesca subsp. vesca]
Length=266

 Score =   184 bits (467),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 114/143 (80%), Gaps = 9/143 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGAR--VVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
             +VSKLRSAL FG KS  G+R  ++GTLFG+RRG VH AFQEDP+L P FL+ELA PT V
Sbjct  84   VSVSKLRSAL-FG-KSRAGSRSGLMGTLFGYRRGHVHLAFQEDPKLNPTFLIELATPTSV  141

Query  402  LVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPD  223
            LVREMASG VRIALECE  T+      KKK  KLLEEP WRTYCNG+KCGFA RR+CGP+
Sbjct  142  LVREMASGLVRIALECEKKTD-----HKKKGLKLLEEPLWRTYCNGKKCGFAMRRDCGPE  196

Query  222  DWRVLNSIGPITMGAGVLPGKED  154
            +W+VL ++ P++MGAGVLPG ED
Sbjct  197  EWKVLKALEPVSMGAGVLPGNED  219


 Score = 77.4 bits (189),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDG  GPELS+YLLR 
Sbjct  226  ELMYMRAKFERVVGSKDSEAFYMMNPDGSAGPELSVYLLRV  266



>ref|XP_003518017.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=290

 Score =   181 bits (458),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 114/166 (69%), Gaps = 27/166 (16%)
 Frame = -2

Query  567  SKLRSALT-FGIKSP------------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLV  427
            SK +SALT F  + P            LG RVVGTLFG RRG VHFAFQEDP+LGPAFL+
Sbjct  87   SKFKSALTVFTTRVPRLGLHHNKNSSSLGTRVVGTLFGHRRGHVHFAFQEDPKLGPAFLI  146

Query  426  ELAMPTGVLVREMASGPVRIALECE----GNTNTWEknkkkkkaKLLEEPAWRTYCNGRK  259
            ELA PT VLVREMASG VRIALECE    G+ N    N    K +LLEEP WRTYCNGRK
Sbjct  147  ELATPTSVLVREMASGLVRIALECEKKKKGDIN---YNASSSKVRLLEEPLWRTYCNGRK  203

Query  258  CGFAARRECGPDDWRVLNSIGPITMGAGVLP-------GKEDDGIG  142
            CG+A RRECGP+ W++L ++ PI+MGAGVLP       G E++  G
Sbjct  204  CGYANRRECGPEVWKILKAVEPISMGAGVLPVCVNGAAGSEEEAAG  249


 Score = 80.1 bits (196),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAKYERVVGSRDSEAFYMM+PDG GGPELSIYL+R 
Sbjct  250  EVMYMRAKYERVVGSRDSEAFYMMNPDGSGGPELSIYLIRV  290



>ref|XP_006437758.1| hypothetical protein CICLE_v10032404mg [Citrus clementina]
 ref|XP_006484391.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X1 [Citrus sinensis]
 ref|XP_006484392.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X2 [Citrus sinensis]
 gb|ESR50998.1| hypothetical protein CICLE_v10032404mg [Citrus clementina]
 gb|KDO70131.1| hypothetical protein CISIN_1g024261mg [Citrus sinensis]
Length=270

 Score =   187 bits (474),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 113/147 (77%), Gaps = 13/147 (9%)
 Frame = -2

Query  585  RRKTAVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
            ++ +AVSKLRSALT FG       S LG RVVGTLFG+RRG VHFAFQED +L PAFL+E
Sbjct  75   KKSSAVSKLRSALTVFGKSKSAYHSGLGTRVVGTLFGYRRGHVHFAFQEDAKLSPAFLIE  134

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            LA PT VLVREMASG VRIALECE  T        KK  KLLEEP WRTYCNG+KCG+A 
Sbjct  135  LATPTSVLVREMASGLVRIALECEKKTE-------KKGLKLLEEPVWRTYCNGKKCGYAM  187

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPG  163
            RRECGP++ ++L ++ PI+MGAGVLPG
Sbjct  188  RRECGPEELKILKAVEPISMGAGVLPG  214


 Score = 73.9 bits (180),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            LMYMRA++ERVVGS+DSEAFYMM+PD  GGPELS+YLLR 
Sbjct  231  LMYMRARFERVVGSKDSEAFYMMNPDCSGGPELSVYLLRV  270



>ref|XP_007153317.1| hypothetical protein PHAVU_003G025000g [Phaseolus vulgaris]
 gb|ESW25311.1| hypothetical protein PHAVU_003G025000g [Phaseolus vulgaris]
Length=265

 Score =   182 bits (461),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 107/143 (75%), Gaps = 9/143 (6%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIK---SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +RK   SK +SALT   K     LG RVVGTLFG RRG VHFAFQEDP++GPAFL++LA 
Sbjct  81   KRKPNFSKFKSALTVFTKRSHHALGTRVVGTLFGHRRGHVHFAFQEDPKVGPAFLIQLAT  140

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            PT VLVREMASG VRIALECE   +           +LLEE  WRTYCNGRKCG+A+RRE
Sbjct  141  PTSVLVREMASGLVRIALECEKKKSK------NNGLRLLEEGVWRTYCNGRKCGYASRRE  194

Query  234  CGPDDWRVLNSIGPITMGAGVLP  166
            CGP++W++L ++ PI+MGAGVLP
Sbjct  195  CGPEEWKILKAVEPISMGAGVLP  217


 Score = 77.0 bits (188),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA+YERVVGS+DSEAFYMM+PDG GGPELSIYL+R 
Sbjct  225  EVMYMRARYERVVGSKDSEAFYMMNPDGVGGPELSIYLIRV  265



>ref|XP_007046347.1| Uncharacterized protein TCM_011889 [Theobroma cacao]
 gb|EOY02179.1| Uncharacterized protein TCM_011889 [Theobroma cacao]
Length=261

 Score =   180 bits (457),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 108/147 (73%), Gaps = 13/147 (9%)
 Frame = -2

Query  576  TAVSKLRSAL-TFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
             AVSKLRSAL  FG      +S LG RVVGTLFG+RRG VHFAFQE+ +  PAFL+ELA 
Sbjct  73   VAVSKLRSALAVFGKNRSAYRSGLGTRVVGTLFGYRRGHVHFAFQEEAKSSPAFLIELAT  132

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            PT VLVREMASG VRIALECE  T         K  KLLEEP WRTYCNG+KCGFA RR 
Sbjct  133  PTSVLVREMASGLVRIALECEKKTGK-------KGVKLLEEPVWRTYCNGKKCGFAMRRA  185

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKED  154
            CGP +W+VL ++ PI+MGAGVLPG  D
Sbjct  186  CGPGEWKVLKAVEPISMGAGVLPGNCD  212


 Score = 78.2 bits (191),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERVVGS+DSEAFYMM+PDG GGPELS+YLLR 
Sbjct  221  ELMYMRARFERVVGSKDSEAFYMMNPDGTGGPELSVYLLRV  261



>gb|KJB50810.1| hypothetical protein B456_008G187800 [Gossypium raimondii]
 gb|KJB50811.1| hypothetical protein B456_008G187800 [Gossypium raimondii]
Length=265

 Score =   178 bits (451),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 110/152 (72%), Gaps = 14/152 (9%)
 Frame = -2

Query  576  TAVSKLRSAL------TFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
             +VS+LRSAL      T   +S LG RVVGTLFG+RRG VHFAFQE+ ++ PAFL++LA 
Sbjct  77   VSVSRLRSALSVFGKNTSAYRSGLGTRVVGTLFGYRRGHVHFAFQEEAKVSPAFLIQLAT  136

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            PT VLVREMASG VRIALECE            K  KLL EP WRTYCNG+KCGFA RRE
Sbjct  137  PTSVLVREMASGLVRIALECEKTMGK-------KGVKLLNEPVWRTYCNGKKCGFAMRRE  189

Query  234  CGPDDWRVLNSIGPITMGAGVLPGK-EDDGIG  142
            CG ++W+VL ++ PI+MGAGVLPG   D+G G
Sbjct  190  CGAEEWKVLKAVEPISMGAGVLPGNCNDNGAG  221


 Score = 80.1 bits (196),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PDG GGPELS+YLLR 
Sbjct  225  ELMYMRAKFERVVGSKDSEAFYMMNPDGSGGPELSVYLLRV  265



>ref|XP_007138351.1| hypothetical protein PHAVU_009G201400g [Phaseolus vulgaris]
 gb|ESW10345.1| hypothetical protein PHAVU_009G201400g [Phaseolus vulgaris]
Length=266

 Score =   180 bits (456),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 110/149 (74%), Gaps = 11/149 (7%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPL------GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
             AVS++RS LT   K+ L      G+RVVGTLFG+RRG VHFAFQ+DP   PAFL+ELA 
Sbjct  75   VAVSRIRSVLTVFNKNRLNSSLGFGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIELAT  134

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LVREMASG VRIALEC+      EK  +KK  KLLEEP WRTYCNG+KCGFA+RRE
Sbjct  135  PISGLVREMASGLVRIALECDK-----EKRAEKKSVKLLEEPVWRTYCNGKKCGFASRRE  189

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            CGP DW +L ++ PI+MGAGVLPG  + G
Sbjct  190  CGPKDWDILKAVEPISMGAGVLPGNNNSG  218


 Score = 77.0 bits (188),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  226  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  266



>emb|CAN74875.1| hypothetical protein VITISV_038922 [Vitis vinifera]
Length=248

 Score =   177 bits (449),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 113/155 (73%), Gaps = 15/155 (10%)
 Frame = -2

Query  585  RRKTAVS-KLRSALT---FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            R+K A+S KLRSAL    FG     + S LG RV+GTLFG+RRG VHFAFQEDP+  PAF
Sbjct  56   RKKAALSSKLRSALALTLFGKRRSHLSSGLGTRVIGTLFGYRRGHVHFAFQEDPKSHPAF  115

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA  T VLVREMASG VRIALEC+           KK  +LLEEP WRTYCNG+KCG
Sbjct  116  LMELATSTSVLVREMASGLVRIALECDKKVEM------KKGTRLLEEPLWRTYCNGKKCG  169

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            +A +RECG ++W+VL ++ PI+MGAGVLPG  + G
Sbjct  170  YAMKRECGAEEWKVLKAVEPISMGAGVLPGNGETG  204


 Score = 78.6 bits (192),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PD  GGPELSIYLLR 
Sbjct  208  ELMYMRAKFERVVGSKDSEAFYMMNPDSTGGPELSIYLLRV  248



>ref|XP_003631229.1| PREDICTED: protein MIZU-KUSSEI 1 [Vitis vinifera]
 emb|CBI27084.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   177 bits (448),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 113/155 (73%), Gaps = 15/155 (10%)
 Frame = -2

Query  585  RRKTAVS-KLRSALT---FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            R+K A+S KLRSAL    FG     + S LG RV+GTLFG+RRG VHFAFQEDP+  PAF
Sbjct  70   RKKAALSSKLRSALALTLFGKRRSHLSSGLGTRVIGTLFGYRRGHVHFAFQEDPKSHPAF  129

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA  T VLVREMASG VRIALEC+           KK  +LLEEP WRTYCNG+KCG
Sbjct  130  LMELATSTSVLVREMASGLVRIALECDKKVEM------KKGTRLLEEPLWRTYCNGKKCG  183

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            +A +RECG ++W+VL ++ PI+MGAGVLPG  + G
Sbjct  184  YAMKRECGAEEWKVLKAVEPISMGAGVLPGNGETG  218


 Score = 78.6 bits (192),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGS+DSEAFYMM+PD  GGPELSIYLLR 
Sbjct  222  ELMYMRAKFERVVGSKDSEAFYMMNPDSTGGPELSIYLLRV  262



>ref|XP_010262483.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nelumbo nucifera]
Length=271

 Score =   174 bits (442),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 109/144 (76%), Gaps = 13/144 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++LRS LT FG     + S LG RVVGTLFG RRG VHFAFQEDP+  PAFL+ELA P
Sbjct  88   AVARLRSVLTVFGRNRAHLSSGLGTRVVGTLFGNRRGHVHFAFQEDPKSYPAFLIELATP  147

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE   +       KK  +LL+EP WRTYCNG+KCG+A +REC
Sbjct  148  TSGLVREMASGLVRIALECEKVVD-------KKGVRLLQEPLWRTYCNGKKCGYATKREC  200

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP++W+VL ++ PI+MGAGVLPG 
Sbjct  201  GPEEWKVLKAVEPISMGAGVLPGN  224


 Score = 81.3 bits (199),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PDG GGPELSIYLLR 
Sbjct  231  ELMYMRAKFERVVGSRDSEAFYMMNPDGTGGPELSIYLLRV  271



>emb|CDO98489.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   173 bits (439),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 103/148 (70%), Gaps = 14/148 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AVS+LRS LT FG      +  LG RVVGTLFG RRG VHFAFQ+DP   P FL+ELA P
Sbjct  87   AVSRLRSVLTAFGRHRAHFQQGLGTRVVGTLFGNRRGHVHFAFQKDPNSQPVFLIELATP  146

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG  RIALEC+            K  +LLEEP WRTYCNG++CGFAARR+C
Sbjct  147  ITGLVREMASGLARIALECDKEEK--------KSTRLLEEPRWRTYCNGKRCGFAARRDC  198

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            GP +W +L ++ PI+MGAGVLPG  DD 
Sbjct  199  GPKEWNILKAVEPISMGAGVLPGNADDA  226


 Score = 80.1 bits (196),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  232  ELMYMRAKFERVVGSRDSEAFYMMNPDSNGAPELSIYLLRV  272



>ref|XP_002315967.1| hypothetical protein POPTR_0010s14150g [Populus trichocarpa]
 gb|EEF02138.1| hypothetical protein POPTR_0010s14150g [Populus trichocarpa]
Length=263

 Score =   174 bits (440),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 109/152 (72%), Gaps = 17/152 (11%)
 Frame = -2

Query  585  RRKT----AVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            R+KT    A SKLRSALT   KS       LG RVVGTLFG+RRG VHFAFQED +  PA
Sbjct  70   RKKTLPILAFSKLRSALTVFSKSRSAYHSGLGTRVVGTLFGYRRGHVHFAFQEDAKQNPA  129

Query  435  FLVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKC  256
             L+ELA PT VLVREMASG VRIALECE            K  KLLEEP WRTYCNG+KC
Sbjct  130  LLIELATPTSVLVREMASGLVRIALECEKKAGK-------KAGKLLEEPLWRTYCNGKKC  182

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLPGK  160
            G+A+RREC P+DW+VL ++ P++MGAGVLPG 
Sbjct  183  GYASRRECRPEDWKVLKAVEPVSMGAGVLPGN  214


 Score = 79.0 bits (193),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERVVGS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  223  ELMYMRARFERVVGSKDSEAFYMMNPDGSGGPELSIYLLRV  263



>gb|KDP20067.1| hypothetical protein JCGZ_05836 [Jatropha curcas]
Length=273

 Score =   174 bits (440),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 109/151 (72%), Gaps = 7/151 (5%)
 Frame = -2

Query  576  TAVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
             AV++LRS L  FG     ++S LG RV+GTLFG+RRG VHFAFQ DP   PAFL+ELA 
Sbjct  83   VAVARLRSVLNAFGKNRSNLQSGLGHRVIGTLFGYRRGHVHFAFQRDPISPPAFLIELAT  142

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LVREMASG VRIALEC+   +  ++ K     +LLEEP WRTYCNG+KCGFAARRE
Sbjct  143  PISGLVREMASGLVRIALECD-KEDVKQERKSCSALRLLEEPMWRTYCNGKKCGFAARRE  201

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            CG  DW++L ++ PI+MGAGVLP    DG G
Sbjct  202  CGAKDWKILKAVEPISMGAGVLPEMGADGDG  232


 Score = 78.2 bits (191),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  233  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  273



>gb|EPS63970.1| hypothetical protein M569_10812, partial [Genlisea aurea]
Length=269

 Score =   174 bits (440),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 107/150 (71%), Gaps = 13/150 (9%)
 Frame = -2

Query  573  AVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            AVSKLRSA++         S LG++VVGTLFG RRG VHFAFQED +  PAFLVELA PT
Sbjct  83   AVSKLRSAISMARAKTHFSSGLGSKVVGTLFGHRRGHVHFAFQEDFKQRPAFLVELATPT  142

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
              LV+EMASG VRIALECE  T        KK   LLEEP WRTYCNG+KCG+  RREC 
Sbjct  143  SNLVKEMASGLVRIALECEKKTE-------KKGGSLLEEPIWRTYCNGKKCGYGIRRECS  195

Query  228  PDDWRVLNSIGPITMGAGVL-PGKEDDGIG  142
              +W++L++IGPITMGAGVL P   DDG G
Sbjct  196  ATEWKILSAIGPITMGAGVLPPTTADDGGG  225


 Score = 77.8 bits (190),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERVVGS DSEA+YMM+PDG+GGPELSIYLLR 
Sbjct  229  EMMYMRAKFERVVGSNDSEAYYMMNPDGNGGPELSIYLLRV  269



>ref|XP_002524384.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37995.1| conserved hypothetical protein [Ricinus communis]
Length=255

 Score =   173 bits (438),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            +VSKLRSALT FG+      S L  ++VGT+FG+RRG VH AFQ D +L P FL+ELA P
Sbjct  72   SVSKLRSALTVFGMSRSAYHSGLATKLVGTIFGYRRGHVHLAFQVDVKLNPPFLIELATP  131

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALECE            K  KLL+EP WRTYCNG+KCG+A RREC
Sbjct  132  TSVLVREMASGLVRIALECEKKPQK-------KAGKLLDEPIWRTYCNGKKCGYAMRREC  184

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            GP++W+VL ++ PI+MGAGVLPG
Sbjct  185  GPEEWKVLKAVEPISMGAGVLPG  207


 Score = 77.8 bits (190),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERVVGS+DSEAFYMM+PDG GGPELS+YLLR 
Sbjct  215  ELMYMRARFERVVGSKDSEAFYMMNPDGSGGPELSVYLLRV  255



>ref|XP_009336646.1| PREDICTED: protein MIZU-KUSSEI 1-like [Pyrus x bretschneideri]
Length=265

 Score =   172 bits (437),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 14/150 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            +VSKLRSALT   KS       LG RV+GTLFG+RRG VH AFQ++P+  PAFL+ELA P
Sbjct  80   SVSKLRSALTVFGKSHRSHRPVLGRRVMGTLFGYRRGHVHLAFQDEPKSAPAFLIELATP  139

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALE E            K  KLLEEP WRTYCNG+KCGFA +REC
Sbjct  140  TSVLVREMASGLVRIALETEKKAEK-------KGLKLLEEPLWRTYCNGKKCGFAMKREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            G ++W+VL ++  I+MGAGVLP   DDG+G
Sbjct  193  GGEEWKVLKALEAISMGAGVLPAS-DDGVG  221


 Score = 78.2 bits (191),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV GS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVAGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>ref|XP_008389331.1| PREDICTED: protein MIZU-KUSSEI 1-like [Malus domestica]
Length=265

 Score =   172 bits (437),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 14/150 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            +VSKLRSALT   KS       LG RV+GTLFG+RRG VH AFQ++P+  PAFL+ELA P
Sbjct  80   SVSKLRSALTVFGKSHRSHRPVLGRRVMGTLFGYRRGHVHLAFQDEPKSAPAFLIELATP  139

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALE E            K  KLLEEP WRTYCNG+KCGFA +REC
Sbjct  140  TSVLVREMASGLVRIALETEKKAEK-------KGFKLLEEPLWRTYCNGKKCGFAMKREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            G ++W+VL ++  I+MGAGVLP   DDG+G
Sbjct  193  GGEEWKVLKALEAISMGAGVLPAS-DDGVG  221


 Score = 78.2 bits (191),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV GS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVAGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>gb|KEH38015.1| DUF617 family protein [Medicago truncatula]
Length=259

 Score =   172 bits (435),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 11/149 (7%)
 Frame = -2

Query  582  RKTAVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            R  A+S+LRSALT   K+       LG+RVVGTLFG+RRG VHFAFQ+DP    AFL+EL
Sbjct  69   RAVAISRLRSALTMFSKNRSNTPFGLGSRVVGTLFGYRRGHVHFAFQKDPTSQEAFLIEL  128

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A P   LVREMASG VRIALEC+          +KK  +LLEEP WRTYCNG+KCGFA R
Sbjct  129  ATPISGLVREMASGSVRIALECDKAKEA-----EKKTLRLLEEPQWRTYCNGKKCGFANR  183

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKED  154
            RECG  +W +L ++ PI+MGAGV+PG ++
Sbjct  184  RECGQKEWDILKAVEPISMGAGVIPGTDN  212


 Score = 77.8 bits (190),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  219  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGVPELSIYLLRV  259



>ref|XP_006582045.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=280

 Score =   172 bits (437),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 105/149 (70%), Gaps = 16/149 (11%)
 Frame = -2

Query  576  TAVSKLRSALTF-----------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFL  430
             AVS++RS LT                 LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL
Sbjct  78   VAVSRIRSVLTVFNNNSNNNRSSNSSLGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFL  137

Query  429  VELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGF  250
            +ELA P  VLVREMASG VRIALEC+    T     +KK  +LLEEP WRTYCNG+KCGF
Sbjct  138  IELATPISVLVREMASGLVRIALECDKEKET-----EKKHVRLLEEPLWRTYCNGKKCGF  192

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLPG  163
            A RRECGP DW VL ++ PI+MGAGVLPG
Sbjct  193  ATRRECGPKDWDVLKAVEPISMGAGVLPG  221


 Score = 77.0 bits (188),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  240  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  280



>ref|XP_002311427.2| hypothetical protein POPTR_0008s11360g [Populus trichocarpa]
 gb|EEE88794.2| hypothetical protein POPTR_0008s11360g [Populus trichocarpa]
Length=261

 Score =   172 bits (435),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 106/155 (68%), Gaps = 18/155 (12%)
 Frame = -2

Query  585  RRKT----AVSKLRSALTF-----GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            R+KT    AVSKLRSALT      G  S  G RV+GTLFG+RRG VHF+FQED +  PAF
Sbjct  71   RKKTLPIVAVSKLRSALTVLSGRSGYHS--GTRVIGTLFGYRRGHVHFSFQEDAKQNPAF  128

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA PT +LVREMASG VRIALECE                  EEP WRTYCNG+KCG
Sbjct  129  LIELATPTSILVREMASGLVRIALECEKKAGKKAGKLL-------EEPLWRTYCNGKKCG  181

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            +A RREC P+DW+VL ++ P++MGAGVLPG    G
Sbjct  182  YATRRECRPEDWKVLKAVEPVSMGAGVLPGNGATG  216


 Score = 77.8 bits (190),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA+YERVVGS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  221  EIMYMRARYERVVGSKDSEAFYMMNPDGPGGPELSIYLLRV  261



>ref|XP_010681395.1| PREDICTED: protein MIZU-KUSSEI 1 [Beta vulgaris subsp. vulgaris]
Length=292

 Score =   170 bits (431),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 106/146 (73%), Gaps = 9/146 (6%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            ++K  V+K  S  T       + S LG++VVGTLFG+RRG VH AFQE+P   PAFL+EL
Sbjct  85   KKKLYVTKFTSFFTKSRSSGDVHSSLGSKVVGTLFGYRRGHVHIAFQENPNSTPAFLIEL  144

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            +  T VLVREMASG VR+ALEC+     W+ N KK+  KLLEEP WR YCNG+KCG+A R
Sbjct  145  STQTSVLVREMASGLVRVALECD---KKWD-NNKKEFIKLLEEPLWRAYCNGKKCGYAMR  200

Query  240  RECGPDDWRVLNSIGPITMGAGVLPG  163
            R+CGP +W VL S+GPITMGAGVLP 
Sbjct  201  RDCGPHEWHVLRSVGPITMGAGVLPA  226


 Score = 79.3 bits (194),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGS+DSEAFYMM+PDG+GGPELS YLLR 
Sbjct  252  ELMYMRAKFERIVGSKDSEAFYMMNPDGNGGPELSFYLLRV  292



>ref|XP_011021376.1| PREDICTED: protein MIZU-KUSSEI 1-like [Populus euphratica]
Length=262

 Score =   171 bits (434),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 108/150 (72%), Gaps = 15/150 (10%)
 Frame = -2

Query  585  RRKT----AVSKLRSALTFGIKS----PLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFL  430
            R+KT    AVSKLRSALT   K       G RV+GTLFG+RRG VHF+FQED +  PAFL
Sbjct  71   RKKTLPIVAVSKLRSALTVLSKGRSGYHSGTRVIGTLFGYRRGHVHFSFQEDAKQNPAFL  130

Query  429  VELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGF  250
            +ELA PT +LVREMASG VRIALECE            K  KLLEEP WRTYCNG+KCG+
Sbjct  131  IELATPTSILVREMASGLVRIALECEKKAGK-------KAGKLLEEPLWRTYCNGKKCGY  183

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLPGK  160
            A RREC P+DW+VL ++ P++MGAGVLPG 
Sbjct  184  ATRRECRPEDWKVLKAVEPVSMGAGVLPGN  213


 Score = 78.2 bits (191),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA+YERVVGS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  222  EIMYMRARYERVVGSKDSEAFYMMNPDGPGGPELSIYLLRV  262



>ref|XP_002511997.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50666.1| conserved hypothetical protein [Ricinus communis]
Length=256

 Score =   172 bits (437),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 104/143 (73%), Gaps = 10/143 (7%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++LRS L  FG     +   LG RVVGTLFG+RRG VHFAFQ DP   PAFL+ELA P
Sbjct  68   AVARLRSVLAAFGKNRSSLPHGLGPRVVGTLFGYRRGHVHFAFQRDPNSPPAFLIELATP  127

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+      E    KK  +LLEEP WRTYCNG+KCGFA RREC
Sbjct  128  ISGLVREMASGLVRIALECDKEKEDQE----KKAVRLLEEPMWRTYCNGKKCGFATRREC  183

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            GP +W+VL ++ PI+MGAGVLPG
Sbjct  184  GPKEWKVLKAVEPISMGAGVLPG  206


 Score = 76.6 bits (187),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  216  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  256



>ref|XP_004508591.1| PREDICTED: uncharacterized protein LOC101512123 [Cicer arietinum]
Length=260

 Score =   173 bits (439),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 7/145 (5%)
 Frame = -2

Query  573  AVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            A+S+LRS LT FG         LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+ELA P
Sbjct  70   AISRLRSVLTVFGKNRSNLPFGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIELATP  129

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+   N  EK  +KK  +LL+EP WRTYCNG+KCGFA RREC
Sbjct  130  ISGLVREMASGLVRIALECDKVVNK-EKEGEKKSLRLLQEPVWRTYCNGKKCGFANRREC  188

Query  231  GPDDWRVLNSIGPITMGAGVLPGKE  157
            G  DW +L ++ PI+MGAGVLP  E
Sbjct  189  GEKDWDILKAVEPISMGAGVLPSAE  213


 Score = 75.1 bits (183),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  220  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  260



>ref|XP_004488352.1| PREDICTED: uncharacterized protein LOC101507963 [Cicer arietinum]
Length=263

 Score =   171 bits (432),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 111/151 (74%), Gaps = 11/151 (7%)
 Frame = -2

Query  582  RKTAVSKLRSALT-FG---IKSP--LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            R  A+S+LR ALT FG   + +P  LG+RV+GTLFG+RRG VHFAFQ+DP    AFL+EL
Sbjct  70   RAVAISRLRLALTVFGKNRLNTPFGLGSRVIGTLFGYRRGHVHFAFQKDPTSQEAFLIEL  129

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A P   LVREMASG VRIALEC       +K  +KK  +LLEEP WRTYCNG+KCGFA R
Sbjct  130  ATPISGLVREMASGLVRIALEC-----NKQKEAEKKGLRLLEEPLWRTYCNGKKCGFATR  184

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            RECGP +W +L ++ PI+MGAGV+PG ++  
Sbjct  185  RECGPKEWDILKAVEPISMGAGVIPGNDNSA  215


 Score = 77.8 bits (190),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  223  ELMYMRAKFERVVGSRDSEAFYMMNPDSNGVPELSIYLLRV  263



>ref|XP_008339717.1| PREDICTED: protein MIZU-KUSSEI 1 [Malus domestica]
Length=265

 Score =   170 bits (431),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 108/150 (72%), Gaps = 14/150 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            +VSKLRSALT   KS       LG RV+GTLFG+RRG VH AFQ++P+  PAFL+ELA P
Sbjct  80   SVSKLRSALTVFGKSHRSQRPVLGRRVMGTLFGYRRGHVHLAFQDEPKSPPAFLIELATP  139

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VR+ALE E            K  KLLEEP WRTYCNG+KCGFA +REC
Sbjct  140  TSVLVREMASGLVRVALETEKKAEX-------KGLKLLEEPLWRTYCNGKKCGFAMKREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            G ++W+VL ++  I+MGAGVLP   DDG+G
Sbjct  193  GGEEWKVLKALEAISMGAGVLPAS-DDGVG  221


 Score = 77.8 bits (190),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV GS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVAGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>ref|XP_002272298.2| PREDICTED: protein MIZU-KUSSEI 1 [Vitis vinifera]
Length=269

 Score =   169 bits (429),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 104/144 (72%), Gaps = 13/144 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AVS+LRS LT FG     +   LG RVVGTLFG RRG VHFAFQ+DP   PAFL+ELA P
Sbjct  84   AVSRLRSVLTIFGRNRSQLPHGLGPRVVGTLFGNRRGHVHFAFQKDPTSQPAFLIELATP  143

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+           KK  +LLEEP WRTYCNG+KCGFA +REC
Sbjct  144  ISGLVREMASGLVRIALECDKEEE-------KKSVRLLEEPLWRTYCNGKKCGFATKREC  196

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP +W VL ++ PI+MGAGVLPG+
Sbjct  197  GPKEWNVLKAVEPISMGAGVLPGE  220


 Score = 78.2 bits (191),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV+GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  229  ELMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSIYLLRV  269



>ref|XP_009356069.1| PREDICTED: protein MIZU-KUSSEI 1 [Pyrus x bretschneideri]
Length=265

 Score =   170 bits (430),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 108/150 (72%), Gaps = 14/150 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            +VSKLRSALT   KS       LG RV+GTLFG+RRG VH AFQ++P+  PAFL+ELA P
Sbjct  80   SVSKLRSALTVFGKSHRSHRPVLGRRVMGTLFGYRRGHVHLAFQDEPKSPPAFLIELATP  139

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VR+ALE E            K  KLLEEP WRTYCNG+KCGFA +REC
Sbjct  140  TSVLVREMASGLVRVALETEKKAEK-------KGLKLLEEPLWRTYCNGKKCGFAMKREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            G ++W+VL ++  I+MGAGVLP   DDG+G
Sbjct  193  GGEEWKVLKALEAISMGAGVLPAS-DDGVG  221


 Score = 77.8 bits (190),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV GS+DSEAFYMM+PDG GGPELSIYLLR 
Sbjct  225  ELMYMRAKFERVAGSKDSEAFYMMNPDGSGGPELSIYLLRV  265



>ref|XP_010096715.1| hypothetical protein L484_025833 [Morus notabilis]
 gb|EXB65567.1| hypothetical protein L484_025833 [Morus notabilis]
Length=669

 Score =   180 bits (456),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG +VVGTLFG RRG VHFAFQE+ +L PAFL+ELAMPT VLVREMASG VRIALECE  
Sbjct  109  LGTKVVGTLFGHRRGHVHFAFQEEAKLSPAFLIELAMPTSVLVREMASGLVRIALECEKK  168

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            T T    +K K  KL+EEP WRTYCNG+KCGFA+R ECGP++W+VL ++GPI+MGAGVLP
Sbjct  169  T-TAIATEKMKPVKLIEEPVWRTYCNGKKCGFASRIECGPEEWKVLRAVGPISMGAGVLP  227

Query  165  GKEDDGIG  142
            G ++ G G
Sbjct  228  GCDNGGGG  235


 Score = 67.8 bits (164),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSI  26
            E+MYMRA++ERVVGS+DSEAFYMM+PDG GGPEL++
Sbjct  239  EIMYMRARFERVVGSKDSEAFYMMNPDGSGGPELNL  274



>ref|XP_006602419.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=278

 Score =   171 bits (433),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 106/150 (71%), Gaps = 14/150 (9%)
 Frame = -2

Query  582  RKTAVSKLRSALTFGIKSP----------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            +  AVS++RS LT   K+           LG+RVVGTLFG+R G VHFAFQ+DP   PAF
Sbjct  76   QAVAVSRIRSVLTVFNKNKNNNRSNSALGLGSRVVGTLFGYRLGHVHFAFQKDPTSQPAF  135

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA P  VLVREMASG VRIALEC G     EK +  +   LLEEP WRTYCNG+KCG
Sbjct  136  LIELATPISVLVREMASGLVRIALEC-GKEKGAEKKQHVR---LLEEPVWRTYCNGKKCG  191

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA RRECGP DW +L ++ PI+MGAGVLPG
Sbjct  192  FATRRECGPKDWDILKAVEPISMGAGVLPG  221


 Score = 76.6 bits (187),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  238  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  278



>emb|CBI15396.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   169 bits (427),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 104/144 (72%), Gaps = 13/144 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AVS+LRS LT FG     +   LG RVVGTLFG RRG VHFAFQ+DP   PAFL+ELA P
Sbjct  69   AVSRLRSVLTIFGRNRSQLPHGLGPRVVGTLFGNRRGHVHFAFQKDPTSQPAFLIELATP  128

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+           KK  +LLEEP WRTYCNG+KCGFA +REC
Sbjct  129  ISGLVREMASGLVRIALECDKEEE-------KKSVRLLEEPLWRTYCNGKKCGFATKREC  181

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP +W VL ++ PI+MGAGVLPG+
Sbjct  182  GPKEWNVLKAVEPISMGAGVLPGE  205


 Score = 78.6 bits (192),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERV+GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  214  ELMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSIYLLRV  254



>gb|KHN15653.1| hypothetical protein glysoja_045736 [Glycine soja]
Length=267

 Score =   170 bits (431),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 106/150 (71%), Gaps = 14/150 (9%)
 Frame = -2

Query  582  RKTAVSKLRSALTFGIKSP----------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            +  AVS++RS LT   K+           LG+RVVGTLFG+R G VHFAFQ+DP   PAF
Sbjct  65   QAVAVSRIRSVLTVFNKNKNNNRSNSALGLGSRVVGTLFGYRLGHVHFAFQKDPTSQPAF  124

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA P  VLVREMASG VRIALEC G     EK +  +   LLEEP WRTYCNG+KCG
Sbjct  125  LIELATPISVLVREMASGLVRIALEC-GKEKGAEKKQHVR---LLEEPVWRTYCNGKKCG  180

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA RRECGP DW +L ++ PI+MGAGVLPG
Sbjct  181  FATRRECGPKDWDILKAVEPISMGAGVLPG  210


 Score = 76.3 bits (186),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  227  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  267



>gb|KJB51115.1| hypothetical protein B456_008G201700 [Gossypium raimondii]
Length=257

 Score =   169 bits (427),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            TA  K RS   FG    LG RVVGTLFG RRG VHFAFQ++P   PAFLVELA P  VLV
Sbjct  78   TAFGKNRSNPPFG--GLLGPRVVGTLFGSRRGHVHFAFQKEPNSPPAFLVELATPISVLV  135

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALEC+   N  +     K  +LLEEP WRTYCNG+KCGFA RR+CGP +W
Sbjct  136  REMASGLVRIALECDKKDNEEK-----KAVRLLEEPVWRTYCNGKKCGFATRRDCGPKEW  190

Query  216  RVLNSIGPITMGAGVLPGKEDDG  148
            ++L ++ PI+MGAGVLP  E + 
Sbjct  191  KILKAVEPISMGAGVLPLTEPEA  213


 Score = 77.8 bits (190),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER++GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  217  ELMYMRAKFERIIGSRDSEAFYMMNPDSNGAPELSIYLLRV  257



>ref|XP_007037756.1| Dr1 [Theobroma cacao]
 gb|EOY22257.1| Dr1 [Theobroma cacao]
Length=249

 Score =   169 bits (428),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 102/138 (74%), Gaps = 9/138 (7%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            TA  K RS+L FG    LG RVVGTLFG+RRG VHFAFQ+DP   PAFLVELA P   LV
Sbjct  71   TAFGKNRSSLPFG----LGPRVVGTLFGYRRGHVHFAFQKDPNSPPAFLVELATPISGLV  126

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALEC+          +KK  +LLEEP WRTYCNG+KCGFA RRECG  +W
Sbjct  127  REMASGLVRIALECDKEKEE-----EKKAVRLLEEPVWRTYCNGKKCGFATRRECGAKEW  181

Query  216  RVLNSIGPITMGAGVLPG  163
            ++L ++ PI+MGAGVLPG
Sbjct  182  KILKAVEPISMGAGVLPG  199


 Score = 77.0 bits (188),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  209  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSIYLLRV  249



>ref|XP_003549815.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=282

 Score =   170 bits (430),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            T  SK RS L FG    LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+ELA P   LV
Sbjct  106  TVFSKNRSNLPFG----LGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIELATPISGLV  161

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALEC+ + ++ +    KK  +LL+E  WRTYCNG+KCGFA RRECG  DW
Sbjct  162  REMASGLVRIALECDKDRDSEK----KKTLRLLQESVWRTYCNGKKCGFATRRECGAKDW  217

Query  216  RVLNSIGPITMGAGVLPGKE  157
             +L ++ PI+MGAGVLP  +
Sbjct  218  DILKAVEPISMGAGVLPNSD  237


 Score = 76.3 bits (186),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  242  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  282



>gb|KDP29344.1| hypothetical protein JCGZ_18265 [Jatropha curcas]
Length=258

 Score =   169 bits (429),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 10/140 (7%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPL---GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
            AVSK+RSALT   KS     G +++GTLFG+RRG VHFAFQ D ++ P FL++LA PT V
Sbjct  78   AVSKIRSALTVISKSHHSGSGTKLIGTLFGYRRGHVHFAFQGDTKINPGFLIQLATPTSV  137

Query  402  LVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPD  223
            LVREMASG VRIALECE            +  KLL+EP WRTYCNG+K G+A RRECGP+
Sbjct  138  LVREMASGLVRIALECEKKQQK-------RPGKLLDEPLWRTYCNGKKSGYAIRRECGPE  190

Query  222  DWRVLNSIGPITMGAGVLPG  163
            +W+VL ++ PI+MGAGVLPG
Sbjct  191  EWKVLKAVEPISMGAGVLPG  210


 Score = 75.9 bits (185),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERVVGS+DSEAFYMM+PDG G PELS+YLLR 
Sbjct  218  ELMYMRARFERVVGSKDSEAFYMMNPDGSGCPELSVYLLRV  258



>ref|XP_003518832.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=281

 Score =   166 bits (421),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 96/135 (71%), Gaps = 9/135 (7%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            L  RV+GTLFG RR  V+FAFQEDP+LGP FLV+LA  T  LVREMASG VRIALECE  
Sbjct  111  LDMRVMGTLFGHRRDHVYFAFQEDPKLGPTFLVKLATRTSTLVREMASGLVRIALECEKK  170

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
             N         K +LLEEP WRTYCNGRKCG+A RRECGP +W++L ++ PI+MGAGVLP
Sbjct  171  KNA------TAKVRLLEEPLWRTYCNGRKCGYANRRECGPHEWKILKAVEPISMGAGVLP  224

Query  165  ---GKEDDGIGPTAS  130
               G E  G    AS
Sbjct  225  VVCGNEAAGSEEEAS  239


 Score = 79.3 bits (194),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAKYERVVGSRDSEAFYMM+PD  GGPELSIYL+R 
Sbjct  241  EVMYMRAKYERVVGSRDSEAFYMMNPDASGGPELSIYLIRV  281



>ref|XP_003524508.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
 gb|KHN15165.1| hypothetical protein glysoja_011783 [Glycine soja]
Length=272

 Score =   169 bits (428),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 106/151 (70%), Gaps = 9/151 (6%)
 Frame = -2

Query  582  RKTAVSKLRSALTFGIKSP-------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
            +  A+S+LRS LT   K+        LG+RVVGTLFG+RRG VHFAFQ DP   PAFL+E
Sbjct  77   QAVAISRLRSVLTVFSKNHRSNLPFGLGSRVVGTLFGYRRGHVHFAFQRDPTSQPAFLIE  136

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaK--LLEEPAWRTYCNGRKCGF  250
            LA P   LVREMASG VRIALEC+ + ++ EK   KK     LL+E  WRTYCNG+KCGF
Sbjct  137  LATPISGLVREMASGLVRIALECDKDKDSEEKKTTKKNKTLRLLQESVWRTYCNGKKCGF  196

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLPGKE  157
            A RRECG  DW +L ++ PI+MGAGVLP  +
Sbjct  197  ATRRECGAKDWDILKAVEPISMGAGVLPNSD  227


 Score = 75.5 bits (184),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  232  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  272



>ref|XP_003609136.1| hypothetical protein MTR_4g112370 [Medicago truncatula]
Length=322

 Score =   168 bits (425),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -2

Query  582  RKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            +  A+S++RS LT        + S LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+EL
Sbjct  64   QTVAISRIRSVLTVFSKNRSNLPSGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIEL  123

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A P   LVREMASG VRIALEC+          +KK  +LL+EP WRTYCNG+KCGF  R
Sbjct  124  ATPISGLVREMASGLVRIALECDKVKEK---EGEKKSLRLLQEPLWRTYCNGKKCGFGNR  180

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKE  157
            RECG  DW +L ++ PI+MGAGVLPG E
Sbjct  181  RECGEKDWEILKAVEPISMGAGVLPGGE  208


 Score = 76.3 bits (186),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELS+YLLRA
Sbjct  215  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRA  255



>ref|XP_010110773.1| hypothetical protein L484_022271 [Morus notabilis]
 gb|EXC28038.1| hypothetical protein L484_022271 [Morus notabilis]
Length=275

 Score =   167 bits (422),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            TA  + RS+L FG    LG RVVGTLFG RRG VHFAFQ+DP   PAFL+ELA P   LV
Sbjct  97   TAFGRNRSSLPFG----LGPRVVGTLFGSRRGHVHFAFQKDPNSQPAFLIELATPISGLV  152

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            +EMASG VRIALEC+          +KK  +LLEEP WRTYCNG+KCGFA RR+CG  +W
Sbjct  153  KEMASGLVRIALECDKEKEE-----EKKGVRLLEEPVWRTYCNGKKCGFATRRDCGAKEW  207

Query  216  RVLNSIGPITMGAGVLPGKEDDG  148
            ++L ++ PI+MGAGVLPG ED+ 
Sbjct  208  KILKAVEPISMGAGVLPGIEDEA  230


 Score = 77.0 bits (188),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  235  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  275



>ref|XP_006440890.1| hypothetical protein CICLE_v10021702mg [Citrus clementina]
 gb|ESR54130.1| hypothetical protein CICLE_v10021702mg [Citrus clementina]
 gb|KDO65558.1| hypothetical protein CISIN_1g044800mg [Citrus sinensis]
Length=267

 Score =   167 bits (422),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 107/148 (72%), Gaps = 11/148 (7%)
 Frame = -2

Query  573  AVSKLRSAL-TFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++LR+ L TFG     +   LG RV GTLFG +RG VHFAFQ+DP   PAFLVELA P
Sbjct  78   AVARLRTVLSTFGKHRSNLPLGLGPRVTGTLFGSKRGHVHFAFQKDPNSPPAFLVELATP  137

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+      EK  +KK  +LLEEP WRTYCNG+KCGFA RREC
Sbjct  138  ISGLVREMASGLVRIALECDK-----EKEDEKKAVRLLEEPMWRTYCNGKKCGFATRREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            G  +W+VL ++ PI+MGAGVLPG  D+ 
Sbjct  193  GAKEWKVLKAVEPISMGAGVLPGTGDEA  220


 Score = 76.6 bits (187),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  227  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSVYLLRV  267



>ref|XP_011008958.1| PREDICTED: protein MIZU-KUSSEI 1 [Populus euphratica]
Length=249

 Score =   166 bits (419),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVR  394
            A+ K RS+L  G    LG+RVVGTLFG+RRG VHFAFQ DP   P FL+ELA P   LVR
Sbjct  72   ALGKNRSSLPMG----LGSRVVGTLFGYRRGHVHFAFQRDPNSPPTFLIELATPISGLVR  127

Query  393  EMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            EMASG VRIALEC+      EK  +KK  KLLEEP WRTYCNG++CGFA R+ECG  +W+
Sbjct  128  EMASGLVRIALECDK-----EKEDQKKAVKLLEEPMWRTYCNGKRCGFATRKECGHKEWK  182

Query  213  VLNSIGPITMGAGVLPG  163
            VL ++ PI+MGAGVLPG
Sbjct  183  VLKAVEPISMGAGVLPG  199


 Score = 77.8 bits (190),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  209  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  249



>ref|XP_011008762.1| PREDICTED: protein MIZU-KUSSEI 1 [Populus euphratica]
Length=263

 Score =   173 bits (438),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 109/152 (72%), Gaps = 17/152 (11%)
 Frame = -2

Query  585  RRKT----AVSKLRSALTFGIKS------PLGARVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            R+KT    A SKLRSALT   KS       LG RVVGTLFG+RRG VHFAFQED +  PA
Sbjct  70   RKKTLPILAFSKLRSALTVFSKSRSAYHSGLGTRVVGTLFGYRRGHVHFAFQEDAKQNPA  129

Query  435  FLVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKC  256
             L+ELA PT VLVREMASG VRIALECE            K  KLLEEP WRTYCNG+KC
Sbjct  130  LLIELATPTSVLVREMASGLVRIALECEKKAGK-------KAGKLLEEPLWRTYCNGKKC  182

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLPGK  160
            G+A+RREC P+DW+VL ++ P++MGAGVLPG 
Sbjct  183  GYASRRECRPEDWKVLKAVEPVSMGAGVLPGN  214


 Score = 70.1 bits (170),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELM MRA  ERVVGS+DSEAFYMM+PDG GGPELS YLLR 
Sbjct  223  ELMNMRAGIERVVGSKDSEAFYMMNPDGSGGPELSFYLLRV  263



>ref|XP_006374348.1| hypothetical protein POPTR_0015s06300g [Populus trichocarpa]
 gb|ERP52145.1| hypothetical protein POPTR_0015s06300g [Populus trichocarpa]
Length=248

 Score =   165 bits (418),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 102/137 (74%), Gaps = 9/137 (7%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVR  394
            A+ K RS+L  G    LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+ELA P   LVR
Sbjct  71   ALGKNRSSLPLG----LGSRVVGTLFGYRRGHVHFAFQKDPNSPPAFLIELATPISGLVR  126

Query  393  EMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            EMASG VRIALEC+          +KK  +L EEP WRTYCNG+KCGFA R+ECGP +W+
Sbjct  127  EMASGLVRIALECDKEKEE-----EKKAVRLQEEPMWRTYCNGKKCGFATRKECGPKEWK  181

Query  213  VLNSIGPITMGAGVLPG  163
            +L ++ PI+MGAGVLPG
Sbjct  182  LLKAVEPISMGAGVLPG  198


 Score = 77.8 bits (190),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  208  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  248



>ref|XP_008800890.1| PREDICTED: protein MIZU-KUSSEI 1-like [Phoenix dactylifera]
Length=265

 Score =   167 bits (422),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 102/144 (71%), Gaps = 8/144 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             AVS+LRS LT  I      + LG RV GTLFG RRG VHFAFQ DPR  PA L+ELA P
Sbjct  79   VAVSRLRSVLTAAIAGRRRPAGLGPRVTGTLFGHRRGHVHFAFQVDPRSCPALLIELATP  138

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE   +      ++   KL+EEP WR YCNG+KCG+A RR+C
Sbjct  139  TSALVREMASGLVRIALECERRGSG---GGRRAGGKLVEEPLWRAYCNGKKCGYAVRRQC  195

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP DWRVL ++ P++MGAGVLPG 
Sbjct  196  GPADWRVLRAVEPVSMGAGVLPGD  219


 Score = 75.9 bits (185),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEAFYMM+PD +GGPELSIYLLR 
Sbjct  225  EMMYMRARFERVVGSKDSEAFYMMNPDSNGGPELSIYLLRV  265



>gb|AES91333.2| DUF617 family protein [Medicago truncatula]
Length=260

 Score =   168 bits (426),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 105/148 (71%), Gaps = 9/148 (6%)
 Frame = -2

Query  582  RKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            +  A+S++RS LT        + S LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+EL
Sbjct  69   QTVAISRIRSVLTVFSKNRSNLPSGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIEL  128

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A P   LVREMASG VRIALEC+          +KK  +LL+EP WRTYCNG+KCGF  R
Sbjct  129  ATPISGLVREMASGLVRIALECDKVKEK---EGEKKSLRLLQEPLWRTYCNGKKCGFGNR  185

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKE  157
            RECG  DW +L ++ PI+MGAGVLPG E
Sbjct  186  RECGEKDWEILKAVEPISMGAGVLPGGE  213


 Score = 74.7 bits (182),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  220  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  260



>ref|XP_007155168.1| hypothetical protein PHAVU_003G179200g [Phaseolus vulgaris]
 gb|ESW27162.1| hypothetical protein PHAVU_003G179200g [Phaseolus vulgaris]
Length=266

 Score =   167 bits (422),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 107/152 (70%), Gaps = 13/152 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            A+S+LRS LT FG         LG+RVVGTLFG+RRG VHFAFQ+DP   PAF++ELA P
Sbjct  79   AISRLRSVLTVFGKNRSNLPFGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFVIELATP  138

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+ +  + +     K  +LL+E  WRTYCNG+KCGFA RREC
Sbjct  139  ITGLVREMASGLVRIALECDKDKESEK-----KSLRLLQESVWRTYCNGKKCGFATRREC  193

Query  231  GPDDWRVLNSIGPITMGAGVLP--GKEDDGIG  142
            G  DW +L ++ PI+MGAGVLP   K D G G
Sbjct  194  GAKDWEILKAVEPISMGAGVLPVSNKSDGGDG  225


 Score = 75.9 bits (185),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  226  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  266



>gb|ACJ84318.1| unknown [Medicago truncatula]
 gb|AFK45849.1| unknown [Medicago truncatula]
Length=255

 Score =   166 bits (421),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 104/148 (70%), Gaps = 9/148 (6%)
 Frame = -2

Query  582  RKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            +  A+S++RS LT        + S LG+RVVGTLFG+RRG VHFAFQ+DP   PAFL+EL
Sbjct  64   QTVAISRIRSVLTVFSKNRSNLPSGLGSRVVGTLFGYRRGHVHFAFQKDPTSQPAFLIEL  123

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A P   LVREMASG VRI LEC+          +KK  +LL+EP WRTYCNG+KCGF  R
Sbjct  124  ATPISGLVREMASGLVRIVLECDKVKEK---EGEKKSLRLLQEPLWRTYCNGKKCGFGNR  180

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKE  157
            RECG  DW +L ++ PI+MGAGVLPG E
Sbjct  181  RECGEKDWEILKAVEPISMGAGVLPGGE  208


 Score = 74.7 bits (182),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  215  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  255



>ref|XP_008801965.1| PREDICTED: protein MIZU-KUSSEI 1 [Phoenix dactylifera]
Length=262

 Score =   165 bits (418),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 96/144 (67%), Gaps = 12/144 (8%)
 Frame = -2

Query  576  TAVSKLRSALTFGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             AVS+ RS +   I        LG RV GTLFG RRG VHFAFQ DPR  PA L+ELA P
Sbjct  78   VAVSRFRSVIAAAIARRHRLGGLGPRVTGTLFGHRRGHVHFAFQVDPRSCPALLIELATP  137

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE               KLLEEP WR YCNG+KCG+A RREC
Sbjct  138  TSTLVREMASGLVRIALECERRDGK-------AAGKLLEEPLWRAYCNGKKCGYAVRREC  190

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP DWRVL ++ P++MGAGVLPG 
Sbjct  191  GPADWRVLRAVEPVSMGAGVLPGD  214


 Score = 75.9 bits (185),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+MYMRA++ERVVGS+DSEAFYMM+PD +GGPELSIYLLR
Sbjct  222  EMMYMRARFERVVGSKDSEAFYMMNPDNNGGPELSIYLLR  261



>ref|XP_004138221.1| PREDICTED: uncharacterized protein LOC101214386 [Cucumis sativus]
 ref|XP_004154934.1| PREDICTED: uncharacterized LOC101214386 [Cucumis sativus]
 gb|KGN63789.1| hypothetical protein Csa_1G015810 [Cucumis sativus]
Length=262

 Score =   162 bits (411),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 106/152 (70%), Gaps = 8/152 (5%)
 Frame = -2

Query  582  RKTAVSKLRSALTF-----GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA  418
            ++ A+S+ RS LT        +  L +RVVGTLFG RRG VHFAFQ DP   PAFL+ELA
Sbjct  64   QQLAISRFRSVLTALGRNRNSQHGLRSRVVGTLFGSRRGHVHFAFQRDPNSHPAFLIELA  123

Query  417  MPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR  238
             P   LV+EMASG VRIALEC+   +    NKK    +LLEEP WRT+CNG+KCGFA+RR
Sbjct  124  TPISGLVKEMASGLVRIALECDKEKDE---NKKPPGRRLLEEPVWRTFCNGKKCGFASRR  180

Query  237  ECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            ECGP + ++L ++ PI+MGAGVLP  ED  + 
Sbjct  181  ECGPKELKILKAVEPISMGAGVLPVNEDAKVS  212


 Score = 78.2 bits (191),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  222  EIMYMRAKFERVVGSRDSEAFYMMNPDSNGAPELSIYLLRV  262



>ref|XP_009617994.1| PREDICTED: protein MIZU-KUSSEI 1 [Nicotiana tomentosiformis]
Length=279

 Score =   162 bits (409),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 104/143 (73%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++L+S LT FG      +  LG RVVGTLFG +RG VHFAFQ+D    PAFLVELA P
Sbjct  93   AVARLKSVLTSFGRNRTNFQQGLGTRVVGTLFGHKRGHVHFAFQKDSTSQPAFLVELATP  152

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC       +K ++KK  +L +EP WRTYCNG+KCGFA RREC
Sbjct  153  ISGLVREMASGLVRIALEC-------DKEEEKKATRLTDEPIWRTYCNGKKCGFANRREC  205

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            GP + ++L ++ PI+MGAGVLPG
Sbjct  206  GPKEMQILKAVEPISMGAGVLPG  228


 Score = 79.0 bits (193),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERV+GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  239  EIMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSIYLLRV  279



>ref|XP_004135413.1| PREDICTED: uncharacterized protein LOC101215336 [Cucumis sativus]
 gb|KGN52034.1| hypothetical protein Csa_5G608220 [Cucumis sativus]
Length=258

 Score =   165 bits (417),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 13/142 (9%)
 Frame = -2

Query  570  VSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            VSKLR+ALT          +S LG RV+GTL+G+RRG V+FA QEDP+  P FL+EL+ P
Sbjct  75   VSKLRTALTVFSRIRPTHHRSRLGGRVIGTLYGYRRGHVYFALQEDPKQSPTFLIELSTP  134

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALECE  T       +KK  KL+EE  WRTYCNG+KCG+ +RREC
Sbjct  135  TSVLVREMASGLVRIALECEKKTE------RKKNCKLVEEALWRTYCNGKKCGYGSRREC  188

Query  231  GPDDWRVLNSIGPITMGAGVLP  166
            G ++ ++L ++ PITMGAGVLP
Sbjct  189  GTEEQKILKAVEPITMGAGVLP  210


 Score = 75.5 bits (184),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERV+GS+DSEA+YMMSPD + GPELSIYLLR 
Sbjct  218  ELMYMRARFERVIGSKDSEAYYMMSPDCNAGPELSIYLLRV  258



>ref|XP_004168743.1| PREDICTED: uncharacterized LOC101215336 [Cucumis sativus]
Length=256

 Score =   165 bits (417),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 13/142 (9%)
 Frame = -2

Query  570  VSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            VSKLR+ALT          +S LG RV+GTL+G+RRG V+FA QEDP+  P FL+EL+ P
Sbjct  73   VSKLRTALTVFSRIRPTHHRSRLGGRVIGTLYGYRRGHVYFALQEDPKQSPTFLIELSTP  132

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALECE  T       +KK  KL+EE  WRTYCNG+KCG+ +RREC
Sbjct  133  TSVLVREMASGLVRIALECEKKTE------RKKNCKLVEEALWRTYCNGKKCGYGSRREC  186

Query  231  GPDDWRVLNSIGPITMGAGVLP  166
            G ++ ++L ++ PITMGAGVLP
Sbjct  187  GTEEQKILKAVEPITMGAGVLP  208


 Score = 75.5 bits (184),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERV+GS+DSEA+YMMSPD + GPELSIYLLR 
Sbjct  216  ELMYMRARFERVIGSKDSEAYYMMSPDCNAGPELSIYLLRV  256



>ref|XP_010924207.1| PREDICTED: protein MIZU-KUSSEI 1-like [Elaeis guineensis]
Length=267

 Score =   166 bits (421),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 101/143 (71%), Gaps = 8/143 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             AVS+ RS LT  I      + LG RV+GTLFG RRG VHFAFQ DPR  PA L+ELA P
Sbjct  81   VAVSRFRSVLTAAIAGRRRPAGLGPRVIGTLFGHRRGHVHFAFQVDPRSCPALLIELATP  140

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE          +K   KL+EEP WR YCNG+KCG+A RR+C
Sbjct  141  TSTLVREMASGLVRIALECE---RRGSGGGRKAAGKLVEEPLWRAYCNGKKCGYAVRRQC  197

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            GP DWRVL ++ P++MGAGVLPG
Sbjct  198  GPADWRVLRAVQPVSMGAGVLPG  220


 Score = 73.2 bits (178),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEA YMM+PD +GGPELSIYLLR 
Sbjct  227  EMMYMRARFERVVGSKDSEALYMMNPDSNGGPELSIYLLRV  267



>ref|XP_009764631.1| PREDICTED: protein MIZU-KUSSEI 1 [Nicotiana sylvestris]
Length=279

 Score =   161 bits (407),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++L+S LT        ++  LG RVVGTLFG +RG VHFAFQ+D    PAFLVELA P
Sbjct  93   AVARLKSVLTSLGRNRGNLQQGLGTRVVGTLFGHKRGHVHFAFQKDSTSQPAFLVELATP  152

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LV+EMASG VRIALEC       +K ++KK  +L +EP WRTYCNG+KCGFA RREC
Sbjct  153  ISGLVQEMASGLVRIALEC-------DKEEEKKATRLTDEPIWRTYCNGKKCGFANRREC  205

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            GP + ++L ++ PI+MGAGVLPG
Sbjct  206  GPKELQILKAVEPISMGAGVLPG  228


 Score = 78.2 bits (191),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERV+GSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  239  EIMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSVYLLRV  279



>ref|XP_008453350.1| PREDICTED: protein MIZU-KUSSEI 1 [Cucumis melo]
Length=266

 Score =   162 bits (411),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 8/148 (5%)
 Frame = -2

Query  582  RKTAVSKLRSALTF-----GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA  418
            ++ AVS+ RS LT        +  L +RVVGTLFG RRG VHFAFQ DP   PAFL+ELA
Sbjct  64   QQLAVSRFRSVLTALGRNRNSQHGLRSRVVGTLFGSRRGHVHFAFQRDPNSNPAFLIELA  123

Query  417  MPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR  238
             P   LV+EMASG VRIALEC+   +    NKK    +LLEEP WRT+CNG+KCGFA+RR
Sbjct  124  TPISGLVKEMASGLVRIALECDKEKDE---NKKPPGRRLLEEPVWRTFCNGKKCGFASRR  180

Query  237  ECGPDDWRVLNSIGPITMGAGVLPGKED  154
            ECGP + ++L ++ PI+MGAGVLP  ED
Sbjct  181  ECGPKELKILKAVEPISMGAGVLPVNED  208


 Score = 76.6 bits (187),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  226  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  266



>ref|XP_008244055.1| PREDICTED: protein MIZU-KUSSEI 1-like [Prunus mume]
 ref|XP_008244061.1| PREDICTED: protein MIZU-KUSSEI 1 [Prunus mume]
Length=279

 Score =   161 bits (408),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 106/150 (71%), Gaps = 11/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS+LRS LT FG         LG RVVGTLFG RRG VHFAFQ DP   PAF
Sbjct  79   RRKLQAAAVSRLRSVLTAFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFAFQRDPNSQPAF  138

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA P   LVREMASG VRIALEC+ +       KK K  +LLEEP WRT+CNG+K G
Sbjct  139  LIELATPISGLVREMASGLVRIALECDKDKEE--MKKKDKALRLLEEPVWRTFCNGKKYG  196

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA+RRECGP +W+VL ++ PI+MGAGVLP 
Sbjct  197  FASRRECGPKEWKVLKAVEPISMGAGVLPA  226


 Score = 77.8 bits (190),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  239  ELMYMRAKFERVVGSRDSEAFYMMNPDSNGAPELSIYLLRV  279



>ref|XP_004236101.1| PREDICTED: protein MIZU-KUSSEI 1 [Solanum lycopersicum]
Length=281

 Score =   160 bits (404),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++L+S LT FG      +  LG RVVGTLFG RRG VHFAFQ+D    PAFLVELA P
Sbjct  95   AVARLKSVLTAFGRNRSNFQQGLGTRVVGTLFGHRRGHVHFAFQKDSTSQPAFLVELATP  154

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC       +K ++KK ++L++EP WRTYCNG+KCGFA RRE 
Sbjct  155  ISGLVREMASGLVRIALEC-------DKEEEKKVSRLIDEPVWRTYCNGKKCGFATRREI  207

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            G  + ++L ++ PI+MGAGVLPG
Sbjct  208  GAKELQILKAVEPISMGAGVLPG  230


 Score = 79.3 bits (194),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERV+GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  241  EIMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSIYLLRV  281



>ref|XP_002317922.1| hypothetical protein POPTR_0012s05480g [Populus trichocarpa]
 gb|EEE96142.1| hypothetical protein POPTR_0012s05480g [Populus trichocarpa]
Length=249

 Score =   161 bits (408),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 103/143 (72%), Gaps = 9/143 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
             A+ K RS+L  G    LG+RVVGTLFG+RRG VHFAFQ DP   P FL+ELA P   LV
Sbjct  71   AALGKNRSSLPMG----LGSRVVGTLFGYRRGHVHFAFQRDPNSPPTFLIELATPISGLV  126

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALEC+      EK  +KK  KLLEEP WRTYCNG++ GFA R+ECG  +W
Sbjct  127  REMASGLVRIALECDK-----EKEDQKKAVKLLEEPMWRTYCNGKRRGFATRKECGHKEW  181

Query  216  RVLNSIGPITMGAGVLPGKEDDG  148
            +VL ++ PI+MGAGVLPG   +G
Sbjct  182  KVLKAVEPISMGAGVLPGCAAEG  204


 Score = 77.8 bits (190),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  209  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  249



>ref|XP_007209453.1| hypothetical protein PRUPE_ppa009748mg [Prunus persica]
 gb|EMJ10652.1| hypothetical protein PRUPE_ppa009748mg [Prunus persica]
Length=279

 Score =   161 bits (408),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 107/150 (71%), Gaps = 11/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS+LRS LT FG         LG RVVGTLFG RRG VHFAFQ DP   PAF
Sbjct  79   RRKLQAAAVSRLRSVLTAFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFAFQRDPNSQPAF  138

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            L+ELA P   LVREMASG VRIALEC  + +  E  KK K  +LLEEP WRT+CNG+K G
Sbjct  139  LIELATPISGLVREMASGLVRIALEC--DKDKEEMKKKDKALRLLEEPVWRTFCNGKKYG  196

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA+RRECGP +W+VL ++ PI+MGAGVLP 
Sbjct  197  FASRRECGPKEWKVLKAVEPISMGAGVLPA  226


 Score = 77.8 bits (190),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  239  ELMYMRAKFERVVGSRDSEAFYMMNPDSNGAPELSIYLLRV  279



>ref|XP_006494262.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X1 [Citrus sinensis]
 ref|XP_006494263.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X2 [Citrus sinensis]
Length=267

 Score =   162 bits (410),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 105/148 (71%), Gaps = 11/148 (7%)
 Frame = -2

Query  573  AVSKLRSAL-TFGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++LR+ L TFG         LG RV GTLFG +RG VHFAFQ+DP   PAFLVELA P
Sbjct  78   AVARLRTVLSTFGKHRSNHPLGLGPRVTGTLFGSKRGHVHFAFQKDPNSPPAFLVELATP  137

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC+      EK  +KK  +LLEEP WRTYCNG+K GFA RREC
Sbjct  138  ISGLVREMASGLVRIALECDK-----EKEDEKKAVRLLEEPMWRTYCNGKKRGFATRREC  192

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            G  +W+VL ++ PI+MGAGVLPG  D+ 
Sbjct  193  GAKEWKVLKAVEPISMGAGVLPGTGDEA  220


 Score = 76.6 bits (187),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  227  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSVYLLRV  267



>ref|XP_010925133.1| PREDICTED: protein MIZU-KUSSEI 1-like [Elaeis guineensis]
Length=263

 Score =   163 bits (412),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 97/144 (67%), Gaps = 12/144 (8%)
 Frame = -2

Query  576  TAVSKLRSALTFGIK-----SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             AVS+ R+ +   I      + LG RV GTLFG RRG VHFAFQ DPR  PA L+ELA P
Sbjct  79   VAVSRFRTVIAAVIARRHRLAGLGPRVTGTLFGHRRGHVHFAFQVDPRSCPALLIELATP  138

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE               KLLEEP WR YCNG+KCG+A RREC
Sbjct  139  TSTLVREMASGLVRIALECERRGGK-------VAGKLLEEPLWRAYCNGKKCGYAVRREC  191

Query  231  GPDDWRVLNSIGPITMGAGVLPGK  160
            GP DWRVL ++ P++MGAGVLPG 
Sbjct  192  GPADWRVLRAVEPVSMGAGVLPGD  215


 Score = 75.9 bits (185),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEAFYMM+PD +GGPELSIYLLR 
Sbjct  223  EMMYMRARFERVVGSKDSEAFYMMNPDNNGGPELSIYLLRV  263



>ref|XP_006345062.1| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum tuberosum]
Length=278

 Score =   159 bits (402),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 104/143 (73%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AV++L+S LT FG      +  LG RVVGTLFG RRG VHFAFQ+D    PAFLVELA P
Sbjct  92   AVARLKSVLTAFGRNRSNFQQGLGTRVVGTLFGHRRGHVHFAFQKDSTSQPAFLVELATP  151

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
               LVREMASG VRIALEC       +K ++KK ++L++EP WRTYCNG+KCGFA RRE 
Sbjct  152  ISGLVREMASGLVRIALEC-------DKEEEKKVSRLIDEPVWRTYCNGKKCGFATRREI  204

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
            G  + ++L ++ PI+MGAGVLPG
Sbjct  205  GAKEVQILKAVEPISMGAGVLPG  227


 Score = 79.0 bits (193),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERV+GSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  238  EIMYMRAKFERVIGSRDSEAFYMMNPDSNGAPELSIYLLRV  278



>ref|XP_009782370.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana sylvestris]
Length=281

 Score =   162 bits (409),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 105/148 (71%), Gaps = 13/148 (9%)
 Frame = -2

Query  573  AVSKLRSALT------FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             V++L+S L          +  LG RVVGTLFG +RG VHFAFQ+DP   PAFL+ELA P
Sbjct  96   TVARLKSVLIAIGRNRIHFQQGLGTRVVGTLFGHKRGHVHFAFQKDPNSQPAFLIELATP  155

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
              VLV+EMASG VRIALEC       +K ++KK A+L++EP W+TYCNG+ CG+A RREC
Sbjct  156  VSVLVQEMASGLVRIALEC-------DKEEEKKVARLIDEPKWKTYCNGKNCGYATRREC  208

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            GP + ++L ++ PI+ GAGVLPG E+ G
Sbjct  209  GPKELQILKAVEPISTGAGVLPGNENGG  236


 Score = 75.9 bits (185),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ERVVGSRDSEAFYMM+PD +G PELS YLLR 
Sbjct  241  EIMYMRAKFERVVGSRDSEAFYMMNPDRNGAPELSFYLLRV  281



>ref|XP_009346641.1| PREDICTED: protein MIZU-KUSSEI 1-like [Pyrus x bretschneideri]
Length=286

 Score =   160 bits (404),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 106/150 (71%), Gaps = 10/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS++RS L  FG         LG RVVGTLFG RRG VHFA Q DP   PAF
Sbjct  78   RRKLQAAAVSRMRSVLNAFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFALQRDPSSHPAF  137

Query  432  LVELAMPTGVLVREMASGPVRIALECE-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKC  256
            L+ELA P   LV+EMASG VRIALEC+  + +  +K K +K  +LLEEP WRT+CNG+K 
Sbjct  138  LIELATPISGLVKEMASGLVRIALECDKDHKDDHQKKKDEKAPRLLEEPVWRTFCNGKKY  197

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            GFA+RRECG  +W+VL ++ PI+MGAGVLP
Sbjct  198  GFASRRECGAKEWKVLKAVEPISMGAGVLP  227


 Score = 77.8 bits (190),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  246  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  286



>ref|XP_008367570.1| PREDICTED: LOW QUALITY PROTEIN: protein MIZU-KUSSEI 1-like [Malus 
domestica]
Length=287

 Score =   159 bits (403),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 106/150 (71%), Gaps = 10/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS+LRS LT FG         LG RVVGTLFG RRG VHFA Q DP   PAF
Sbjct  79   RRKLQAAAVSRLRSVLTTFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFALQRDPSSHPAF  138

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTN-TWEknkkkkkaKLLEEPAWRTYCNGRKC  256
            L+ELA P   LV+EMASG VRIALEC+ +     +K K +K  +LLEEP WRT+CNG+K 
Sbjct  139  LIELATPISGLVKEMASGLVRIALECDKDHKRRSQKKKDQKSLRLLEEPVWRTFCNGKKY  198

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            GFA++RECG  +W+VL ++ PI+MGAGVLP
Sbjct  199  GFASKRECGAKEWKVLKAVEPISMGAGVLP  228


 Score = 77.8 bits (190),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  247  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  287



>ref|XP_008374708.1| PREDICTED: protein MIZU-KUSSEI 1 [Malus domestica]
Length=287

 Score =   160 bits (404),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 106/150 (71%), Gaps = 10/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS++RS L  FG         LG RVVGTLFG RRG VHFA Q DP   PAF
Sbjct  79   RRKLQAAAVSRMRSVLNAFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFALQRDPSSHPAF  138

Query  432  LVELAMPTGVLVREMASGPVRIALECE-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKC  256
            L+ELA P   LV+EMASG VRIALEC+  + +  +K K +K  +LLEEP WRT+CNG+K 
Sbjct  139  LIELATPISGLVKEMASGLVRIALECDKDHKDDHQKKKDEKAPRLLEEPVWRTFCNGKKY  198

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            GFA+RRECG  +W+VL ++ PI+MGAGVLP
Sbjct  199  GFASRRECGAKEWKVLKAVEPISMGAGVLP  228


 Score = 77.0 bits (188),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELS+YLLR 
Sbjct  247  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSVYLLRV  287



>ref|XP_008446535.1| PREDICTED: protein MIZU-KUSSEI 1 [Cucumis melo]
Length=257

 Score =   160 bits (404),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = -2

Query  570  VSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            VSKLR+ALT          +S LG RV+GTLFG+RRG V+FA QEDP+  P FL+EL+ P
Sbjct  74   VSKLRTALTVFSRIRPTYHRSRLGGRVIGTLFGYRRGHVYFALQEDPKQSPTFLIELSTP  133

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T VLVREMASG VRIALECE  T       +KK  KL+EE  WRTYCNG+KCG+ +RRE 
Sbjct  134  TSVLVREMASGLVRIALECEKKTE------RKKNCKLVEEALWRTYCNGKKCGYGSRREY  187

Query  231  GPDDWRVLNSIGPITMGAGVLP  166
            G ++ ++L ++ PITMGAGVLP
Sbjct  188  GTEEQKILKAVEPITMGAGVLP  209


 Score = 76.6 bits (187),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERV+GS+DSEA+YMMSPD +GGPELSIYLLR 
Sbjct  217  ELMYMRARFERVIGSKDSEAYYMMSPDCNGGPELSIYLLRV  257



>ref|XP_004299248.1| PREDICTED: protein MIZU-KUSSEI 1 [Fragaria vesca subsp. vesca]
Length=264

 Score =   158 bits (400),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 103/158 (65%), Gaps = 18/158 (11%)
 Frame = -2

Query  585  RRK---TAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    A+S+LRS LT       G+   LG+RVVGTLFG ++G VHFA Q DP   PAF
Sbjct  58   RRKLQAAAISRLRSVLTAFGKNRGGLPLGLGSRVVGTLFGSKKGHVHFALQRDPNSHPAF  117

Query  432  LVELAMPTGVLVREMASGPVRIALECEG---------NTNTWEknkkkkkaKLLEEPAWR  280
            L+ELA P   LV+EMASG VRIALEC+             +          +LLEEP WR
Sbjct  118  LIELATPISGLVKEMASGLVRIALECDKEKEDQEKKKTMESKSSKSGSAVRRLLEEPVWR  177

Query  279  TYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            TYCNG+K GFA+RRECGP +W+VL ++ PI+MGAGVLP
Sbjct  178  TYCNGKKSGFASRRECGPKEWKVLKAVEPISMGAGVLP  215


 Score = 77.8 bits (190),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  224  ELMYMRAKFERVVGSRDSEAFYMMNPDSNGAPELSIYLLRV  264



>gb|KEH37940.1| plant-specific domain TIGR01570 family protein [Medicago truncatula]
Length=270

 Score =   164 bits (414),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 11/137 (8%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            T ++K RS     + S  G R+VGTLFG+RRG VHFAFQ+D +L P FL+ELA PT VLV
Sbjct  92   TILTKNRS-----LHSSSGTRMVGTLFGYRRGHVHFAFQDDSKLSPTFLIELATPTSVLV  146

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALECE      +K   +K  KLLEEP WR+YCNGRKCG+A R ECG ++W
Sbjct  147  REMASGVVRIALECE------KKGGGRKSLKLLEEPIWRSYCNGRKCGYAYRHECGSEEW  200

Query  216  RVLNSIGPITMGAGVLP  166
            ++L ++ PI+MGAGVLP
Sbjct  201  KILKAVEPISMGAGVLP  217


 Score = 72.0 bits (175),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAKYERV+GS+DSEAFYMM+  G GGPELS+YLLR 
Sbjct  230  ELMYMRAKYERVIGSKDSEAFYMMNHVGSGGPELSLYLLRV  270



>ref|XP_009392909.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=266

 Score =   158 bits (400),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 97/140 (69%), Gaps = 13/140 (9%)
 Frame = -2

Query  564  KLRSALTFGI---KSPLG--ARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVL  400
            +LR+ LT  I   + P+G   RV GTLFG RRG VHFAFQ DPR  PA L+ELA PT  L
Sbjct  89   RLRAVLTAAIVGRRRPVGFGPRVTGTLFGHRRGHVHFAFQVDPRACPAVLIELATPTNTL  148

Query  399  VREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDD  220
            VREMASG VRIALECE      +        KLLEEP WR YCNG+KCG+A RRECGP D
Sbjct  149  VREMASGLVRIALECERRAGGGK--------KLLEEPLWRAYCNGKKCGYAVRRECGPAD  200

Query  219  WRVLNSIGPITMGAGVLPGK  160
            WRVL ++ P++ GAGVLPG 
Sbjct  201  WRVLRAVEPVSTGAGVLPGD  220


 Score = 77.0 bits (188),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEAFYMM+PD +GGPELSIYLLRA
Sbjct  226  EMMYMRARFERVVGSKDSEAFYMMNPDNNGGPELSIYLLRA  266



>ref|XP_010936793.1| PREDICTED: protein MIZU-KUSSEI 1-like [Elaeis guineensis]
Length=233

 Score =   161 bits (408),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 98/143 (69%), Gaps = 6/143 (4%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPLGARVV-GTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            AVS+LRS LT  I +     V+ GTLFG RRG V+ AFQ D R  PA LVELA PT  LV
Sbjct  55   AVSRLRSVLTAAIPARWSRPVLTGTLFGHRRGHVNLAFQVDARSSPAVLVELATPTSTLV  114

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG  RIALECE         K   +  LLEEP WR YCNGRKCG+A RRECGP DW
Sbjct  115  REMASGLARIALECERKEE-----KTTARTSLLEEPLWRAYCNGRKCGYAVRRECGPADW  169

Query  216  RVLNSIGPITMGAGVLPGKEDDG  148
            +VL ++ P++MGAGVLPG + DG
Sbjct  170  KVLRALEPVSMGAGVLPGDDPDG  192


 Score = 73.2 bits (178),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA++ERVVGS+DSEAFYM++PDG+ GPELS+YLLR 
Sbjct  193  DIMYMRARFERVVGSKDSEAFYMINPDGNTGPELSVYLLRV  233



>ref|XP_009610371.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana tomentosiformis]
Length=285

 Score =   160 bits (404),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 13/146 (9%)
 Frame = -2

Query  573  AVSKLRSALT------FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             V++L+S L          +  LG RVVGTLFG +RG VHFAFQ+DP   PAFL+ELA P
Sbjct  100  TVARLKSVLIAIGRNRIHFQQGLGTRVVGTLFGHKRGYVHFAFQKDPNSQPAFLIELATP  159

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
              VLV+EMASG VRIALEC       +K ++KK  KL++EP W+TYCNG+KCG+A RREC
Sbjct  160  ITVLVQEMASGLVRIALEC-------DKEEEKKVGKLIDEPKWKTYCNGKKCGYATRREC  212

Query  231  GPDDWRVLNSIGPITMGAGVLPGKED  154
            GP + ++L  + PI+ GAGVLPG E+
Sbjct  213  GPKELQILKVVEPISTGAGVLPGNEN  238


 Score = 74.7 bits (182),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ERVVGSRDSEAFYMM+PD +G PELS YLLR 
Sbjct  245  DIMYMRAKFERVVGSRDSEAFYMMNPDRNGAPELSFYLLRV  285



>gb|KJB39902.1| hypothetical protein B456_007G041200 [Gossypium raimondii]
Length=258

 Score =   157 bits (396),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = -2

Query  585  RRKTAVS---KLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            R ++AVS   K RS+L FG    LG+RV+GTLFG+RRG VHFA Q++    PAFLVEL  
Sbjct  67   RLRSAVSSFRKSRSSLPFG----LGSRVIGTLFGYRRGHVHFALQKEAGSPPAFLVELTT  122

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LVREMASG VRIALEC+         K     +LLEE  WRTYCNG+KCGFA RR+
Sbjct  123  PISGLVREMASGLVRIALECDKPKAEDHNKKGTTVVRLLEESTWRTYCNGKKCGFATRRD  182

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKEDDGIGP  139
            CG  +W++L ++ PI+ GAGVLP   +   GP
Sbjct  183  CGDKEWKILKAVEPISTGAGVLPAGNEVEAGP  214


 Score = 77.8 bits (190),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  218  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSIYLLRV  258



>ref|XP_004241620.2| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum lycopersicum]
Length=294

 Score =   160 bits (404),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 103/152 (68%), Gaps = 13/152 (9%)
 Frame = -2

Query  585  RRKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
            RRK  V+KL+S LT        ++  LG +VVGTLFG + G VHFAFQ+D    PAFLVE
Sbjct  103  RRKAVVAKLKSVLTSLGKNRGNLQPGLGTKVVGTLFGHKNGHVHFAFQKDANSQPAFLVE  162

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            LA P   LV EM+SG VRIALEC+       K  +KK  +L++EP WRTYCNG+KCGFA 
Sbjct  163  LATPISGLVHEMSSGLVRIALECD-------KTDEKKSTRLIDEPLWRTYCNGKKCGFAT  215

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
             RECGP + ++L ++ PI+MG GVLP  ED+ 
Sbjct  216  TRECGPKELQILKAVEPISMGVGVLPRNEDES  247


 Score = 74.3 bits (181),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ERVVGSRDSEAFYMM+PD  G  ELSIYLLR 
Sbjct  254  DVMYMRAKFERVVGSRDSEAFYMMNPDCDGAAELSIYLLRV  294



>ref|XP_010265326.1| PREDICTED: protein MIZU-KUSSEI 1 [Nelumbo nucifera]
Length=264

 Score =   152 bits (385),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 98/143 (69%), Gaps = 13/143 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIK------SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
             V++LRS LT   K      S LG RV+GTLFG RRG V FAFQEDP+  PAFL+EL   
Sbjct  81   TVARLRSVLTVFTKNRSHLSSRLGTRVIGTLFGHRRGPVKFAFQEDPKSYPAFLIELTTL  140

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            T  LVREMASG VRIALECE   +        K  +LL+EP W  YCNG+KCG A +REC
Sbjct  141  TCGLVREMASGLVRIALECEKKFDN-------KGVRLLQEPKWTAYCNGKKCGSATKREC  193

Query  231  GPDDWRVLNSIGPITMGAGVLPG  163
             P++W+VL ++ PI+MGAGVLPG
Sbjct  194  RPEEWKVLKAVEPISMGAGVLPG  216


 Score = 81.6 bits (200),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ERVVGSRDSEAFYMM+PDG GGPELSIYLLR 
Sbjct  224  ELMYMRAKFERVVGSRDSEAFYMMNPDGTGGPELSIYLLRV  264



>ref|XP_009792099.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana sylvestris]
Length=281

 Score =   156 bits (395),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 13/145 (9%)
 Frame = -2

Query  582  RKTAVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            R+ AV++L+S LT  G      +  LG +VVGTLFG ++G V+FAFQ+DP   PAFLVEL
Sbjct  93   RRKAVARLKSVLTSLGRNKGYFQQGLGTKVVGTLFGHKKGHVNFAFQKDPNSQPAFLVEL  152

Query  420  AMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            A+P   LVREMASG VRIALEC+           KK  +L++E  WRTYCNG+KCGFA R
Sbjct  153  AIPISGLVREMASGLVRIALECDKEEE-------KKSTRLIDEILWRTYCNGKKCGFATR  205

Query  240  RECGPDDWRVLNSIGPITMGAGVLP  166
            +ECGP + ++L ++ PI+MGAGVLP
Sbjct  206  KECGPKELQILKAVEPISMGAGVLP  230


 Score = 77.0 bits (188),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ERVVGSRDSEAFYMM+PD  G PELSIYLLR 
Sbjct  241  DVMYMRAKFERVVGSRDSEAFYMMNPDSDGAPELSIYLLRV  281



>ref|XP_004137460.1| PREDICTED: uncharacterized protein LOC101209919 [Cucumis sativus]
 ref|XP_004157427.1| PREDICTED: uncharacterized protein LOC101223313 [Cucumis sativus]
 gb|KGN64097.1| hypothetical protein Csa_1G042090 [Cucumis sativus]
Length=277

 Score =   155 bits (393),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 107/150 (71%), Gaps = 14/150 (9%)
 Frame = -2

Query  585  RRK---TAVSKLRSALTFGIK-----SP-LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AV++LRS LT   K     SP LG+RV+GTLFG RRG VHFAFQ DP   PAF
Sbjct  70   RRKMPAVAVARLRSVLTVFAKNRSTLSPGLGSRVIGTLFGSRRGHVHFAFQRDPNSEPAF  129

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            LVELA P   LV+EMASG VRIALEC+      EK  +KK  +LLE+P WRT+CNG+K G
Sbjct  130  LVELATPISGLVKEMASGLVRIALECDK-----EKEGEKKAVRLLEQPLWRTFCNGKKSG  184

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA R++CG  + ++L ++ PI+MGAGVLPG
Sbjct  185  FATRKDCGVKEMKILKAVEPISMGAGVLPG  214


 Score = 77.4 bits (189),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  237  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSIYLLRV  277



>ref|XP_006354738.1| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum tuberosum]
Length=292

 Score =   159 bits (401),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 101/152 (66%), Gaps = 13/152 (9%)
 Frame = -2

Query  585  RRKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
            RRK  V+KL+S LT         +  LG +VVGTLFG + G VHFAFQ+D    PAFLVE
Sbjct  101  RRKAVVAKLKSVLTSLGKNRGNFQQGLGTKVVGTLFGHKNGHVHFAFQKDANSQPAFLVE  160

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            LA P   LV+EM+SG VRIALEC+           KK  +L++EP WRTYCNG+KCGFA 
Sbjct  161  LATPISGLVQEMSSGLVRIALECDKTDE-------KKSTRLIDEPLWRTYCNGKKCGFAT  213

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
             RECGP + ++L ++ PI+MG GVLP  E++ 
Sbjct  214  TRECGPKELQILKAVEPISMGVGVLPRNEEES  245


 Score = 74.3 bits (181),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ERVVGSRDSEAFYMM+PD  G  ELSIYLLR 
Sbjct  252  DVMYMRAKFERVVGSRDSEAFYMMNPDCDGAAELSIYLLRV  292



>ref|XP_009416767.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   159 bits (402),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = -2

Query  573  AVSKLRSALTFGIKS-----PLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            AVS+LRS L+F I S      LG RV GTL+G R G +HFA Q DPR  PA L+ELA  T
Sbjct  92   AVSRLRSVLSFAIGSRHRQLGLGHRVTGTLYGRRGGHMHFAIQVDPRACPAMLIELATST  151

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
              LVREMASG VRIALECE    T  +        LLEEP WR YCNG+K G AARRECG
Sbjct  152  RALVREMASGLVRIALECERRAGTGNRR-------LLEEPLWRAYCNGKKHGHAARRECG  204

Query  228  PDDWRVLNSIGPITMGAGVLP  166
            P DWRVL ++ P+TMGAGVLP
Sbjct  205  PADWRVLRAVEPVTMGAGVLP  225


 Score = 73.9 bits (180),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEAFYMM+PD  GGPEL+IYLLR 
Sbjct  233  EVMYMRARFERVVGSQDSEAFYMMNPDSSGGPELTIYLLRV  273



>ref|XP_008455509.1| PREDICTED: protein MIZU-KUSSEI 1-like [Cucumis melo]
Length=266

 Score =   155 bits (392),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 107/150 (71%), Gaps = 14/150 (9%)
 Frame = -2

Query  585  RRK---TAVSKLRSALTFGIK-----SP-LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AV++LRS LT   K     SP LG+RV+GTLFG RRG VHFAFQ DP   PAF
Sbjct  59   RRKMPAVAVARLRSVLTVFAKNRSTLSPGLGSRVIGTLFGSRRGHVHFAFQRDPNSEPAF  118

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            LVELA P   LV+EMASG VRIALEC+      EK  +KK  +LLE+P WRT+CNG+K G
Sbjct  119  LVELATPISGLVKEMASGLVRIALECDK-----EKEGEKKAVRLLEQPLWRTFCNGKKSG  173

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            FA R++CG  + ++L ++ PI+MGAGVLPG
Sbjct  174  FATRKDCGVKEMKILKAVEPISMGAGVLPG  203


 Score = 77.0 bits (188),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  226  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGTPELSIYLLRV  266



>emb|CDX87184.1| BnaC09g04990D [Brassica napus]
Length=258

 Score =   155 bits (391),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 104/147 (71%), Gaps = 7/147 (5%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS ++           S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  60   AVSRLRSVISSLSRARPGNNNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSPPAFLIELAT  119

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LV+EMASG VRIALEC+      +++  ++  +L+EEP WRTYCNG+KCGFAARRE
Sbjct  120  PISGLVKEMASGLVRIALECDKAKEEAKEDGDRRPRRLVEEPVWRTYCNGKKCGFAARRE  179

Query  234  CGPDDWRVLNSIGPITMGAGVLPGKED  154
            CG  + +VL ++  ++MGAGVLP  E+
Sbjct  180  CGEKEKKVLKALEMVSMGAGVLPETEE  206


 Score = 77.4 bits (189),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  218  EIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  257



>gb|EPS74122.1| hypothetical protein M569_00633 [Genlisea aurea]
Length=408

 Score =   154 bits (390),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 98/146 (67%), Gaps = 10/146 (7%)
 Frame = -2

Query  570  VSKLRSALTFG---IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVL  400
            +S+LRSAL           G +V G LFG RRG V  AFQED    P FLVE+A PT  L
Sbjct  227  ISQLRSALGKARTHFSPGKGTKVSGALFGHRRGHVQLAFQEDSTGSPFFLVEMATPTAAL  286

Query  399  VREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDD  220
            V+EMASG VRIALECE           +K  KLL+EP WR YCNG+KCG+AARRECGPD+
Sbjct  287  VKEMASGLVRIALECEKKVE-------RKGVKLLDEPLWRAYCNGKKCGYAARRECGPDE  339

Query  219  WRVLNSIGPITMGAGVLPGKEDDGIG  142
            W+VLN +GPI+MGAGVLP     G+G
Sbjct  340  WKVLNLVGPISMGAGVLPAVGVPGVG  365


 Score = 77.8 bits (190),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYM+AK+ERVV  +DSEAFYMM+PDGHGGPELSIYLLRA
Sbjct  368  EMMYMKAKFERVVCGKDSEAFYMMNPDGHGGPELSIYLLRA  408



>ref|XP_010554247.1| PREDICTED: protein MIZU-KUSSEI 1 [Tarenaya hassleriana]
Length=268

 Score =   160 bits (405),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 105/152 (69%), Gaps = 12/152 (8%)
 Frame = -2

Query  582  RKTAVSKLRSALT------FGIK-SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
            +K  VSKLR ALT      FG   S LG RVVGTLFG RRG VHFA Q+DP   PA L+E
Sbjct  59   KKKTVSKLRYALTLFNRNRFGYSYSGLGTRVVGTLFGNRRGHVHFAVQDDPTRLPAVLIE  118

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTW-----EknkkkkkaKLLEEPAWRTYCNGRK  259
            L  PT VLVREMASG VRIALECE   ++      EK K     KLLEEP WRTYCNG+K
Sbjct  119  LPTPTSVLVREMASGLVRIALECEKKIDSIGMTKKEKKKLGLPKKLLEEPTWRTYCNGKK  178

Query  258  CGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            CGFAARRE G  +W+VL ++G ITMGAGVLP 
Sbjct  179  CGFAARREVGAAEWKVLTAVGRITMGAGVLPA  210


 Score = 71.2 bits (173),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            LMYMRA++ERVVGSRDSEAFYMMSP+G +GGPELS+Y LR 
Sbjct  228  LMYMRARFERVVGSRDSEAFYMMSPEGANGGPELSVYFLRV  268



>ref|XP_009337564.1| PREDICTED: protein MIZU-KUSSEI 1 [Pyrus x bretschneideri]
Length=289

 Score =   153 bits (387),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 104/150 (69%), Gaps = 10/150 (7%)
 Frame = -2

Query  585  RRK---TAVSKLRSALT-FGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            RRK    AVS+LRS LT FG         LG RVVGTLFG RRG VHFA Q DP   PAF
Sbjct  81   RRKLQAAAVSRLRSVLTTFGKNRSSLPLGLGPRVVGTLFGSRRGHVHFALQRDPSSHPAF  140

Query  432  LVELAMPTGVLVREMASGPVRIALECEGNTNT-WEknkkkkkaKLLEEPAWRTYCNGRKC  256
            L+ELA P   LV+EMASG VRIALEC+ +     +K K +K  +LLEEP WRT+CNG+K 
Sbjct  141  LIELATPISGLVKEMASGLVRIALECDKDHKADLQKKKDQKSLRLLEEPVWRTFCNGKKY  200

Query  255  GFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            GFA++RECG  +W+ + ++  I+MGAGVLP
Sbjct  201  GFASKRECGAKEWKGVEAVEAISMGAGVLP  230


 Score = 78.2 bits (191),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  249  ELMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  289



>gb|EYU28944.1| hypothetical protein MIMGU_mgv1a023336mg, partial [Erythranthe 
guttata]
Length=261

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 110/146 (75%), Gaps = 7/146 (5%)
 Frame = -2

Query  564  KLRSALTFG---IKSP---LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
            +LRSAL  G    + P   LG++VVGTLFG RRG V FAFQED +  PAFLVELA PT V
Sbjct  105  QLRSALALGRARTRGPSPHLGSKVVGTLFGHRRGHVRFAFQEDFKAAPAFLVELATPTSV  164

Query  402  LVREMASGPVRIALECEG-NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGP  226
            LV+EMASG VRIALEC+  N    + +      ++L+EP WRTYCNG+KCG+A RRECGP
Sbjct  165  LVKEMASGLVRIALECDKINKIEKKGSLVVAATRILDEPVWRTYCNGKKCGYALRRECGP  224

Query  225  DDWRVLNSIGPITMGAGVLPGKEDDG  148
            D+W+VLN++GPI+MGAGVLPG E DG
Sbjct  225  DEWKVLNAVGPISMGAGVLPGSEPDG  250



>ref|XP_009390202.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   154 bits (390),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 98/152 (64%), Gaps = 8/152 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGIK------SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA  418
            +TAVS+LRS L           + LGARV GTL+G RRG VH AFQ D +  P  LVELA
Sbjct  84   ETAVSRLRSVLAAATSLRRNRPTGLGARVTGTLYGHRRGHVHLAFQADSKSCPVVLVELA  143

Query  417  MPTGVLVREMASGPVRIALECEGN--TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
              T  LVREMASG VRIALECE    +      K     +L+EEP WR Y NG+KCG+A 
Sbjct  144  TATSALVREMASGLVRIALECERKPSSGGGGGEKAAATTRLVEEPLWRAYINGKKCGYAV  203

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            +RECGP DW+VL ++ P++MGAGV+PG   D 
Sbjct  204  QRECGPGDWKVLRAVEPVSMGAGVIPGDGGDA  235


 Score = 76.6 bits (187),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ERVVGS+DSEAFYMM+PD +GGPELS+YLLR
Sbjct  241  DVMYMRAKFERVVGSKDSEAFYMMNPDNNGGPELSVYLLR  280



>emb|CDY48081.1| BnaA06g33470D [Brassica napus]
Length=266

 Score =   160 bits (405),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F  KS LG RV+GTLFG RRG V+FA Q+DP   PA L++L  PT +LV+E
Sbjct  84   IEKIRYALGFS-KSGLGFRVIGTLFGNRRGNVYFAVQDDPTRLPAVLIQLPTPTSILVKE  142

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            MASG VRIALE   +             KLLEE  WRTYCNGRKCG+AAR+ECG  +WRV
Sbjct  143  MASGLVRIALETAASKT--------GSKKLLEESTWRTYCNGRKCGYAARKECGEAEWRV  194

Query  210  LNSIGPITMGAGVLPGKEDDG  148
            L ++GPITMGAGVLP   D+G
Sbjct  195  LKAVGPITMGAGVLPAVVDEG  215


 Score = 69.7 bits (169),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV GSRDSEAFYMM+P+G  GGPELS+Y LR 
Sbjct  225  ELMYMRARFERVTGSRDSEAFYMMNPEGSSGGPELSVYFLRV  266



>ref|XP_009597987.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana tomentosiformis]
Length=290

 Score =   153 bits (386),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 99/144 (69%), Gaps = 12/144 (8%)
 Frame = -2

Query  579  KTAVSKLRSALT-FG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA  418
            + AV++L+S LT  G      +  LG +VVGTLFG ++G VHFAFQ+DP   PAFLVELA
Sbjct  102  RKAVARLKSVLTSLGRNKGYFQQGLGTKVVGTLFGHKKGHVHFAFQKDPNSKPAFLVELA  161

Query  417  MPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR  238
             P   LVREMASG VRIALEC+            K  +L++E  WRTYCNG+KCGFA RR
Sbjct  162  TPISGLVREMASGLVRIALECDKEEEEK------KSTRLIDEILWRTYCNGKKCGFATRR  215

Query  237  ECGPDDWRVLNSIGPITMGAGVLP  166
            ECG  + ++L ++ PI+MGAGVLP
Sbjct  216  ECGTKELQILKAVEPISMGAGVLP  239


 Score = 76.6 bits (187),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRAK+ERVVGSRDSEAFYMM+PD  G PELSIYLLR 
Sbjct  250  DVMYMRAKFERVVGSRDSEAFYMMNPDSDGAPELSIYLLRV  290



>ref|XP_009412425.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   157 bits (397),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG RV GTLFG RRG VHFAFQ DPR  PA L+ELA PT  LVREMASG VRIALECE  
Sbjct  100  LGPRVTGTLFGHRRGHVHFAFQVDPRACPAVLIELATPTDTLVREMASGLVRIALECERR  159

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
                +        KLLEEP WR YCNG+KCG A RRECGP DWRVL ++ P++ GAGVLP
Sbjct  160  AGGGK--------KLLEEPLWRAYCNGKKCGHAVRRECGPADWRVLQAVEPVSTGAGVLP  211

Query  165  GKEDDGI  145
            G   DG+
Sbjct  212  G--GDGV  216


 Score = 72.4 bits (176),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA +ERVVGS DSEAFYMM+PD  GGPELSIYLLR 
Sbjct  220  DVMYMRASFERVVGSSDSEAFYMMNPDNQGGPELSIYLLRV  260



>emb|CDY16840.1| BnaA09g05420D [Brassica napus]
Length=255

 Score =   154 bits (388),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS ++           S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  60   AVSRLRSVISSLSRARPGNNNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSQPAFLIELAT  119

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LV+EMASG VRIALEC+      +++  ++  +L+EEP WRTYCNG+KCGFAARRE
Sbjct  120  PISGLVKEMASGLVRIALECDKAKEEAKEDGDRRPRRLVEEPVWRTYCNGKKCGFAARRE  179

Query  234  CGPDDWRVLNSIGPITMGAGVLP  166
            CG  + +VL ++  ++MGAGVLP
Sbjct  180  CGEKEKKVLKALEMVSMGAGVLP  202


 Score = 75.5 bits (184),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  216  IMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  254



>dbj|BAB03084.1| unnamed protein product [Arabidopsis thaliana]
Length=293

 Score =   156 bits (395),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 102/151 (68%), Gaps = 12/151 (8%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVRE
Sbjct  106  LEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVRE  164

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            MASG VRIALE           K   K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+V
Sbjct  165  MASGLVRIALETAA-------YKTDSKKKLLEESTWRTYCNGKKCGYAARKECGEAEWKV  217

Query  210  LNSIGPITMGAGVLPGK----EDDGIGPTAS  130
            L ++GPITMGAGVLP      +++G G   S
Sbjct  218  LKAVGPITMGAGVLPATTTTVDEEGNGAVGS  248


 Score = 72.4 bits (176),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERVVGSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  252  ELMYMRARFERVVGSRDSEAFYMMNPDVSSGGPELSVYFLRV  293



>ref|XP_009111953.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
Length=255

 Score =   153 bits (386),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS ++           S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  60   AVSRLRSVISSLSRARPGNNNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSPPAFLIELAT  119

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRE  235
            P   LV+EMASG VRIALEC+      +++  ++  +L+EEP WRTYCNG+KCGFAARRE
Sbjct  120  PISGLVKEMASGLVRIALECDKAKEEAKEDGDRRPRRLVEEPVWRTYCNGKKCGFAARRE  179

Query  234  CGPDDWRVLNSIGPITMGAGVLP  166
            CG  + +VL ++  ++MGAGVLP
Sbjct  180  CGEKEKKVLKALEMVSMGAGVLP  202


 Score = 75.5 bits (184),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  216  IMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  254



>ref|XP_009152125.1| PREDICTED: protein MIZU-KUSSEI 1 [Brassica rapa]
Length=267

 Score =   159 bits (401),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 98/142 (69%), Gaps = 9/142 (6%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVR  394
             + K+R AL F  KS LG RV+GTLFG RRG V+FA Q+DP   P  L++L  PT +LV+
Sbjct  84   TIEKIRYALGFS-KSGLGFRVIGTLFGNRRGHVYFAVQDDPTRLPVVLIQLPTPTSILVK  142

Query  393  EMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            EMASG VRIALE   +             KLLEE  WRTYCNGRKCG+AAR+ECG  +WR
Sbjct  143  EMASGLVRIALETAASKT--------GSKKLLEESTWRTYCNGRKCGYAARKECGEAEWR  194

Query  213  VLNSIGPITMGAGVLPGKEDDG  148
            VL ++GPITMGAGVLP   D+G
Sbjct  195  VLKAVGPITMGAGVLPAVVDEG  216


 Score = 69.7 bits (169),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV GSRDSEAFYMM+P+G  GGPELS+Y LR 
Sbjct  226  ELMYMRARFERVTGSRDSEAFYMMNPEGSSGGPELSVYFLRV  267



>ref|XP_010514181.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X1 [Camelina sativa]
 ref|XP_010514182.1| PREDICTED: protein MIZU-KUSSEI 1-like isoform X2 [Camelina sativa]
Length=269

 Score =   157 bits (396),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 104/153 (68%), Gaps = 15/153 (10%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVRE
Sbjct  81   LEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVRE  139

Query  390  MASGPVRIALECEG-NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            MASG VRIALE     T+T        K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+
Sbjct  140  MASGLVRIALETAAFKTDT--------KKKLLEESTWRTYCNGKKCGYAARKECGEAEWK  191

Query  213  VLNSIGPITMGAGVLPGK-----EDDGIGPTAS  130
            VL ++GPITMGAGVLP       E++G G   S
Sbjct  192  VLKAVGPITMGAGVLPAAKTTAGEEEGNGAVGS  224


 Score = 71.2 bits (173),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  228  ELMYMRARFERVIGSRDSEAFYMMNPDVSSGGPELSVYFLRV  269



>ref|XP_004488528.1| PREDICTED: uncharacterized protein LOC101498450 [Cicer arietinum]
Length=274

 Score =   152 bits (385),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = -2

Query  531  SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE  352
            S LG R+VGTLFG+RRG VHFAFQED +L PAFL++LA PT VLVREMASG VRIALECE
Sbjct  103  SSLGRRMVGTLFGYRRGHVHFAFQEDSKLCPAFLIKLATPTSVLVREMASGIVRIALECE  162

Query  351  GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGV  172
                      KKK  KLLEEP W TYCNGRKCG+A R ECG ++W++L ++ PI+MGAGV
Sbjct  163  KKVGG----GKKKGLKLLEEPIWSTYCNGRKCGYAYRHECGSEEWKILKAVEPISMGAGV  218

Query  171  LP  166
            LP
Sbjct  219  LP  220


 Score = 75.1 bits (183),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +MYMRAKYERVVGS+DSEAFYMM+P GHGGPELSI+L+R 
Sbjct  235  VMYMRAKYERVVGSKDSEAFYMMNPVGHGGPELSIFLIRV  274



>ref|XP_002875266.1| hypothetical protein ARALYDRAFT_904728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51525.1| hypothetical protein ARALYDRAFT_904728 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   156 bits (394),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVRE
Sbjct  80   IEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVRE  138

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            MASG VRIALE           K   K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+V
Sbjct  139  MASGLVRIALETAA-------YKTDSKKKLLEESTWRTYCNGKKCGYAARKECGEAEWKV  191

Query  210  LNSIGPITMGAGVLPGK---EDDGIGPTAS  130
            L ++GPITMGAGVLP     +++G G   S
Sbjct  192  LKAVGPITMGAGVLPAATTVDEEGNGAVGS  221


 Score = 71.2 bits (173),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  225  ELMYMRARFERVIGSRDSEAFYMMNPDVSSGGPELSVYFLRV  266



>ref|NP_189192.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22652.1| unknown protein [Arabidopsis thaliana]
 gb|AAT71994.1| At3g25640 [Arabidopsis thaliana]
 gb|AEE77045.1| uncharacterized protein AT3G25640 [Arabidopsis thaliana]
Length=267

 Score =   155 bits (393),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 102/151 (68%), Gaps = 12/151 (8%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVRE
Sbjct  80   LEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVRE  138

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            MASG VRIALE           K   K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+V
Sbjct  139  MASGLVRIALETAA-------YKTDSKKKLLEESTWRTYCNGKKCGYAARKECGEAEWKV  191

Query  210  LNSIGPITMGAGVLPGK----EDDGIGPTAS  130
            L ++GPITMGAGVLP      +++G G   S
Sbjct  192  LKAVGPITMGAGVLPATTTTVDEEGNGAVGS  222


 Score = 71.6 bits (174),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERVVGSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  226  ELMYMRARFERVVGSRDSEAFYMMNPDVSSGGPELSVYFLRV  267



>ref|XP_010425215.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
Length=269

 Score =   156 bits (395),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 104/153 (68%), Gaps = 15/153 (10%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVRE
Sbjct  81   LEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVRE  139

Query  390  MASGPVRIALECEG-NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            MASG VRIALE     T+T        K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+
Sbjct  140  MASGLVRIALETAAFKTDT--------KKKLLEESTWRTYCNGKKCGYAARKECGEAEWK  191

Query  213  VLNSIGPITMGAGVLPGK-----EDDGIGPTAS  130
            VL ++GPITMGAGVLP       E++G G   S
Sbjct  192  VLKAVGPITMGAGVLPAATTTTVEEEGNGAVGS  224


 Score = 70.9 bits (172),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  228  ELMYMRARFERVIGSRDSEAFYMMNPDVSIGGPELSVYFLRV  269



>ref|XP_010502442.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
 ref|XP_010502443.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
Length=269

 Score =   155 bits (392),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 104/153 (68%), Gaps = 15/153 (10%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLV+E
Sbjct  81   LEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVQE  139

Query  390  MASGPVRIALECEG-NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            MASG VRIALE     T+T        K KLLEE  WRTYCNG+KCG+AAR+ECG  +W+
Sbjct  140  MASGLVRIALETAAFKTDT--------KKKLLEESTWRTYCNGKKCGYAARKECGEAEWK  191

Query  213  VLNSIGPITMGAGVLPGK-----EDDGIGPTAS  130
            VL ++GPITMGAGVLP       E++G G   S
Sbjct  192  VLKAVGPITMGAGVLPAATTTAVEEEGNGAVGS  224


 Score = 71.6 bits (174),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  228  ELMYMRARFERVIGSRDSEAFYMMNPDVSSGGPELSVYFLRV  269



>ref|XP_002458221.1| hypothetical protein SORBIDRAFT_03g029300 [Sorghum bicolor]
 gb|EES03341.1| hypothetical protein SORBIDRAFT_03g029300 [Sorghum bicolor]
Length=295

 Score =   155 bits (391),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   I     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  94   RTAVSRLRTALAAAIAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  153

Query  414  PTGVLVREMASGPVRIALECE-----GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGF  250
            PT  LVREMASG VRIALEC+                    KL+EE AWR YCNG+ CG+
Sbjct  154  PTASLVREMASGLVRIALECDRAKGAACAAAATNGGGGGGRKLVEEKAWRAYCNGKGCGY  213

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLP  166
            A RRECG  DWRVL ++ P++MGAGV+P
Sbjct  214  AVRRECGAADWRVLRALEPVSMGAGVIP  241


 Score = 71.2 bits (173),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 4/44 (9%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD----GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD    G+GGPELS+YLLR
Sbjct  251  DVMYMRARFERVVGSRDSEAFYMMNPDSSTGGNGGPELSVYLLR  294



>gb|EYU22616.1| hypothetical protein MIMGU_mgv1a011113mg [Erythranthe guttata]
Length=292

 Score =   161 bits (408),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 94/129 (73%), Gaps = 8/129 (6%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG +VVGTLFG RRG V FAFQED +  PAFLVELA PT VLV+EMASG VRIALEC+  
Sbjct  112  LGTKVVGTLFGQRRGHVRFAFQEDFKSNPAFLVELATPTSVLVKEMASGHVRIALECDKR  171

Query  345  TNTWEknkkkkk--------aKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPI  190
             +  +    K           K+LEEP W  YCNG+KCG+A RRECGPD+W+VLN++GPI
Sbjct  172  IDDKKTPTTKTATKRKKKRAVKILEEPFWSAYCNGKKCGYAVRRECGPDEWKVLNAVGPI  231

Query  189  TMGAGVLPG  163
            TMGAGVLP 
Sbjct  232  TMGAGVLPA  240


 Score = 64.7 bits (156),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 2/43 (5%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD--GHGGPELSIYLLRA  11
            E+MYMRAK+ERVVG  DS+AFYM++PD    G PELSIYLLR 
Sbjct  250  EIMYMRAKFERVVGCNDSQAFYMINPDDVSGGCPELSIYLLRV  292



>emb|CDY65924.1| BnaCnng49120D [Brassica napus]
Length=265

 Score =   159 bits (402),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 98/142 (69%), Gaps = 9/142 (6%)
 Frame = -2

Query  573  AVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVR  394
             + K+R AL F   S LG RV+GTLFG RRG V+FA Q+DP   PA L++L  PT +LV+
Sbjct  82   TIEKIRYALGFS-NSGLGFRVIGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSILVK  140

Query  393  EMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWR  214
            EMASG VRIALE   +             KLLEE  WRTYCNGRKCG+AAR+ECG  +WR
Sbjct  141  EMASGLVRIALETAASKT--------GSKKLLEESTWRTYCNGRKCGYAARKECGEAEWR  192

Query  213  VLNSIGPITMGAGVLPGKEDDG  148
            VL ++GPITMGAGVLP   D+G
Sbjct  193  VLKAVGPITMGAGVLPAVVDEG  214


 Score = 65.9 bits (159),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV GSRDSEAFYMM+ +G  GGPELS+Y LR 
Sbjct  224  ELMYMRARFERVTGSRDSEAFYMMNHEGSSGGPELSVYFLRV  265



>ref|XP_009395091.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   151 bits (382),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 94/141 (67%), Gaps = 13/141 (9%)
 Frame = -2

Query  570  VSKLRSALTFGIKS-----PLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTG  406
            VS+LRS L   I        +G RV GTLFG RRG V+FAFQ DPR  PA L+EL  PT 
Sbjct  81   VSRLRSVLAAAIAGRHRPVGIGPRVTGTLFGHRRGHVYFAFQVDPRACPAVLIELTTPTN  140

Query  405  VLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGP  226
             LVREMASG VRIALECE      +        KLLEEP WR Y NG+KCG+A RRECGP
Sbjct  141  TLVREMASGLVRIALECERRAGGGK--------KLLEEPLWRAYFNGKKCGYAVRRECGP  192

Query  225  DDWRVLNSIGPITMGAGVLPG  163
             +WRVL ++ P++ GAGVLPG
Sbjct  193  AEWRVLRAVEPVSTGAGVLPG  213


 Score = 73.2 bits (178),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS+DSEAFYMM+PD   GPELSIYLLR 
Sbjct  220  EMMYMRARFERVVGSKDSEAFYMMNPDNSAGPELSIYLLRV  260



>ref|XP_006395638.1| hypothetical protein EUTSA_v10004775mg [Eutrema salsugineum]
 gb|ESQ32924.1| hypothetical protein EUTSA_v10004775mg [Eutrema salsugineum]
Length=266

 Score =   150 bits (380),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 94/134 (70%), Gaps = 9/134 (7%)
 Frame = -2

Query  564  KLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMA  385
            ++R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLV+EMA
Sbjct  82   RIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVKEMA  140

Query  384  SGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLN  205
            SG VRIALE            K    KLLEE  WRTYCNG+KCG+AA++ECG  +WRVL 
Sbjct  141  SGLVRIALET--------AAFKTGSKKLLEESTWRTYCNGKKCGYAAKKECGEAEWRVLK  192

Query  204  SIGPITMGAGVLPG  163
            ++GPITMGAGVLP 
Sbjct  193  AVGPITMGAGVLPA  206


 Score = 73.2 bits (178),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PDG  GGPELS+Y LR 
Sbjct  225  ELMYMRARFERVIGSRDSEAFYMMNPDGSSGGPELSVYFLRV  266



>ref|XP_004953646.1| PREDICTED: uncharacterized protein LOC101766682 [Setaria italica]
Length=337

 Score =   145 bits (366),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALECEG  349
            LG+ V GT+FG RRGRVH A Q DPR  P  LVE+A   TG LVREM+SG VR+ALECE 
Sbjct  167  LGSCVTGTIFGRRRGRVHVALQTDPRSAPVLLVEMAAYSTGALVREMSSGLVRLALECEK  226

Query  348  NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVL  169
                      +K+  LLEEP WR YCNGRKCGFA RRECG D+WRVL ++ P+++GAGVL
Sbjct  227  TP----LAAGEKRRGLLEEPTWRAYCNGRKCGFAVRRECGADEWRVLGAVEPVSVGAGVL  282

Query  168  P  166
            P
Sbjct  283  P  283


 Score = 79.0 bits (193),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR
Sbjct  297  DLMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLR  336



>ref|XP_010547720.1| PREDICTED: protein MIZU-KUSSEI 1-like [Tarenaya hassleriana]
Length=239

 Score =   152 bits (385),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 104/153 (68%), Gaps = 7/153 (5%)
 Frame = -2

Query  582  RKTAVSKLRSALTF--GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            +  AVS+LRS +      +S LG+RVVGTLFG RRG VHFA Q+DP   PAFLVELA P 
Sbjct  47   QSIAVSRLRSVIASLSRNRSALGSRVVGTLFGSRRGHVHFAIQKDPTSPPAFLVELATPI  106

Query  408  GVLVREMASGPVRIALEC----EGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
              LV+EMASG VRIALEC    E +    E   +    +L+EEP WRTYCNG+KCGF AR
Sbjct  107  SGLVKEMASGLVRIALECDRPKEEDAGGGE-KTRMPSRRLVEEPLWRTYCNGKKCGFGAR  165

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            RECG  + +VL ++  ++MGAGVLP  E+ G G
Sbjct  166  RECGGKETKVLKALEMVSMGAGVLPETEESGAG  198


 Score = 71.2 bits (173),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ERVVGS DSEAFYMM+PD +G PELS+YLLR
Sbjct  199  DVMYMRAKFERVVGSPDSEAFYMMNPDSNGAPELSLYLLR  238



>ref|XP_008799422.1| PREDICTED: protein MIZU-KUSSEI 1-like [Phoenix dactylifera]
Length=201

 Score =   151 bits (382),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 94/140 (67%), Gaps = 6/140 (4%)
 Frame = -2

Query  564  KLRSALTFGIKSPLGARVV-GTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            +LRS LT  I       V+ GTLFG RRG V+ AFQ D R  PA L+ELA PT  LVREM
Sbjct  26   RLRSVLTAAIPGRWNRPVLTGTLFGHRRGHVNLAFQVDARSCPAVLIELATPTSTLVREM  85

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVL  208
            ASG  RIALECE             +A LLEEP WR YCNGRKCG+A RRECGP DW+VL
Sbjct  86   ASGLARIALECERKEEK-----TTPRAGLLEEPMWRAYCNGRKCGYAVRRECGPADWKVL  140

Query  207  NSIGPITMGAGVLPGKEDDG  148
             ++ P++MGAGVLPG + DG
Sbjct  141  RALEPVSMGAGVLPGDDPDG  160


 Score = 72.4 bits (176),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA++ERVVGS+DSEAFYM++PDG+ GPELS+YLLR 
Sbjct  161  DIMYMRARFERVVGSKDSEAFYMINPDGNTGPELSVYLLRV  201



>ref|XP_002454406.1| hypothetical protein SORBIDRAFT_04g030260 [Sorghum bicolor]
 gb|EES07382.1| hypothetical protein SORBIDRAFT_04g030260 [Sorghum bicolor]
Length=280

 Score =   144 bits (363),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 8/132 (6%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALECEG  349
            LG+ V GT+FG RRGRVH A Q DPR  P  LVE+A   TG LVREM+SG VR+ALECE 
Sbjct  112  LGSCVTGTIFGRRRGRVHVALQTDPRSAPVLLVEMAAYSTGALVREMSSGLVRLALECEK  171

Query  348  NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVL  169
                      +K+  LLEEP WR YCNGRKCGFA RRECG D+WRVL ++ P+++GAGVL
Sbjct  172  TP----LAAGEKRRGLLEEPTWRAYCNGRKCGFAVRRECGADEWRVLGAVEPVSVGAGVL  227

Query  168  PGKEDDGIGPTA  133
            P   DD  G  A
Sbjct  228  P---DDVAGAGA  236


 Score = 78.6 bits (192),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR
Sbjct  240  DLMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLR  279



>ref|XP_009129038.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
 emb|CDY46507.1| BnaA02g27570D [Brassica napus]
Length=265

 Score =   150 bits (380),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 96/141 (68%), Gaps = 9/141 (6%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            + K+R AL F   S LG RVVGTLFG R G V+FA Q+DP   PA L++L  PT +LV+E
Sbjct  80   IEKIRYALGFS-NSGLGFRVVGTLFGNRHGHVYFAVQDDPTRLPAVLIQLPTPTSILVKE  138

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            MASG VRIALE            K+   KLLEE  WRTYCNG+KCG++AR+ECG  +WRV
Sbjct  139  MASGLVRIALET--------AAFKRDSKKLLEESTWRTYCNGKKCGYSARKECGEAEWRV  190

Query  210  LNSIGPITMGAGVLPGKEDDG  148
            L ++GPITMGAGVLP     G
Sbjct  191  LKAVGPITMGAGVLPAAATAG  211


 Score = 71.6 bits (174),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV GSRDSEAFYMM+PDG  GGPELS+Y LR 
Sbjct  224  ELMYMRAQFERVTGSRDSEAFYMMNPDGSSGGPELSVYFLRV  265



>ref|XP_002872035.1| hypothetical protein ARALYDRAFT_910318 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48294.1| hypothetical protein ARALYDRAFT_910318 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   146 bits (368),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 99/161 (61%), Gaps = 21/161 (13%)
 Frame = -2

Query  573  AVSKLRSAL-TFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS + T     P      LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  67   AVSRLRSVIATLSRARPGNHNTGLGSRVVGTLFGSRRGHVHFSIQKDPNSPPAFLIELAT  126

Query  414  PTGVLVREMASGPVRIALECEGNTNTWE--------------knkkkkkaKLLEEPAWRT  277
            P   LV+EMASG VRIALEC+      E              K       +L+EEP WRT
Sbjct  127  PISGLVKEMASGLVRIALECDKGKEEVEGDEKNGTLRHGGGDKTTAAVSRRLVEEPIWRT  186

Query  276  YCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
            YCNG+KCGFA RREC   + +VL ++  ++MGAGVLP  E+
Sbjct  187  YCNGKKCGFATRRECAEKEKKVLKALKMVSMGAGVLPETEE  227


 Score = 76.3 bits (186),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  238  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  277



>ref|XP_006394578.1| hypothetical protein EUTSA_v10004740mg [Eutrema salsugineum]
 gb|ESQ31864.1| hypothetical protein EUTSA_v10004740mg [Eutrema salsugineum]
Length=281

 Score =   146 bits (368),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 101/160 (63%), Gaps = 20/160 (13%)
 Frame = -2

Query  573  AVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AVS+LRS +        G  S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA P
Sbjct  70   AVSRLRSVIASLSRARPGNNSGLGSRVVGTLFGSRRGHVHFSIQKDPTSPPAFLIELATP  129

Query  411  TGVLVREMASGPVRIALECEGNTNTW--------------EknkkkkkaKLLEEPAWRTY  274
               LV+EMASG VRIALEC+                    +K K     +L+EEP WRTY
Sbjct  130  ISGLVKEMASGLVRIALECDKAKEEEKEEGENGNRRHGGGDKTKTVIPRRLVEEPIWRTY  189

Query  273  CNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
            CNG+KCGFA RR+CG  + +VL ++  ++MGAGVLP  E+
Sbjct  190  CNGKKCGFATRRDCGEKEKKVLKALEMVSMGAGVLPDTEE  229


 Score = 75.9 bits (185),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  241  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  280



>ref|XP_010695769.1| PREDICTED: protein MIZU-KUSSEI 1 [Beta vulgaris subsp. vulgaris]
Length=275

 Score =   143 bits (360),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 100/155 (65%), Gaps = 10/155 (6%)
 Frame = -2

Query  576  TAVSKLRSALT-FGIKSP------LGA--RVVGTLFGFRRGRVHFAFQEDPRLGPAFLVE  424
             AVS++RS LT   I         LG+  +V+GTLFG+R+G VHF FQ +    P F +E
Sbjct  79   VAVSRIRSVLTALNINKSSSSFPNLGSSPKVIGTLFGYRKGHVHFVFQREHNTIPVFFIE  138

Query  423  LAMPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            LA P   LV+EMASG VRIALEC+      +K    K+ +LLEE  WRT+CNG+KCGFA 
Sbjct  139  LATPITNLVKEMASGLVRIALECDKQEEE-QKKNNNKRKRLLEEKIWRTFCNGKKCGFAT  197

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIGP  139
            +RE GP++ ++L  + PI+MGAGVLPG    G  P
Sbjct  198  KREIGPNEAKILKVVEPISMGAGVLPGFNGSGSSP  232


 Score = 79.0 bits (193),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ELMYMRA++ERVVGSRDSEAFYM++PD HG PELSIYLLR 
Sbjct  235  ELMYMRAQFERVVGSRDSEAFYMVNPDCHGAPELSIYLLRV  275



>gb|KFK27633.1| hypothetical protein AALP_AA8G408600 [Arabis alpina]
Length=266

 Score =   146 bits (369),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 100/153 (65%), Gaps = 17/153 (11%)
 Frame = -2

Query  573  AVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            AVS+LRS +        G  + LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA P
Sbjct  60   AVSRLRSVIASLSRSKPGNNTGLGSRVVGTLFGSRRGHVHFSIQKDPTSPPAFLIELATP  119

Query  411  TGVLVREMASGPVRIALEC------EGNTNTW-----EknkkkkkaKLLEEPAWRTYCNG  265
               LV+EMASG VRIALEC      E N N       +        +L+EEP WRTYCNG
Sbjct  120  ISGLVKEMASGLVRIALECDKEKLQEQNGNHRHGGGDKTKTVVVPRRLVEEPIWRTYCNG  179

Query  264  RKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            +KCGFA+RR+CG  + +VL ++  ++MGAGVLP
Sbjct  180  KKCGFASRRDCGEKEKKVLKALEMVSMGAGVLP  212


 Score = 75.5 bits (184),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  227  IMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  265



>ref|XP_006290275.1| hypothetical protein CARUB_v10017795mg, partial [Capsella rubella]
 gb|EOA23173.1| hypothetical protein CARUB_v10017795mg, partial [Capsella rubella]
Length=280

 Score =   150 bits (379),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 102/146 (70%), Gaps = 9/146 (6%)
 Frame = -2

Query  561  LRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMAS  382
            +R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLVREMAS
Sbjct  97   IRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVREMAS  155

Query  381  GPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNS  202
            G VRIALE      T       KK KLLEE +WRTYCNG+KCG+AAR+ECG  +W+VL +
Sbjct  156  GLVRIALE------TAAFKTDTKKKKLLEESSWRTYCNGKKCGYAARKECGEAEWKVLKA  209

Query  201  IGPITMGAGVLPGK--EDDGIGPTAS  130
            +GPITMGAGVLP    E++G G   S
Sbjct  210  VGPITMGAGVLPAATVEEEGNGAVGS  235


 Score = 71.2 bits (173),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GSRDSEAFYMM+PD   GGPELS+Y LR 
Sbjct  239  ELMYMRARFERVIGSRDSEAFYMMNPDVSSGGPELSVYFLRV  280



>emb|CDX99760.1| BnaC02g35600D [Brassica napus]
Length=262

 Score =   150 bits (378),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 92/133 (69%), Gaps = 9/133 (7%)
 Frame = -2

Query  543  FGIKSP-LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
             G  SP LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT +LV+EMASG VRI
Sbjct  84   LGFSSPSLGFRVVGTLFGSRRGHVYFAVQDDPTRLPAVLIQLPTPTSILVKEMASGLVRI  143

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALE            K    KLLEE +WRTYCNG+KCG++AR+ECG  +WRVL ++GPIT
Sbjct  144  ALET--------AAFKTDSKKLLEESSWRTYCNGKKCGYSARKECGEAEWRVLKAVGPIT  195

Query  186  MGAGVLPGKEDDG  148
            MGAGVLP     G
Sbjct  196  MGAGVLPAAATAG  208


 Score = 71.6 bits (174),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLRA  11
            ELMYMRA++ERV GSRDSEAFYMM+PDG  GGPELS+Y LR 
Sbjct  221  ELMYMRAQFERVTGSRDSEAFYMMNPDGSSGGPELSVYFLRV  262



>ref|XP_008675294.1| PREDICTED: protein MIZU-KUSSEI 1-like [Zea mays]
 tpg|DAA58369.1| TPA: hypothetical protein ZEAMMB73_642874 [Zea mays]
Length=290

 Score =   149 bits (377),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 99/157 (63%), Gaps = 11/157 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            + AVS+LR+AL   I     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  89   RAAVSRLRTALASAIAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPAVLLELAA  148

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkka------KLLEEPAWRTYCNGRKCG  253
            PT  LVREMASG VRIALEC+        +            KL+EE  WR YCNG+ CG
Sbjct  149  PTASLVREMASGLVRIALECDRAKGACALSSAAAATNGGGCRKLVEEKVWRAYCNGKGCG  208

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            +A RRECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  209  YAVRRECGAADWRVLRALEPVSMGAGVIPAACGGGEG  245


 Score = 72.0 bits (175),  Expect(2) = 9e-49, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 4/44 (9%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD----GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD    G+GGPELSIYLLR
Sbjct  246  DVMYMRARFERVVGSRDSEAFYMMNPDSSAGGNGGPELSIYLLR  289



>ref|XP_010454591.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
Length=289

 Score =   146 bits (368),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 98/162 (60%), Gaps = 26/162 (16%)
 Frame = -2

Query  573  AVSKLRSAL-TFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS + T     P      LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  76   AVSRLRSVIATLSRARPGHHHSGLGSRVVGTLFGSRRGHVHFSIQKDPNSPPAFLIELAT  135

Query  414  PTGVLVREMASGPVRIALECE-------------------GNTNTWEknkkkkkaKLLEE  292
            P   LV+EMASG VRIALEC+                   G   T          +L+EE
Sbjct  136  PISGLVKEMASGLVRIALECDKGKEEDEGEEEKIKTLRHGGGDKTKTATATAISRRLVEE  195

Query  291  PAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            P WRTYCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP
Sbjct  196  PMWRTYCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLP  237


 Score = 75.1 bits (183),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  250  VMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  288



>ref|XP_009136391.1| PREDICTED: protein MIZU-KUSSEI 1 [Brassica rapa]
Length=278

 Score =   145 bits (366),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 101/164 (62%), Gaps = 21/164 (13%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  68   AVSRLRSVIASLSRARPGNNNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSPPAFLIELAT  127

Query  414  PTGVLVREMASGPVRIALECEGNTNTW--------------EknkkkkkaKLLEEPAWRT  277
            P   LV+EMASG VRIALEC+                    +K K     +L+EEP WRT
Sbjct  128  PISGLVKEMASGLVRIALECDKAKEEEKEEGEKGRRRHGGGDKTKAAVPRRLVEEPTWRT  187

Query  276  YCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGI  145
            YCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP  E+  +
Sbjct  188  YCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLPETEETSV  231


 Score = 75.9 bits (185),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  238  DVMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  277



>dbj|BAK00452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=258

 Score =   141 bits (355),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 99/153 (65%), Gaps = 15/153 (10%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            +R  A+++LRS     I     +  LG+ V GT+FG RRGRVH A Q DPR  P  LVE+
Sbjct  66   KRADALARLRSVFLAAITHRRRRRQLGSCVTGTIFGRRRGRVHVALQTDPRSAPVLLVEM  125

Query  420  A-MPTGVLVREMASGPVRIALECEGN-TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFA  247
            A   TG LVREM+SG VR+ALECE    N  EK +      LLEEP WR YCNG KCG+A
Sbjct  126  AAYSTGALVREMSSGLVRLALECEKPPLNAGEKRRP-----LLEEPTWRAYCNGLKCGYA  180

Query  246  ARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
              RECG D+WRVL ++  +++GAGVLP   DDG
Sbjct  181  VHRECGADEWRVLGAVEQVSVGAGVLP---DDG  210


 Score = 79.7 bits (195),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRAK+ERVVGSRDSEAFYMM+PDG GGPELSIYLLR 
Sbjct  218  DLMYMRAKFERVVGSRDSEAFYMMNPDGSGGPELSIYLLRV  258



>ref|NP_001151133.1| LOC100284766 [Zea mays]
 gb|ACG41726.1| plant-specific domain TIGR01570 family protein [Zea mays]
 gb|AFW63574.1| plant-specific domain TIGR01570 family protein [Zea mays]
Length=281

 Score =   142 bits (359),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 101/154 (66%), Gaps = 13/154 (8%)
 Frame = -2

Query  573  AVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MP  412
            A+++LR+     I     +  LG+ V GT+FG RRGRVH A Q DPR  P  LVE+A   
Sbjct  87   ALARLRALFLAAITHRRRRRQLGSCVTGTIFGRRRGRVHVALQTDPRSPPVLLVEMAAYS  146

Query  411  TGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARREC  232
            TG LVREM+SG VR+ALECE           +K+  LLEEP WR YCNGRKCGFA RR+C
Sbjct  147  TGALVREMSSGLVRLALECEKPP----LAAGEKRRGLLEEPTWRAYCNGRKCGFAVRRDC  202

Query  231  GPDDWRVLNSIGPITMGAGVLPGKEDDGIGPTAS  130
            G D+WRVL ++ P+++GAGVLP   DD +  + S
Sbjct  203  GADEWRVLGAVEPVSVGAGVLP---DDDVAGSVS  233


 Score = 78.2 bits (191),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR
Sbjct  241  DLMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLR  280



>ref|NP_197701.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09827.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAQ62428.1| At5g23100 [Arabidopsis thaliana]
 dbj|BAD93939.1| putative protein [Arabidopsis thaliana]
 gb|AED93122.1| uncharacterized protein AT5G23100 [Arabidopsis thaliana]
Length=277

 Score =   145 bits (365),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 99/165 (60%), Gaps = 25/165 (15%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  63   AVSRLRSVIATLSRARPGNQNSGLGSRVVGTLFGSRRGHVHFSIQKDPNSPPAFLIELAT  122

Query  414  PTGVLVREMASGPVRIALECE------------------GNTNTWEknkkkkkaKLLEEP  289
            P   LV+EMASG VRIALEC+                  G   T          +L+EEP
Sbjct  123  PISGLVKEMASGLVRIALECDKGKEEEEGEEKNGTLRHGGGDKTKTTTTAAVSRRLVEEP  182

Query  288  AWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
             WRTYCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP  E+
Sbjct  183  MWRTYCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLPETEE  227


 Score = 75.5 bits (184),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  237  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  276



>ref|XP_009393601.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   146 bits (369),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 7/145 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGIK------SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA  418
            +TAVS+L S L           + LG  V GTL+G+RRG VH AFQ D +  P  LVELA
Sbjct  88   ETAVSRLLSVLAAAASGRRNRSTGLGVYVTGTLYGYRRGYVHLAFQTDSKSCPVVLVELA  147

Query  417  MPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR  238
             PT  LVREMASG VRIALEC+    +     K    +L+EEP WR+Y NG+KCG+A +R
Sbjct  148  TPTSTLVREMASGLVRIALECDRKARS-GGGGKAASTRLVEEPLWRSYINGKKCGYAVQR  206

Query  237  ECGPDDWRVLNSIGPITMGAGVLPG  163
             CGP DW++L ++ P++MGAGV+PG
Sbjct  207  NCGPADWKLLRAVEPVSMGAGVIPG  231


 Score = 73.9 bits (180),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA++ERVVGS+DSEAFYMM+PDGHG  ELS+YLLR 
Sbjct  242  DVMYMRARFERVVGSKDSEAFYMMNPDGHGSTELSVYLLRV  282



>ref|XP_010522225.1| PREDICTED: protein MIZU-KUSSEI 1-like [Tarenaya hassleriana]
Length=266

 Score =   145 bits (366),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 99/149 (66%), Gaps = 10/149 (7%)
 Frame = -2

Query  582  RKTAVSKLRSALTF------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL  421
            +  AVS+LRS +        G +S LG+RVVGTLFG RRG VHFA Q+D    PAFLVEL
Sbjct  60   QSVAVSRLRSVIASLSRTRPGSQSGLGSRVVGTLFGSRRGHVHFAIQKDSTSPPAFLVEL  119

Query  420  AMPTGVLVREMASGPVRIALEC----EGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            A P   LV+EMASG VRIALEC    E +     +  +    +L+EEP WRTYCNG+K G
Sbjct  120  ATPISGLVKEMASGLVRIALECSKPNEVDAGGGAEKTRLPSRRLVEEPLWRTYCNGKKSG  179

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLP  166
            FA RRECG  + +VL ++  I+MGAGVLP
Sbjct  180  FATRRECGEKETKVLKALEMISMGAGVLP  208


 Score = 75.1 bits (183),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  226  DVMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  265



>gb|KFK35071.1| hypothetical protein AALP_AA5G231600 [Arabis alpina]
Length=260

 Score =   150 bits (379),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 92/132 (70%), Gaps = 9/132 (7%)
 Frame = -2

Query  558  RSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASG  379
            R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT VLV+EMASG
Sbjct  79   RYALGF-TNSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTSVLVKEMASG  137

Query  378  PVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSI  199
             VRIALE            K    KLLEE  WRTYCNG+KCG+AAR+ECG  +WRVL ++
Sbjct  138  IVRIALETAA--------FKTGSKKLLEESTWRTYCNGKKCGYAARKECGEAEWRVLKAV  189

Query  198  GPITMGAGVLPG  163
            GPITMGAGVLP 
Sbjct  190  GPITMGAGVLPA  201


 Score = 70.1 bits (170),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-GHGGPELSIYLLRA  11
            ELMYMRA++ERV+GS+DSEAFYMM+PD   GGPELS+Y LR 
Sbjct  219  ELMYMRARFERVIGSKDSEAFYMMNPDVSSGGPELSVYFLRV  260



>ref|XP_002436989.1| hypothetical protein SORBIDRAFT_10g013960 [Sorghum bicolor]
 gb|EER88356.1| hypothetical protein SORBIDRAFT_10g013960 [Sorghum bicolor]
Length=312

 Score =   142 bits (359),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 107/173 (62%), Gaps = 21/173 (12%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIKS--------PLGA--RVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            RR  A+S+LRSA+   +          PLG+   V GT+FG RRGRVH A Q DPR  PA
Sbjct  95   RRSEALSRLRSAILAVLARARRGRGRRPLGSCDTVTGTIFGRRRGRVHLALQTDPRAPPA  154

Query  435  FLVELA-MPTGVLVREMASGPVRIALECEGN----------TNTWEknkkkkkaKLLEEP  289
             +VELA   TG LVREMASG VR+ALECE                ++  +++ A L+EE 
Sbjct  155  LMVELAAYSTGALVREMASGLVRLALECEKEKAPAPPLQTGDRHHQRRPRQQAAALVEEA  214

Query  288  AWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIGPTAS  130
             WR YCNGRKCG+A RR+CG D+WRVL ++ P+++GAGVLP   +     TA+
Sbjct  215  TWRAYCNGRKCGYAVRRDCGADEWRVLRAVEPVSVGAGVLPDGNNMSTEATAA  267


 Score = 77.8 bits (190),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +LMYMRAK+ERVVGSRDSEAFYM++PDG GGPELSIYLLR
Sbjct  272  DLMYMRAKFERVVGSRDSEAFYMVNPDGGGGPELSIYLLR  311



>ref|XP_004969290.1| PREDICTED: uncharacterized protein LOC101782167 [Setaria italica]
Length=288

 Score =   148 bits (374),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 101/159 (64%), Gaps = 13/159 (8%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   I     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  85   RTAVSRLRTALAAAIAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  144

Query  414  PTGVLVREMASGPVRIALECE--------GNTNTWEknkkkkkaKLLEEPAWRTYCNGRK  259
            PT  LVREMASG VRIALEC+         +  +   N      KL+EE  WR YCNG+ 
Sbjct  145  PTASLVREMASGLVRIALECDRAKAACALPSAASAASNSGGAGRKLVEEKVWRAYCNGKG  204

Query  258  CGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            CG+A RRECG  DWRVL ++  ++MGAGV+P     G G
Sbjct  205  CGYAVRRECGAADWRVLRALEAVSMGAGVIPAACGGGEG  243


 Score = 72.0 bits (175),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 4/44 (9%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD----GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD    G+GGPELSIYLLR
Sbjct  244  DVMYMRARFERVVGSRDSEAFYMMNPDSSTGGNGGPELSIYLLR  287



>dbj|BAD07762.1| unknown protein [Oryza sativa Japonica Group]
Length=290

 Score =   141 bits (356),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 7/122 (6%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALECEG  349
            LG+ + GT+FG RRGRVH A Q D R  P  LVE+A   TG LVREM+SG VR+ALECE 
Sbjct  121  LGSSLTGTIFGRRRGRVHVALQTDTRSPPVLLVEMAAYSTGALVREMSSGLVRLALECEK  180

Query  348  N-TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGV  172
               N  EK +      LLEEP WR YCNGRKCGFA RRECG D+WRVL ++ P+++GAGV
Sbjct  181  QPINPGEKRRA-----LLEEPTWRAYCNGRKCGFAVRRECGADEWRVLGAVEPVSVGAGV  235

Query  171  LP  166
            LP
Sbjct  236  LP  237


 Score = 78.6 bits (192),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR 
Sbjct  250  DLMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLRV  290



>dbj|BAJ95925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   157 bits (396),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 101/153 (66%), Gaps = 7/153 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   I     +  LG+R+ GTL+G RRG VH AFQ DPR  PA L+EL  
Sbjct  94   RTAVSRLRTALAAAISGRHRQVGLGSRLTGTLYGHRRGHVHLAFQVDPRACPALLLELTA  153

Query  414  PTGVLVREMASGPVRIALECEGN--TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            PT  LVREMASG VRIALECE +   + +         KLLEE  WR YCNG+ CG+A R
Sbjct  154  PTASLVREMASGLVRIALECERSKGASAFPGTTATGGRKLLEETVWRAYCNGKGCGYAVR  213

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            RECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  214  RECGAADWRVLRALEPVSMGAGVIPASCGGGEG  246


 Score = 63.2 bits (152),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 7/47 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHG-------GPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYM++PD          GPELS+YLLR
Sbjct  247  DVMYMRARFERVVGSRDSEAFYMINPDSSSSSNANSVGPELSVYLLR  293



>gb|EAZ24353.1| hypothetical protein OsJ_08106 [Oryza sativa Japonica Group]
Length=291

 Score =   141 bits (355),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 7/122 (6%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALECEG  349
            LG+ + GT+FG RRGRVH A Q D R  P  LVE+A   TG LVREM+SG VR+ALECE 
Sbjct  122  LGSSLTGTIFGRRRGRVHVALQTDTRSPPVLLVEMAAYSTGALVREMSSGLVRLALECEK  181

Query  348  N-TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGV  172
               N  EK +      LLEEP WR YCNGRKCGFA RRECG D+WRVL ++ P+++GAGV
Sbjct  182  QPINPGEKRRA-----LLEEPTWRAYCNGRKCGFAVRRECGADEWRVLGAVEPVSVGAGV  236

Query  171  LP  166
            LP
Sbjct  237  LP  238


 Score = 78.6 bits (192),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR 
Sbjct  251  DLMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLRV  291



>emb|CDM83526.1| unnamed protein product [Triticum aestivum]
Length=296

 Score =   154 bits (389),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 99/157 (63%), Gaps = 11/157 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   I     +  LG+R+ GTL+G RRG VH AFQ DPR  PA L+EL  
Sbjct  94   RTAVSRLRTALAAAISGRHRQVSLGSRLTGTLYGHRRGHVHLAFQVDPRACPALLLELTA  153

Query  414  PTGVLVREMASGPVRIALECEGNTNT------WEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            PT  LVREMASG VRIALECE +                   KLLEE  WR YCNG+ CG
Sbjct  154  PTASLVREMASGLVRIALECERSKGASAFPGTTGGAGVGAGRKLLEETVWRAYCNGKGCG  213

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            +A RRECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  214  YAVRRECGAADWRVLRALEPVSMGAGVIPASCGGGEG  250


 Score = 65.1 bits (157),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 5/45 (11%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHG-----GPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYM++PD        GPELS+YLLR
Sbjct  251  DVMYMRARFERVVGSRDSEAFYMINPDSSSNANSVGPELSVYLLR  295



>ref|NP_001056405.2| Os05g0577100 [Oryza sativa Japonica Group]
 gb|EAY99149.1| hypothetical protein OsI_21108 [Oryza sativa Indica Group]
 dbj|BAF18319.2| Os05g0577100 [Oryza sativa Japonica Group]
Length=297

 Score =   157 bits (398),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 99/152 (65%), Gaps = 8/152 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LRSAL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  94   RTAVSRLRSALAAAVTGRHRQVGLGARLTGTLYGHRRGHVHLAFQLDPRACPALLLELAA  153

Query  414  PTGVLVREMASGPVRIALECE---GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            PT  LVREMASG VRIALECE   G              +LLEE  WR YCNG+ CG+A 
Sbjct  154  PTAALVREMASGLVRIALECERAKGGPAPALPTATGGGKRLLEETVWRAYCNGKSCGYAV  213

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            RRECG  DWRVL ++ P++MGAGV+P     G
Sbjct  214  RRECGAADWRVLRALEPVSMGAGVIPAASCGG  245


 Score = 61.2 bits (147),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 8/48 (17%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD--------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD          GGPELS+YLLR
Sbjct  249  DVMYMRARFERVVGSRDSEAFYMMNPDSTSTSSNSNSGGPELSVYLLR  296



>ref|XP_009390951.1| PREDICTED: protein MIZU-KUSSEI 1-like [Musa acuminata subsp. 
malaccensis]
Length=285

 Score =   144 bits (364),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGI------KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
             AVS+LRS L           + LGA V GTL+G RRG VH AFQ D +  P  LVELA 
Sbjct  91   AAVSRLRSLLAAAPFLRRNRMAGLGAHVTGTLYGHRRGHVHLAFQADSKSCPVVLVELAT  150

Query  414  PTGVLVREMASGPVRIALECE---GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
             T  LVREMASG VRI+LECE   G      +       +L+EEP WR Y NG+KCGFA 
Sbjct  151  ATSALVREMASGLVRISLECERKSGGGGEKAETTTTTATRLVEEPLWRAYVNGKKCGFAV  210

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPG  163
            +R+CGP DW+VL ++ P++MGAGV+PG
Sbjct  211  QRDCGPADWKVLRAVEPVSMGAGVIPG  237


 Score = 74.3 bits (181),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRA++ERVVGS+DSEAFYMM+PD +GGPELS+YLLR
Sbjct  245  DVMYMRARFERVVGSKDSEAFYMMNPDNNGGPELSVYLLR  284



>ref|XP_006288391.1| hypothetical protein CARUB_v10001643mg [Capsella rubella]
 gb|EOA21289.1| hypothetical protein CARUB_v10001643mg [Capsella rubella]
Length=284

 Score =   144 bits (363),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 97/161 (60%), Gaps = 25/161 (16%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  71   AVSRLRSVIASLSRARPGNHHSGLGSRVVGTLFGSRRGHVHFSIQKDPNSSPAFLIELAT  130

Query  414  PTGVLVREMASGPVRIALECE------------------GNTNTWEknkkkkkaKLLEEP  289
            P   LV+EMASG VRIALEC+                  G   T          +L+EEP
Sbjct  131  PISGLVKEMASGLVRIALECDKGKEEEEGEEKNKTLRHGGGDKTKTTTATASSRRLVEEP  190

Query  288  AWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
             WRTYCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP
Sbjct  191  MWRTYCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLP  231


 Score = 74.3 bits (181),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  245  VMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  283



>ref|XP_003567838.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brachypodium distachyon]
Length=312

 Score =   157 bits (396),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 99/153 (65%), Gaps = 9/153 (6%)
 Frame = -2

Query  576  TAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMP  412
            TAV+++RSAL+  +     +  +GAR+ GTL+G RRG VH AFQ DPR  PA L+ELA P
Sbjct  110  TAVARIRSALSAAVSGRRRQVGMGARLAGTLYGHRRGHVHLAFQVDPRACPALLLELAAP  169

Query  411  TGVLVREMASGPVRIALECE----GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            T  LVREMASG VRIALECE                   +L+EE  WR Y NGR CGFAA
Sbjct  170  TAALVREMASGLVRIALECERGKPKGGAGAGDEGGGGGRRLVEETVWRAYVNGRSCGFAA  229

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDGI  145
            RRECG  DWRVL ++ P++MGAGV+P     GI
Sbjct  230  RRECGAADWRVLRALEPVSMGAGVIPAASGGGI  262


 Score = 61.6 bits (148),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 7/47 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD        +GGPELS+YLLR
Sbjct  265  DVMYMRARFERVVGSRDSEAFYMMNPDNSSGGGGNNGGPELSVYLLR  311



>ref|XP_008659519.1| PREDICTED: protein MIZU-KUSSEI 1 [Zea mays]
Length=316

 Score =   142 bits (359),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 104/162 (64%), Gaps = 18/162 (11%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIKS--------PLG--ARVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            R   A+S+LRSA+   +          PLG  A V GT+FG RRGRVH A Q DPR  PA
Sbjct  103  RHGEALSRLRSAILAVLARARRGRGRRPLGSCATVTGTIFGRRRGRVHLALQTDPRAPPA  162

Query  435  FLVELA-MPTGVLVREMASGPVRIALECE-------GNTNTWEknkkkkkaKLLEEPAWR  280
             +VELA   TG LVREMASG VR+ALECE          +   + + +++  L+EE  WR
Sbjct  163  LMVELAAYSTGALVREMASGLVRLALECEKAPAPPKQTGDHHHQRRPRQQTALVEEATWR  222

Query  279  TYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
             YCNGRKCG+A RR+CG D+WRVL ++ P+++GAGVLP  ++
Sbjct  223  AYCNGRKCGYALRRDCGADEWRVLRAVEPVSVGAGVLPDGDN  264


 Score = 75.9 bits (185),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +LMYMRAK+ERVVGSRDSEAFYM++PDG  GPELSIYLLR
Sbjct  276  DLMYMRAKFERVVGSRDSEAFYMLNPDGGTGPELSIYLLR  315



>ref|XP_010493423.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
Length=288

 Score =   143 bits (361),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 98/162 (60%), Gaps = 26/162 (16%)
 Frame = -2

Query  573  AVSKLRSAL-TFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS + T     P      LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  75   AVSRLRSVIATLSRARPGHHHSGLGSRVVGTLFGSRRGHVHFSIQKDPNSPPAFLIELAT  134

Query  414  PTGVLVREMASGPVRIALECE-------------------GNTNTWEknkkkkkaKLLEE  292
            P   LV+EMASG VRIALEC+                   G+             +L+EE
Sbjct  135  PISGLVKEMASGLVRIALECDKGKEEDEGEEKNKTLRHGGGDKTKTTTATAAISRRLVEE  194

Query  291  PAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            P WRTYCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP
Sbjct  195  PMWRTYCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLP  236


 Score = 74.7 bits (182),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  249  VMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  287



>ref|XP_004961132.1| PREDICTED: uncharacterized protein LOC101773620 [Setaria italica]
Length=301

 Score =   154 bits (389),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 98/154 (64%), Gaps = 10/154 (6%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LRSAL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  97   RTAVSRLRSALANAVAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  156

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkk-----kkaKLLEEPAWRTYCNGRKCGF  250
            PT  LVREMASG VRIALECE    +               KLLEE  WR YCNG+ CG+
Sbjct  157  PTAALVREMASGLVRIALECERAKGSALPTPTAGPNGGNGKKLLEETVWRAYCNGKSCGY  216

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            A RREC   DWRVL ++ P++MGAGV+P     G
Sbjct  217  AVRRECSAADWRVLRALEPVSMGAGVIPAASCGG  250


 Score = 63.2 bits (152),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 7/47 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHG-------GPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD          GPELS+YLLR
Sbjct  254  DVMYMRARFERVVGSRDSEAFYMMNPDNSSGGGGGHGGPELSVYLLR  300



>ref|XP_003569437.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brachypodium distachyon]
Length=307

 Score =   153 bits (387),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 99/153 (65%), Gaps = 7/153 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+EL  
Sbjct  105  RTAVSRLRTALAAAMAGRRRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELTA  164

Query  414  PTGVLVREMASGPVRIALECEGNT--NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAAR  241
            PT  LVREMASG VRIALECE +               KL+EE  WR YCNG+ CG+A R
Sbjct  165  PTASLVREMASGLVRIALECERSKGFQAGAGTTTCGGRKLVEETVWRAYCNGKGCGYAVR  224

Query  240  RECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            RECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  225  RECGAADWRVLRALEPVSMGAGVIPASCGGGEG  257


 Score = 63.9 bits (154),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 9/49 (18%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHG---------GPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD            GPELS+YLLR
Sbjct  258  DVMYMRARFERVVGSRDSEAFYMMNPDSSNNGGGSSSSIGPELSVYLLR  306



>dbj|BAJ99442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   155 bits (392),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 99/144 (69%), Gaps = 6/144 (4%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAV++LRSAL+  +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  103  RTAVARLRSALSAAVSGRRRQVGLGARLTGTLYGHRRGHVHLAFQTDPRACPALLLELAA  162

Query  414  PTGVLVREMASGPVRIALECE-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR  238
            PTG LVREMASG VRIALECE     T          +L+EE  WR Y NG+ CG+A RR
Sbjct  163  PTGALVREMASGLVRIALECERAKAATGGAGGDGGGRRLVEETVWRAYVNGKSCGYAVRR  222

Query  237  ECGPDDWRVLNSIGPITMGAGVLP  166
            ECG  DWRVL ++ P++MGAGV+P
Sbjct  223  ECGGADWRVLRALEPVSMGAGVIP  246


 Score = 61.6 bits (148),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 7/47 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD        +GGPELS+YLLR
Sbjct  256  DVMYMRARFERVVGSRDSEAFYMMNPDSSSSGSGINGGPELSVYLLR  302



>ref|XP_002533439.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28946.1| conserved hypothetical protein [Ricinus communis]
Length=276

 Score =   139 bits (350),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              IKS LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  100  LSIKSSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLLLELAMSTSTLVKEMSSGLVRIA  159

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LEC+            +  KL  EP W  YCNGRKCG+A  R C   DW VLN++  +++
Sbjct  160  LECD---KVQVPTNGTRSGKLFNEPTWTMYCNGRKCGYAVSRTCTELDWHVLNTVQSVSV  216

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  217  GAGVIPMVED  226


 Score = 77.8 bits (190),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+P+G+GGPELSI+LLR
Sbjct  236  ELLYMRAKFERVVGSRDSEAFYMMNPEGNGGPELSIFLLR  275



>ref|XP_002441565.1| hypothetical protein SORBIDRAFT_09g029410 [Sorghum bicolor]
 gb|EES19995.1| hypothetical protein SORBIDRAFT_09g029410 [Sorghum bicolor]
Length=322

 Score =   154 bits (390),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 99/156 (63%), Gaps = 17/156 (11%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LRSAL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  108  RTAVSRLRSALANAVAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  167

Query  414  PTGVLVREMASGPVRIALECE------------GNTNTWEknkkkkkaKLLEEPAWRTYC  271
            PT  LVREMASG VRIALECE             +     +       KL+EE  WR YC
Sbjct  168  PTAALVREMASGLVRIALECERAKGSSAAAASLPSPGAAGRGPGGGGKKLVEETVWRAYC  227

Query  270  NGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            NG+ CG+A RRECG  DWRVL ++ P++MGAGV+P 
Sbjct  228  NGKSCGYAVRRECGAADWRVLRALEPVSMGAGVIPA  263


 Score = 62.0 bits (149),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 10/50 (20%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHG----------GPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD             GPELS+YLLR
Sbjct  272  DVMYMRARFERVVGSRDSEAFYMMNPDNSSGAGHGGGGHGGPELSVYLLR  321



>emb|CDY02205.1| BnaA03g39620D [Brassica napus]
Length=280

 Score =   140 bits (354),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 100/164 (61%), Gaps = 21/164 (13%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  68   AVSRLRSVIASLSRARPGNNNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSPPAFLIELAT  127

Query  414  PTGVLVREMASGPVRIALECEGNTNTW--------------EknkkkkkaKLLEEPAWRT  277
            P   LV+EMASG VRIALEC+                    +K K     +L+EEP WRT
Sbjct  128  PISGLVKEMASGLVRIALECDKAKEEEKEEGEKGRRRHGGGDKTKAAVPRRLVEEPTWRT  187

Query  276  YCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGI  145
            YCNG+KCGFA RRE G  + +VL ++  ++MGAGVLP  E+  +
Sbjct  188  YCNGKKCGFATRREGGEKEKKVLKALEMVSMGAGVLPETEETSV  231


 Score = 75.9 bits (185),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  240  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  279



>ref|XP_010044306.1| PREDICTED: protein MIZU-KUSSEI 1 [Eucalyptus grandis]
 gb|KCW86386.1| hypothetical protein EUGRSUZ_B03065 [Eucalyptus grandis]
Length=280

 Score =   144 bits (363),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 103/154 (67%), Gaps = 13/154 (8%)
 Frame = -2

Query  570  VSKLRSAL-TFGIK-SPLGA----RVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            + KLRSAL  FG K S   A     VVGTLFG RRG VHFAFQ+DP   PAF+++LAMPT
Sbjct  80   LPKLRSALHLFGKKRSKFHAMRRTHVVGTLFGNRRGHVHFAFQDDPSSAPAFMIQLAMPT  139

Query  408  GVLVREMASGPVRIALECE-------GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGF  250
             VLVREMASG VRIALEC+             +KNKKK   KL EE  W TYCNGRKCG+
Sbjct  140  SVLVREMASGLVRIALECDKKATAAAAEAAKKKKNKKKNGGKLTEEAVWTTYCNGRKCGY  199

Query  249  AARRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            A R ECG ++ +VL ++  +TMGAGVLP  E D 
Sbjct  200  ALRSECGEEEEKVLRALEVVTMGAGVLPADEGDA  233


 Score = 72.4 bits (176),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ERVVGS DSEAFYM+SPDG GGPELS+YLLR 
Sbjct  240  EMMYMRARFERVVGSGDSEAFYMVSPDGGGGPELSLYLLRV  280



>gb|AFW86551.1| hypothetical protein ZEAMMB73_410633 [Zea mays]
Length=240

 Score =   141 bits (356),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 104/162 (64%), Gaps = 18/162 (11%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIKS--------PLG--ARVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            R   A+S+LRSA+   +          PLG  A V GT+FG RRGRVH A Q DPR  PA
Sbjct  27   RHGEALSRLRSAILAVLARARRGRGRRPLGSCATVTGTIFGRRRGRVHLALQTDPRAPPA  86

Query  435  FLVELA-MPTGVLVREMASGPVRIALECE-------GNTNTWEknkkkkkaKLLEEPAWR  280
             +VELA   TG LVREMASG VR+ALECE          +   + + +++  L+EE  WR
Sbjct  87   LMVELAAYSTGALVREMASGLVRLALECEKAPAPPKQTGDHHHQRRPRQQTALVEEATWR  146

Query  279  TYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
             YCNGRKCG+A RR+CG D+WRVL ++ P+++GAGVLP  ++
Sbjct  147  AYCNGRKCGYALRRDCGADEWRVLRAVEPVSVGAGVLPDGDN  188


 Score = 74.7 bits (182),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRAK+ERVVGSRDSEAFYM++PDG  GPELSIYLLR 
Sbjct  200  DLMYMRAKFERVVGSRDSEAFYMLNPDGGTGPELSIYLLRV  240



>ref|XP_006350176.1| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum tuberosum]
Length=282

 Score =   135 bits (341),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
            F I   LG +V GTLFG RRG V FA Q+DP+  P  L+ELA+ T  LV+EM+SG VRIA
Sbjct  106  FSITPSLGRKVTGTLFGHRRGHVSFAVQDDPKSDPVLLIELAVSTSSLVKEMSSGLVRIA  165

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE    T      +K+  L EEP W  YCNGRKCG+A  R C   DW VL+++  +++
Sbjct  166  LECE---KTAAPGGSRKRLGLFEEPMWTMYCNGRKCGYATSRLCTDSDWHVLSTVQSVSV  222

Query  183  GAGVLPGKED  154
            GAGV+P  +D
Sbjct  223  GAGVIPVVDD  232


 Score = 79.7 bits (195),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  242  ELLYMRAKFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  281



>ref|XP_004236600.1| PREDICTED: protein MIZU-KUSSEI 1-like [Solanum lycopersicum]
Length=281

 Score =   135 bits (341),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
            F I   LG +V GTLFG RRG V FA Q+DP+  P  L+ELA+ T  LV+EM+SG VRIA
Sbjct  105  FSITPSLGRKVTGTLFGHRRGHVSFAVQDDPKSDPVLLIELAVSTSSLVKEMSSGLVRIA  164

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE    T      +++  L EEP W  YCNGRKCG+A  R C   DW VL+++  +++
Sbjct  165  LECE---KTAAPGGSRRRLGLFEEPMWTMYCNGRKCGYATSRLCTDSDWHVLSTVQSVSV  221

Query  183  GAGVLPGKED  154
            GAGV+P  +D
Sbjct  222  GAGVIPVVDD  231


 Score = 79.7 bits (195),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  241  ELLYMRAKFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  280



>gb|EEE64799.1| hypothetical protein OsJ_19655 [Oryza sativa Japonica Group]
Length=297

 Score =   154 bits (389),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 98/152 (64%), Gaps = 8/152 (5%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LRSAL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  94   RTAVSRLRSALAAAVTGRHRQVGLGARLTGTLYGHRRGHVHLAFQLDPRACPALLLELAA  153

Query  414  PTGVLVREMASGPVRIALECE---GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAA  244
            PT  LVREMASG VRIALECE   G              +LLEE   R YCNG+ CG+A 
Sbjct  154  PTAALVREMASGLVRIALECERAKGGPAPALPTATGGGKRLLEETVLRAYCNGKSCGYAV  213

Query  243  RRECGPDDWRVLNSIGPITMGAGVLPGKEDDG  148
            RRECG  DWRVL ++ P++MGAGV+P     G
Sbjct  214  RRECGAADWRVLRALEPVSMGAGVIPAASCGG  245


 Score = 61.2 bits (147),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 8/48 (17%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD--------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD          GGPELS+YLLR
Sbjct  249  DVMYMRARFERVVGSRDSEAFYMMNPDSTSTSSNSNSGGPELSVYLLR  296



>ref|XP_008650054.1| PREDICTED: protein MIZU-KUSSEI 1-like [Zea mays]
 gb|AFW79296.1| plant-specific domain TIGR01570 family protein [Zea mays]
Length=305

 Score =   153 bits (387),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 97/150 (65%), Gaps = 11/150 (7%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LRSAL   +     +  +GAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  100  RTAVSRLRSALANAVAGRHRQVGMGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  159

Query  414  PTGVLVREMASGPVRIALECE------GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCG  253
            PT  LVREMASG VRIALEC+                     +L+EE  WR YCNG+ CG
Sbjct  160  PTAALVREMASGLVRIALECDRARARGSPAAALPSPSPGAGKRLVEETVWRAYCNGKSCG  219

Query  252  FAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +A RRECG  DWRVL ++ P++MGAGV+P 
Sbjct  220  YAVRRECGAADWRVLRALEPVSMGAGVIPA  249


 Score = 62.0 bits (149),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 7/47 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD-------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD       GHGGPELS+YLLR
Sbjct  258  DVMYMRARFERVVGSRDSEAFYMMNPDGSGGGAHGHGGPELSVYLLR  304



>ref|XP_006849759.1| hypothetical protein AMTR_s00024p00251250 [Amborella trichopoda]
 gb|ERN11340.1| hypothetical protein AMTR_s00024p00251250 [Amborella trichopoda]
Length=279

 Score =   139 bits (350),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = -2

Query  555  SALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGP  376
            SAL  G  S LG+ + GTLFG+RRG VHF FQEDP   PA ++ELAM T  LV+EMA G 
Sbjct  99   SALLRGSSSHLGSCITGTLFGYRRGHVHFTFQEDPGAWPALVIELAMQTSALVKEMACGV  158

Query  375  VRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIG  196
            VR+ALECE      +K KKK+  +L++EP W  YCNGRK G+A  REC   DW +L ++ 
Sbjct  159  VRVALECERRCQD-DKAKKKRGRRLIDEPVWSMYCNGRKSGYAVTRECAGGDWEILKAVQ  217

Query  195  PITMGAGVLP  166
             I+MGAGVLP
Sbjct  218  AISMGAGVLP  227


 Score = 75.1 bits (183),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRA++ERVVGS+DSEAFYM++PDG GGPELSI+LLR
Sbjct  239  ELMYMRARFERVVGSKDSEAFYMINPDGTGGPELSIFLLR  278



>ref|XP_010672869.1| PREDICTED: protein MIZU-KUSSEI 1 [Beta vulgaris subsp. vulgaris]
Length=295

 Score =   136 bits (342),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
             L+    +PLG +V GTLFG R+G V FA Q+DP+  PA L+ELA+ T  LVREM+SG V
Sbjct  111  VLSLSSPTPLGRKVTGTLFGHRKGHVTFAVQDDPKADPALLIELAISTSTLVREMSSGLV  170

Query  372  RIALECE-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIG  196
            RIALECE G+ ++      K   KL  EP W  YCNGRKCG+A  R+    DW VL+++ 
Sbjct  171  RIALECERGSHSSTTGRGNKHGPKLFLEPVWTMYCNGRKCGYANSRQGNEFDWHVLSTVQ  230

Query  195  PITMGAGVLPGKEDDG  148
             +++GAGV+P  ED  
Sbjct  231  SVSVGAGVIPLVEDQA  246


 Score = 78.2 bits (191),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVG+RDSEAFYM++PDG+GGPELSI+LLR
Sbjct  255  ELLYMRAKFERVVGNRDSEAFYMLNPDGNGGPELSIFLLR  294



>ref|XP_004965367.1| PREDICTED: uncharacterized protein LOC101760957 [Setaria italica]
Length=193

 Score =   137 bits (345),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 89/138 (64%), Gaps = 15/138 (11%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL-AMPTGVLVREMASGPVRIALECE-  352
            +G+ V GT+FG RRGRVH A Q DPR  PA L+EL A  TG LVREMASG VR+ALECE 
Sbjct  1    MGSSVTGTIFGRRRGRVHLALQTDPRAPPALLLELAAYSTGALVREMASGLVRLALECEK  60

Query  351  -----GNTNTWEknkkkkka--------KLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
                   T  +  N  +            LLEE  WR YCNGRKCG+A RRECG D+WRV
Sbjct  61   ARPPHQQTTGYPSNIDRSTMRVPCPRQGVLLEEATWRAYCNGRKCGYAVRRECGADEWRV  120

Query  210  LNSIGPITMGAGVLPGKE  157
            L ++ P+++GAGVLP  E
Sbjct  121  LRAVEPVSVGAGVLPDGE  138


 Score = 76.6 bits (187),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRAK+ERVVGSRDSEAFYM++PDG GGPELSIYLLR 
Sbjct  153  DLMYMRAKFERVVGSRDSEAFYMVNPDGGGGPELSIYLLRV  193



>ref|XP_010424246.1| PREDICTED: protein MIZU-KUSSEI 1-like, partial [Camelina sativa]
Length=285

 Score =   139 bits (350),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 99/157 (63%), Gaps = 21/157 (13%)
 Frame = -2

Query  573  AVSKLRSAL-TFGIKSP------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS + T     P      LG+RVVGTLFG RRG VHF+ Q+DP    AFL+ELA 
Sbjct  77   AVSRLRSVIATLSRARPGHHHSGLGSRVVGTLFGSRRGHVHFSIQKDPNSPLAFLIELAT  136

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEk--------------nkkkkkaKLLEEPAWRT  277
            P   LV+EMASG VRIALEC+      ++              +K     +L+EEP WRT
Sbjct  137  PISGLVKEMASGLVRIALECDKGKEEKDEGGEEKNKALRHGGGDKTAISRRLVEEPMWRT  196

Query  276  YCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            YCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP
Sbjct  197  YCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLP  233


 Score = 74.7 bits (182),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  246  VMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  284



>ref|XP_010037336.1| PREDICTED: protein MIZU-KUSSEI 1 [Eucalyptus grandis]
 gb|KCW49041.1| hypothetical protein EUGRSUZ_K02646 [Eucalyptus grandis]
Length=307

 Score =   140 bits (353),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 100/170 (59%), Gaps = 34/170 (20%)
 Frame = -2

Query  573  AVSKLRSALTFGIKS-------------PLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            AVSKLRS L    K+              LG RVVGT+FG RRG V F+ Q+D    PAF
Sbjct  78   AVSKLRSVLFQFAKNVRSHSPGGGGGGSGLGPRVVGTIFGHRRGHVLFSLQKDANSQPAF  137

Query  432  LVELAMPTGVLVREMASGPVRIALECE--------GNTN-------------TWEknkkk  316
            LVELA P   LVREMASG VRIALEC+          TN             +   +   
Sbjct  138  LVELATPISGLVREMASGLVRIALECDKPVQNNGTNGTNRSSNSSSNSSSNSSSSSSSSS  197

Query  315  kkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
               +LLEEP WRTYCNG+K GFAARRECGP +W+VL ++ PI+MGAGVLP
Sbjct  198  SSKRLLEEPVWRTYCNGKKYGFAARRECGPKEWKVLKAVEPISMGAGVLP  247


 Score = 73.6 bits (179),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +MYMRAK+ER+VGSRD EAFYMM+PD +G PELS+YLLR 
Sbjct  268  MMYMRAKFERIVGSRDCEAFYMMNPDCNGAPELSVYLLRV  307



>ref|XP_010279509.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nelumbo nucifera]
Length=267

 Score =   133 bits (335),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG +V GTLFG ++G V FA Q+DPR  P  L+ELA  T  LV+EM+SG VRIALECE  
Sbjct  100  LGRKVTGTLFGHKKGHVSFAVQDDPRSEPVLLLELATSTSSLVKEMSSGLVRIALECEKG  159

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            +         +  KL +EP W  YCNGRKCG++  R CG  DW+VLN++  +++GAGV+P
Sbjct  160  S-----AASGRPVKLFQEPMWTMYCNGRKCGYSMSRTCGEPDWQVLNTVQTVSVGAGVIP  214

Query  165  GKEDDG  148
             ++D  
Sbjct  215  AEKDQN  220


 Score = 79.3 bits (194),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRA++ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  227  ELMYMRARFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  266



>emb|CDP14124.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   134 bits (338),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA QE+PR  P  ++ELA+ T  LV+EM+SG VRIA
Sbjct  97   LSITPSLGRKVTGTLFGHRRGHVSFAVQENPRSEPVSIIELAVSTATLVKEMSSGLVRIA  156

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE    +     + +  KL+ EP W  YCNGRKCG+A  R C   DW VLN+I  +++
Sbjct  157  LECEKTVPS-----RGRSTKLVSEPMWTMYCNGRKCGYALTRACSDSDWHVLNTIQSVSV  211

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  212  GAGVIPLMED  221


 Score = 78.2 bits (191),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  231  ELLYMRARFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  270



>dbj|BAD46510.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC80668.1| hypothetical protein OsI_23075 [Oryza sativa Indica Group]
Length=305

 Score =   137 bits (345),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -2

Query  513  VVGTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALECEGNTNT  337
            + GT+FG  RGRVH A Q DPR  PA ++ELA   TG LVREMASG VR+ALECE     
Sbjct  138  LTGTVFGRLRGRVHLALQTDPRAAPAMMLELAGYSTGALVREMASGLVRLALECEKAAPP  197

Query  336  WEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
                +K+++A L+EE  WR YCNGRKCG+A RRECG ++WRVL ++ P+T+GAGVLP
Sbjct  198  TNPGEKRRRAALMEETTWRAYCNGRKCGYAVRRECGAEEWRVLRAVEPVTVGAGVLP  254


 Score = 75.9 bits (185),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA++ERVVGSRDSEAFYM+SPDG+ GPELSIYLLR 
Sbjct  265  DMMYMRARFERVVGSRDSEAFYMVSPDGNAGPELSIYLLRV  305



>ref|XP_003563885.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brachypodium distachyon]
Length=271

 Score =   138 bits (347),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 100/151 (66%), Gaps = 11/151 (7%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIKSP---------LGARVVGTLFGFRRGRVHFAFQEDPRLGPAF  433
            R + A+++LRSA+   +            +G+ V GT+FG RRGRVH A Q  PR  PA 
Sbjct  73   RGEEALARLRSAVLSVVARARRGRRATTAMGSSVTGTIFGRRRGRVHVALQTGPRTPPAL  132

Query  432  LVELA-MPTGVLVREMASGPVRIALECEGNTNTWEknkkkk-kaKLLEEPAWRTYCNGRK  259
            +VEL+   TG LVREM+SG VRIALEC     T     +++ K  L+EEP WR YCNGRK
Sbjct  133  IVELSSYSTGALVREMSSGLVRIALECPKTAPTHTSGGERRRKTALVEEPTWRAYCNGRK  192

Query  258  CGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
            CG+A RRECG ++WRVL ++ P+++GAGVLP
Sbjct  193  CGYAVRRECGAEEWRVLRAVEPVSVGAGVLP  223


 Score = 74.7 bits (182),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            ++MYMRA++ERVVGSRDSEAFYM++PDG+ GPELSIYLLR 
Sbjct  231  DMMYMRARFERVVGSRDSEAFYMINPDGNAGPELSIYLLRV  271



>ref|NP_001151601.1| plant-specific domain TIGR01570 family protein [Zea mays]
 gb|ACG43488.1| plant-specific domain TIGR01570 family protein [Zea mays]
 gb|AFW83416.1| plant-specific domain TIGR01570 family protein [Zea mays]
Length=293

 Score =   140 bits (352),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 85/128 (66%), Gaps = 8/128 (6%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE--  352
            LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA PT  LVREMASG VRIALEC+  
Sbjct  113  LGARITGTLYGRRRGHVHLAFQVDPRACPALLLELAAPTASLVREMASGLVRIALECDRA  172

Query  351  ------GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPI  190
                   +             KL+EE AWR YCNG+ CG+A RRECG  D RVL ++ P+
Sbjct  173  KGACAFPSAAAATNGGAGGCRKLVEEKAWRAYCNGKGCGYAVRRECGAADLRVLRALEPV  232

Query  189  TMGAGVLP  166
            +MGAGV+P
Sbjct  233  SMGAGVIP  240


 Score = 72.0 bits (175),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 4/44 (9%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD----GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD    G+GGPELSIYLLR
Sbjct  249  DVMYMRARFERVVGSRDSEAFYMMNPDSSTGGNGGPELSIYLLR  292



>ref|NP_001149649.1| plant-specific domain TIGR01570 family protein [Zea mays]
 gb|ACG36236.1| plant-specific domain TIGR01570 family protein [Zea mays]
Length=182

 Score =   142 bits (359),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE--  352
            +GAR+ GTL+G RRG VH AFQ DPR  PA L+ELA PT  LVREMASG VRIALEC+  
Sbjct  1    MGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAAPTAALVREMASGLVRIALECDRA  60

Query  351  ----GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
                               +L+EE  WR YCNG+ CG+A RRECG  DWRVL ++ P++M
Sbjct  61   RARGSPAAALPSPSPGAGKRLVEETVWRAYCNGKSCGYAVRRECGAADWRVLRALEPVSM  120

Query  183  GAGVLPGKEDDG  148
            GAGV+P     G
Sbjct  121  GAGVIPAASCGG  132


 Score = 68.9 bits (167),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 6/46 (13%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPD------GHGGPELSIYLLR  14
            ++MYMRA++ERVVGSRDSEAFYMM+PD      GH GPELS+YLLR
Sbjct  136  DVMYMRARFERVVGSRDSEAFYMMNPDXXXXXXGHVGPELSVYLLR  181



>ref|XP_003570211.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brachypodium distachyon]
Length=296

 Score =   134 bits (336),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 99/158 (63%), Gaps = 22/158 (14%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIK---------SPLGARVVGTLFGFRRGRVHFAFQE-DPRLG--  442
            +R  A+++LRSA    +            LG+ V GT+FG RRGRVH A Q  DPR    
Sbjct  89   KRADALARLRSAFRAALAHHRRRRRGHQQLGSSVTGTIFGRRRGRVHVALQSTDPRAAAS  148

Query  441  -----PAFLVELA-MPTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWR  280
                 P  LVELA   TG LVREM+SG VR+ALECE    +      +K+  LLEEP WR
Sbjct  149  GSSSSPVLLVELAAYSTGALVREMSSGLVRLALECEKPPLS----PGEKRRPLLEEPTWR  204

Query  279  TYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
             YCNGRKCG+A RRECG D+WRVL ++ P+++GAGVLP
Sbjct  205  AYCNGRKCGYAVRRECGADEWRVLAAVEPVSVGAGVLP  242


 Score = 77.8 bits (190),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRA++ERVVGSRDSEAFYMM+PDG GGPELSIYLLR
Sbjct  257  LMYMRARFERVVGSRDSEAFYMMNPDGSGGPELSIYLLR  295



>gb|AFW86550.1| hypothetical protein ZEAMMB73_410633 [Zea mays]
Length=252

 Score =   136 bits (343),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 104/174 (60%), Gaps = 30/174 (17%)
 Frame = -2

Query  585  RRKTAVSKLRSALTFGIKS--------PLG--ARVVGTLFGFRRGRVHFAFQEDPRLGPA  436
            R   A+S+LRSA+   +          PLG  A V GT+FG RRGRVH A Q DPR  PA
Sbjct  27   RHGEALSRLRSAILAVLARARRGRGRRPLGSCATVTGTIFGRRRGRVHLALQTDPRAPPA  86

Query  435  FLVELA-MPTGVLVREMASGPVRIALECEGNT-------------------NTWEknkkk  316
             +VELA   TG LVREMASG VR+ALECE                      +   + + +
Sbjct  87   LMVELAAYSTGALVREMASGLVRLALECEKAPAPPKQTGDPSIDVDAYFGGDHHHQRRPR  146

Query  315  kkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED  154
            ++  L+EE  WR YCNGRKCG+A RR+CG D+WRVL ++ P+++GAGVLP  ++
Sbjct  147  QQTALVEEATWRAYCNGRKCGYALRRDCGADEWRVLRAVEPVSVGAGVLPDGDN  200


 Score = 74.7 bits (182),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +LMYMRAK+ERVVGSRDSEAFYM++PDG  GPELSIYLLR 
Sbjct  212  DLMYMRAKFERVVGSRDSEAFYMLNPDGGTGPELSIYLLRV  252



>ref|XP_009599704.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana tomentosiformis]
Length=281

 Score =   130 bits (327),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
            F I   LG +V GTLFG RRG V FA Q+DP+  P  L+ELA+ T  LV+EM+SG VRIA
Sbjct  98   FSITPSLGRKVTGTLFGHRRGHVSFAVQDDPKSEPVLLIELAISTSSLVKEMSSGLVRIA  157

Query  363  LECEGNT----NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIG  196
            LECE              ++++ +L +EP W  YCNGRKCG A  R C   DW VL ++ 
Sbjct  158  LECEKMVVPPQTAARGGGRRRRVELFQEPMWTMYCNGRKCGHALSRACTDSDWHVLGTVQ  217

Query  195  PITMGAGVLPGKED  154
             +++GAGV+P  +D
Sbjct  218  SVSVGAGVIPVVDD  231


 Score = 80.5 bits (197),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  241  ELLYMRAKFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  280



>ref|XP_010456653.1| PREDICTED: protein MIZU-KUSSEI 1-like, partial [Camelina sativa]
Length=189

 Score =   135 bits (340),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 84/135 (62%), Gaps = 19/135 (14%)
 Frame = -2

Query  513  VVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE------  352
            VVGTLFG RRG VHF+ Q+DP   PAFL+ELA P   LV+EMASG VRIALEC+      
Sbjct  3    VVGTLFGSRRGHVHFSIQKDPNSPPAFLIELATPISGLVKEMASGLVRIALECDKGKEED  62

Query  351  -------------GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
                         G   T          +L+EEP WRTYCNG+KCGFA RRECG  + +V
Sbjct  63   EGEEEKIKTLRHGGGDKTKTATATAISRRLVEEPMWRTYCNGKKCGFATRRECGEKEKKV  122

Query  210  LNSIGPITMGAGVLP  166
            L ++  ++MGAGVLP
Sbjct  123  LKALEMVSMGAGVLP  137


 Score = 74.3 bits (181),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            +MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  150  VMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  188



>emb|CDY66471.1| BnaC07g49860D [Brassica napus]
Length=266

 Score =   134 bits (337),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 100/155 (65%), Gaps = 11/155 (7%)
 Frame = -2

Query  573  AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct  68   AVSRLRSVIASLSRARPGNSNSGLGSRVVGTLFGSRRGHVHFSVQKDPTSPPAFLIELAT  127

Query  414  PTGVLVREMASGPVRIALECEGNTNTWEknkkkkkaKL----LEEPAWRTYCNGRKCGFA  247
            P   LV+EMASG VRIALEC+      ++   K + +       +P WRTYCNG+KCGFA
Sbjct  128  PISGLVKEMASGLVRIALECDKAKEEEKEEGDKGRRRHGGGDKTKPMWRTYCNGKKCGFA  187

Query  246  ARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
             RRECG  + +VL ++  ++MGAGVLP  E+  +G
Sbjct  188  TRRECGEKEKKVLKALEMVSMGAGVLPETEETSVG  222


 Score = 75.5 bits (184),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ++MYMRAK+ER+VGSRDSEAFYMM+PD +G PELSIYLLR
Sbjct  226  DIMYMRAKFERIVGSRDSEAFYMMNPDSNGAPELSIYLLR  265



>ref|XP_009758656.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana sylvestris]
Length=282

 Score =   129 bits (323),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
            F I   LG ++ GTLFG RRG V FA Q+DP+  P  L+ELA+ T  LV+EM+SG VRIA
Sbjct  99   FSITPSLGRKLTGTLFGHRRGHVTFAVQDDPKSEPVLLIELAISTSSLVKEMSSGLVRIA  158

Query  363  LECEGNTNTWEknk----kkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIG  196
            LECE      +        + + +L +EP W  YCNGRKCG A  R C   DW VL ++ 
Sbjct  159  LECEKMVAPPQTAARGSGNRLRVELFQEPVWTMYCNGRKCGHALSRACTDSDWHVLGTVQ  218

Query  195  PITMGAGVLPGKED  154
             +++GAGV+P  +D
Sbjct  219  SVSVGAGVIPVVDD  232


 Score = 80.5 bits (197),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  242  ELLYMRAKFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  281



>ref|XP_011078478.1| PREDICTED: protein MIZU-KUSSEI 1-like [Sesamum indicum]
Length=228

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 102/152 (67%), Gaps = 20/152 (13%)
 Frame = -2

Query  573  AVSKLRSALTFG-----IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPT  409
            AVSKLRSAL  G       S LG  VVGT+F  RRG +HFAFQ+   + PAFLVELAMP 
Sbjct  55   AVSKLRSALALGRARIQFSSGLGKNVVGTVFTCRRGHLHFAFQDHFNVSPAFLVELAMPR  114

Query  408  GVLVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECG  229
             +L +EM+SG VR+ALEC+ N              LL EP WRTYCNG+K G+A RRECG
Sbjct  115  RILPKEMSSGLVRVALECDKNKGI----------GLLGEPVWRTYCNGKKHGYATRRECG  164

Query  228  PDDWRVLNSIGPITMGAGVLP-----GKEDDG  148
            P+DW+VLN+IGPI+MG G+LP     G E DG
Sbjct  165  PEDWKVLNAIGPISMGTGMLPAASERGTESDG  196



>ref|XP_007204835.1| hypothetical protein PRUPE_ppa027006mg [Prunus persica]
 gb|EMJ06034.1| hypothetical protein PRUPE_ppa027006mg [Prunus persica]
Length=281

 Score =   134 bits (337),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 88/138 (64%), Gaps = 3/138 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q DPR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  104  LSITPSLGRKVTGTLFGNRRGHVSFAVQLDPRSEPVLLLELAMSTSSLVKEMSSGLVRIA  163

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LE E +  +       +  KL +EP+W  YCNGRKCG+AA R CG  DW VL ++  +++
Sbjct  164  LESERHHGS--SRTGVQGRKLFQEPSWTMYCNGRKCGYAASRTCGESDWHVLTTVRSVSV  221

Query  183  GAGVLPGKEDDGIGPTAS  130
            GAGV+P   DDG   +AS
Sbjct  222  GAGVIP-VVDDGKKGSAS  238


 Score = 74.7 bits (182),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++P+G+GGPELSI+LLR
Sbjct  241  ELLYMRARFERVVGSRDSEAFYMLNPEGNGGPELSIFLLR  280



>gb|KDO45924.1| hypothetical protein CISIN_1g039343mg [Citrus sinensis]
Length=277

 Score =   134 bits (336),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EMASG VRIA
Sbjct  100  LSVTPSLGRKVTGTLFGNRRGHVSFAVQDDPRSEPVLLLELAMSTATLVKEMASGLVRIA  159

Query  363  LECE--GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPI  190
            LECE  G   T +     +  +L  EP W  YCNGRKCG+A  R CG  DW VL ++  +
Sbjct  160  LECEKAGPVQTGK----GRAGRLFHEPMWTMYCNGRKCGYATSRACGGLDWHVLTTVQSV  215

Query  189  TMGAGVLPGKED  154
            ++GAGV+P  ED
Sbjct  216  SVGAGVIPVVED  227


 Score = 75.1 bits (183),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PD +GGPELSI+LLR
Sbjct  237  ELLYMRARFERVVGSRDSEAFYMLNPDNNGGPELSIFLLR  276



>ref|XP_011075338.1| PREDICTED: protein MIZU-KUSSEI 1-like [Sesamum indicum]
Length=275

 Score =   132 bits (331),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 84/134 (63%), Gaps = 6/134 (4%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  ++ELA+ T  LV+EM+SG VRIA
Sbjct  103  LSITPSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLIIELAVSTSALVKEMSSGLVRIA  162

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE          +    +L  EPAW  YCNGRKCG+A  R C   DW+VL ++  +++
Sbjct  163  LECEKTHQP-----RGTAVRLFGEPAWTMYCNGRKCGYAVSRSCSESDWQVLRTVQSVSV  217

Query  183  GAGVLPGKEDDGIG  142
            GAGV+P   DDG G
Sbjct  218  GAGVIP-LVDDGRG  230


 Score = 76.6 bits (187),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  235  ELLYMRARFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  274



>ref|XP_007028679.1| Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta 
[Theobroma cacao]
 gb|EOY09181.1| Acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta 
[Theobroma cacao]
Length=282

 Score =   130 bits (327),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 83/133 (62%), Gaps = 7/133 (5%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  104  LSITPSLGRKVTGTLFGLRRGHVSFAVQDDPRSEPVLLLELAMSTSSLVKEMSSGLVRIA  163

Query  363  LECE---GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGP  193
            LECE   G T      +  +  KL  EP W  YCNGRK G+A  R C   DW VL+++  
Sbjct  164  LECEKVPGRT----AAQPCRTGKLFHEPMWTMYCNGRKSGYAVTRTCTESDWHVLSTVQS  219

Query  192  ITMGAGVLPGKED  154
            +++GAGV+P  ED
Sbjct  220  VSVGAGVIPVVED  232


 Score = 77.8 bits (190),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  242  ELLYMRAKFERVVGSRDSEAFYMMNPDNNGGPELSIFLLR  281



>ref|XP_006492939.1| PREDICTED: protein MIZU-KUSSEI 1-like [Citrus sinensis]
Length=277

 Score =   132 bits (333),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EMASG VRIA
Sbjct  100  LSVTPSLGRKVTGTLFGNRRGHVSFAVQDDPRSEPVLLLELAMSTATLVKEMASGLVRIA  159

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE       +  K +  +L  EP W  YCNGRKCG+A  R CG  DW VL ++  +++
Sbjct  160  LECEKAGPV--QAGKGRAGRLFHEPMWTMYCNGRKCGYATSRACGGLDWHVLTTVQSVSV  217

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  218  GAGVIPVVED  227


 Score = 75.1 bits (183),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PD +GGPELSI+LLR
Sbjct  237  ELLYMRARFERVVGSRDSEAFYMLNPDNNGGPELSIFLLR  276



>ref|XP_008387312.1| PREDICTED: protein MIZU-KUSSEI 1 [Malus domestica]
Length=279

 Score =   132 bits (333),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = -2

Query  546  TFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
               +   LG +V GTLFG RRG V FA Q DP+  P FL+ELAM T  LV+EM+SG VRI
Sbjct  101  NLSVTPSLGRKVTGTLFGNRRGHVSFAVQLDPQSEPVFLLELAMSTSSLVKEMSSGLVRI  160

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALE E    +          KL +EP+W  YCNGRKCG+AA R CG  DW VL ++  ++
Sbjct  161  ALESEKQQGSGR--TGMHGRKLFQEPSWTMYCNGRKCGYAASRTCGESDWHVLRTVRSVS  218

Query  186  MGAGVLPGKED  154
            +GAGV+P  +D
Sbjct  219  VGAGVIPVVDD  229


 Score = 75.1 bits (183),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++P+G+GGPELSI+LLR
Sbjct  239  ELLYMRARFERVVGSRDSEAFYMLNPEGNGGPELSIFLLR  278



>ref|XP_002966034.1| hypothetical protein SELMODRAFT_167931 [Selaginella moellendorffii]
 ref|XP_002971457.1| hypothetical protein SELMODRAFT_95589 [Selaginella moellendorffii]
 gb|EFJ27206.1| hypothetical protein SELMODRAFT_95589 [Selaginella moellendorffii]
 gb|EFJ33454.1| hypothetical protein SELMODRAFT_167931 [Selaginella moellendorffii]
Length=206

 Score =   130 bits (328),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 80/130 (62%), Gaps = 9/130 (7%)
 Frame = -2

Query  531  SPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE  352
            S LG+RV GTLFG R+G VHFA QEDP+  P  L+EL  PT  LV+EMASG VRIALECE
Sbjct  45   SALGSRVTGTLFGNRKGHVHFAVQEDPKSPPVLLLELTTPTSTLVKEMASGLVRIALECE  104

Query  351  GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGV  172
               N  +         L  E  W  YCNGRK G+A RR C   D ++L  +  ++MGAGV
Sbjct  105  RTMNRGK---------LFLEQVWTMYCNGRKSGYALRRICSDSDLQILRMVQAVSMGAGV  155

Query  171  LPGKEDDGIG  142
            LP  E+   G
Sbjct  156  LPMDEEGADG  165


 Score = 76.6 bits (187),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRA++ERVVGS+DSEAFYMM+PDG GGPELSI+LLR
Sbjct  166  ELMYMRARFERVVGSKDSEAFYMMNPDGTGGPELSIFLLR  205



>ref|XP_006421312.1| hypothetical protein CICLE_v10006416mg [Citrus clementina]
 gb|ESR34552.1| hypothetical protein CICLE_v10006416mg [Citrus clementina]
Length=277

 Score =   132 bits (332),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EMASG VRIA
Sbjct  100  LSVTPSLGRKVTGTLFGNRRGHVSFAVQDDPRSEPVLLLELAMSTATLVKEMASGLVRIA  159

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE       +  K +  +L  EP W  YCNGRKCG+A  R CG  DW VL ++  +++
Sbjct  160  LECEKAGPV--QAGKGRAGRLFHEPMWTMYCNGRKCGYATSRVCGGLDWHVLTTVQSVSV  217

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  218  GAGVIPVVED  227


 Score = 75.1 bits (183),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PD +GGPELSI+LLR
Sbjct  237  ELLYMRARFERVVGSRDSEAFYMLNPDNNGGPELSIFLLR  276



>ref|XP_010108210.1| hypothetical protein L484_003407 [Morus notabilis]
 gb|EXC18223.1| hypothetical protein L484_003407 [Morus notabilis]
Length=285

 Score =   126 bits (317),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 80/130 (62%), Gaps = 1/130 (1%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q DPR  P  L+ELA+ T  LV+EMASG VRIA
Sbjct  107  LSVTPSLGRKVTGTLFGNRRGHVSFAVQLDPRSEPVLLLELAVSTASLVKEMASGLVRIA  166

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LE E  T         +  KL +EP W  YCNGR+CG+A  R CG  D  VLN +  +++
Sbjct  167  LESE-KTPAAHGRGAMQGRKLFQEPTWTMYCNGRRCGYAVSRTCGESDSHVLNVVRSVSV  225

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  226  GAGVIPVVED  235


 Score = 79.3 bits (194),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  245  ELLYMRAKFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  284



>ref|XP_004513863.1| PREDICTED: uncharacterized protein LOC101513022 [Cicer arietinum]
Length=284

 Score =   127 bits (318),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = -2

Query  540  GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIAL  361
             I   LG ++ GTLFG RRG + FA Q  PR  P  L+ELAM T  LV+EM+SG VRIAL
Sbjct  106  SISPSLGRKITGTLFGNRRGHISFAVQLHPRAEPVLLLELAMSTSSLVKEMSSGLVRIAL  165

Query  360  ECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMG  181
            EC   T         +  +L  EP W  YCNG+KCG+A  R CG  D  VL+++  +++G
Sbjct  166  ECRKTTTVSAAYSGGRPNRLFHEPDWTMYCNGKKCGYAVSRTCGDLDLHVLSTVQSVSVG  225

Query  180  AGVLP  166
            AGV+P
Sbjct  226  AGVIP  230


 Score = 78.6 bits (192),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRAK+ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  245  LMYMRAKFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  283



>ref|XP_008392242.1| PREDICTED: protein MIZU-KUSSEI 1-like [Malus domestica]
Length=279

 Score =   133 bits (334),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = -2

Query  546  TFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
               +   LG +V GTLFG RRG V FA Q DPR  P  L+ELAM T  LV+EM+SG VRI
Sbjct  101  NLSVTPSLGRKVTGTLFGNRRGHVSFAVQLDPRSEPVLLLELAMSTSSLVKEMSSGLVRI  160

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALE E    +          KL +EP+W  YCNGRKCG+AA R CG  DW VL+++  ++
Sbjct  161  ALESEKQQGS--ARAVMNGRKLFQEPSWTMYCNGRKCGYAATRTCGESDWHVLSTVRSVS  218

Query  186  MGAGVLPGKED  154
            +GAGV+P  +D
Sbjct  219  VGAGVIPVLDD  229


 Score = 72.4 bits (176),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGS DSEAFYM++P+G+GGPELSI+LLR
Sbjct  239  ELLYMRARFERVVGSLDSEAFYMLNPEGNGGPELSIFLLR  278



>gb|KHN10435.1| hypothetical protein glysoja_030871 [Glycine soja]
Length=265

 Score =   129 bits (324),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 92/140 (66%), Gaps = 21/140 (15%)
 Frame = -2

Query  576  TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV  397
            T  SK RS L FG    LG+RVVGTL             +DP   PAFL+ELA P   LV
Sbjct  102  TVFSKNRSNLPFG----LGSRVVGTL-------------KDPTSQPAFLIELATPISGLV  144

Query  396  REMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDW  217
            REMASG VRIALEC+ + ++    +KKK  +LL+E  WRTYCNG+KCGFA RRECG  DW
Sbjct  145  REMASGLVRIALECDKDKDS----EKKKTLRLLQESVWRTYCNGKKCGFATRRECGAKDW  200

Query  216  RVLNSIGPITMGAGVLPGKE  157
             +L ++ PI+MGAGVLP  +
Sbjct  201  DILKAVEPISMGAGVLPNSD  220


 Score = 76.3 bits (186),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            E+MYMRA++ER+VGSRDSEAFYMM+PD +G PELSIYLLR 
Sbjct  225  EVMYMRARFERIVGSRDSEAFYMMNPDSNGAPELSIYLLRV  265



>ref|XP_011078992.1| PREDICTED: protein MIZU-KUSSEI 1-like [Sesamum indicum]
Length=247

 Score =   130 bits (327),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 8/130 (6%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  L+ELA+ T  LV+EM+SG +RIA
Sbjct  76   LSITPSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLLIELAVSTATLVKEMSSGLLRIA  135

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE             + +L  EPAW  YCNGR+CG+A  R C   DW VL+++  +++
Sbjct  136  LECE--------KAHPPRVRLFREPAWTMYCNGRQCGYAQSRACTESDWHVLSTVQSVSV  187

Query  183  GAGVLPGKED  154
            GAGV+P  +D
Sbjct  188  GAGVIPVVDD  197


 Score = 75.1 bits (183),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVG+RDSEAFYM++PDG+GGPELSI+LLR
Sbjct  207  ELLYMRARFERVVGNRDSEAFYMLNPDGNGGPELSIFLLR  246



>emb|CBI29820.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   129 bits (324),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 83/130 (64%), Gaps = 6/130 (5%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  L+ELA  T  LV+EM+SG VRIA
Sbjct  106  LSITPSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLLLELATSTSTLVKEMSSGLVRIA  165

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE      +   + +  KL +EP W  YCNGRKCG+A  RECG  D  VL+++  ++ 
Sbjct  166  LECE------KVAARGRPVKLFQEPMWTMYCNGRKCGYAMSRECGEFDRHVLSTVQSVSA  219

Query  183  GAGVLPGKED  154
            GAGV+P  ++
Sbjct  220  GAGVIPTDDN  229


 Score = 76.3 bits (186),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E++YMRA++ERVVGSRDSEAFYMM+PDG GGPELSI+LLR
Sbjct  239  EMLYMRARFERVVGSRDSEAFYMMNPDGTGGPELSIFLLR  278



>ref|XP_010056931.1| PREDICTED: LOW QUALITY PROTEIN: protein MIZU-KUSSEI 1 [Eucalyptus 
grandis]
Length=290

 Score =   127 bits (318),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -2

Query  516  RVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNTNT  337
            +V GTLFG+RRG V FA Q+ P+  P  L+ELA+ T  LV+EM+SG VRIALECE   ++
Sbjct  124  KVTGTLFGYRRGAVSFAVQDSPQSEPVLLLELAVSTSALVKEMSSGLVRIALECEKADDS  183

Query  336  WEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP---  166
             +     +  +L +EPAW  YCNGRKCG+AA REC   D  VL ++  +++GAGV+P   
Sbjct  184  AD-----RPPRLFQEPAWTMYCNGRKCGYAASRECTESDLHVLRTVRSMSVGAGVIPLLA  238

Query  165  --GKEDDGI  145
               K D GI
Sbjct  239  DRKKADAGI  247


 Score = 78.6 bits (192),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  250  ELLYMRAKFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  289



>ref|XP_009363198.1| PREDICTED: protein MIZU-KUSSEI 1-like [Pyrus x bretschneideri]
Length=279

 Score =   130 bits (326),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = -2

Query  546  TFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
               +   LG +V GTLFG RRG V FA Q D R  P  L+ELAM T  LV+EM+SG VRI
Sbjct  101  NLSVAPSLGRKVTGTLFGNRRGHVSFAVQLDTRSDPVLLLELAMSTSSLVKEMSSGLVRI  160

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALE E   ++       +K  L +EP+W  YCNGRKCG+AA R CG  DW VL+++  ++
Sbjct  161  ALESEKQQSSGRAGMNGRK--LFQEPSWTMYCNGRKCGYAATRTCGESDWHVLSTVRSVS  218

Query  186  MGAGVLPGKED  154
            +GAGV+P  +D
Sbjct  219  VGAGVIPVLDD  229


 Score = 74.7 bits (182),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++P+G+GGPELSI+LLR
Sbjct  239  ELLYMRARFERVVGSRDSEAFYMLNPEGNGGPELSIFLLR  278



>dbj|BAB90468.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAB92806.1| hypothetical protein [Oryza sativa Japonica Group]
Length=307

 Score =   143 bits (360),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 104/168 (62%), Gaps = 22/168 (13%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  92   RTAVSRLRTALAAALAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  151

Query  414  PTGVLVREMASGPVRIALECE-----------------GNTNTWEknkkkkkaKLLEEPA  286
            PT  LVREMASG VRIALECE                  ++++   +      KL+EE  
Sbjct  152  PTASLVREMASGLVRIALECERAKGGGACAFPTAAAAPSSSSSSSSSSSAGGRKLVEETV  211

Query  285  WRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            WR YCNGR CG+A RRECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  212  WRAYCNGRSCGYAVRRECGAADWRVLRALEPVSMGAGVIPAACGGGEG  259


 Score = 62.0 bits (149),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 7/48 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-------HGGPELSIYLLRA  11
            ++MYMRA++ERVVGSRDSEAFYMM+PD        +GGPELS+YLLR 
Sbjct  260  DVMYMRARFERVVGSRDSEAFYMMNPDCGGSGSNNNGGPELSVYLLRV  307



>ref|XP_002284235.1| PREDICTED: protein MIZU-KUSSEI 1 [Vitis vinifera]
Length=262

 Score =   129 bits (323),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 83/130 (64%), Gaps = 6/130 (5%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  L+ELA  T  LV+EM+SG VRIA
Sbjct  89   LSITPSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLLLELATSTSTLVKEMSSGLVRIA  148

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LECE      +   + +  KL +EP W  YCNGRKCG+A  RECG  D  VL+++  ++ 
Sbjct  149  LECE------KVAARGRPVKLFQEPMWTMYCNGRKCGYAMSRECGEFDRHVLSTVQSVSA  202

Query  183  GAGVLPGKED  154
            GAGV+P  ++
Sbjct  203  GAGVIPTDDN  212


 Score = 75.9 bits (185),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E++YMRA++ERVVGSRDSEAFYMM+PDG GGPELSI+LLR
Sbjct  222  EMLYMRARFERVVGSRDSEAFYMMNPDGTGGPELSIFLLR  261



>ref|NP_001043690.1| Os01g0642600 [Oryza sativa Japonica Group]
 dbj|BAF05604.1| Os01g0642600 [Oryza sativa Japonica Group]
 gb|EAY75143.1| hypothetical protein OsI_03037 [Oryza sativa Indica Group]
Length=303

 Score =   143 bits (360),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 104/168 (62%), Gaps = 22/168 (13%)
 Frame = -2

Query  579  KTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM  415
            +TAVS+LR+AL   +     +  LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct  88   RTAVSRLRTALAAALAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA  147

Query  414  PTGVLVREMASGPVRIALECE-----------------GNTNTWEknkkkkkaKLLEEPA  286
            PT  LVREMASG VRIALECE                  ++++   +      KL+EE  
Sbjct  148  PTASLVREMASGLVRIALECERAKGGGACAFPTAAAAPSSSSSSSSSSSAGGRKLVEETV  207

Query  285  WRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIG  142
            WR YCNGR CG+A RRECG  DWRVL ++ P++MGAGV+P     G G
Sbjct  208  WRAYCNGRSCGYAVRRECGAADWRVLRALEPVSMGAGVIPAACGGGEG  255


 Score = 61.6 bits (148),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 7/48 (15%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-------HGGPELSIYLLRA  11
            ++MYMRA++ERVVGSRDSEAFYMM+PD        +GGPELS+YLLR 
Sbjct  256  DVMYMRARFERVVGSRDSEAFYMMNPDCGGSGSNNNGGPELSVYLLRV  303



>gb|KJB19243.1| hypothetical protein B456_003G090900 [Gossypium raimondii]
Length=276

 Score =   128 bits (321),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 80/134 (60%), Gaps = 8/134 (6%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG V FA Q+DPR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  106  LSITPSLGRKVTGTLFGHRRGHVSFAVQDDPRSEPVLLLELAMSTASLVKEMSSGLVRIA  165

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LE E            +  +L  EP W  YCNGRK G+A  R C   DW VL+++  +++
Sbjct  166  LESE--------KAPGRTGRLFHEPTWSMYCNGRKSGYAVTRTCTESDWHVLSTVQSVSV  217

Query  183  GAGVLPGKEDDGIG  142
            GAGV+P  ED   G
Sbjct  218  GAGVIPVVEDAKSG  231


 Score = 76.6 bits (187),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYM++PD +GGPELSI+LLR
Sbjct  236  ELLYMRAKFERVVGSRDSEAFYMLNPDNNGGPELSIFLLR  275



>ref|XP_009339447.1| PREDICTED: protein MIZU-KUSSEI 1-like [Pyrus x bretschneideri]
Length=279

 Score =   129 bits (325),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 82/124 (66%), Gaps = 2/124 (2%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG  V GTLFG RRG V FA Q DP+  P  L+ELAM T  LV+EM+SG VRIALE E  
Sbjct  108  LGRNVTGTLFGNRRGHVSFAVQLDPQSEPVLLLELAMSTSSLVKEMSSGLVRIALESEKQ  167

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
              +       +K  L +EP+W  YCNGRKCG+AA R CG  DW VL+++  +++GAGV+P
Sbjct  168  QGSGRAGMHGRK--LFQEPSWTMYCNGRKCGYAASRTCGESDWHVLSTVRSVSVGAGVIP  225

Query  165  GKED  154
              +D
Sbjct  226  VVDD  229


 Score = 74.7 bits (182),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++P+G+GGPELSI+LLR
Sbjct  239  ELLYMRARFERVVGSRDSEAFYMLNPEGNGGPELSIFLLR  278



>ref|XP_010517659.1| PREDICTED: protein MIZU-KUSSEI 1-like [Camelina sativa]
Length=299

 Score =   131 bits (329),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 88/143 (62%), Gaps = 10/143 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G RRG V F+ Q DPR  P  L++LAM T  LV+E
Sbjct  112  VSNQLISLVTGGSSSLGRRVTGTLYGHRRGHVTFSVQYDPRSDPVLLLDLAMSTATLVKE  171

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE         + +   KL +EP W  YCNGRKCG+A  R   C   DW
Sbjct  172  MSSGLVRIALECE--------KRHRPGTKLFQEPKWTMYCNGRKCGYAVSRGGACTDSDW  223

Query  216  RVLNSIGPITMGAGVLPGKEDDG  148
            RVLN++  +T+GAGV+P  +  G
Sbjct  224  RVLNTVSRVTVGAGVIPTAKSIG  246


 Score = 73.2 bits (178),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  259  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  298



>ref|XP_003535869.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=296

 Score =   127 bits (318),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 84/136 (62%), Gaps = 6/136 (4%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG + FA Q  PR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  106  LSVTPSLGRKVTGTLFGHRRGHISFAVQLHPRADPVLLLELAMSTSSLVKEMSSGLVRIA  165

Query  363  LECE---GNTNTWEknkkk---kkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNS  202
            LE +    +T T          ++ KL +EP+W  YCNGR CG+A  R CG  DW VL++
Sbjct  166  LESQKLSASTITRTMRSNSGRQQQCKLFQEPSWTMYCNGRNCGYAVSRTCGDLDWHVLST  225

Query  201  IGPITMGAGVLPGKED  154
            I  +++GAGV+P  ED
Sbjct  226  IQSVSVGAGVIPLLED  241


 Score = 77.0 bits (188),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRA++ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  257  LMYMRARFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  295



>ref|XP_008467200.1| PREDICTED: protein MIZU-KUSSEI 1-like [Cucumis melo]
Length=242

 Score =   132 bits (333),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = -2

Query  576  TAVSKLRSA--LTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
             +VSKLRSA  L+FGI++    RV+GT+FG RRG VHF+ Q +    P FLVELAMPT  
Sbjct  61   VSVSKLRSAIALSFGIRTR-SCRVLGTIFGHRRGHVHFSVQTEGSAKPMFLVELAMPTTA  119

Query  402  LVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPD  223
            LVREMASG  RIALECE      +K +  ++        WR+YCNG+K G A R ECG +
Sbjct  120  LVREMASGVARIALECERGEKKKKKGELNEEG------IWRSYCNGKKYGIAHRFECGAE  173

Query  222  DWRVLNSIGPITMGAGVLPG  163
            +WR+L ++GPIT+GAGVLPG
Sbjct  174  EWRILRAVGPITVGAGVLPG  193


 Score = 71.2 bits (173),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +M+MRA++ERVVGS+DSEAFYM++PDG GGPELSI+LLR 
Sbjct  203  VMFMRARFERVVGSKDSEAFYMINPDGVGGPELSIFLLRV  242



>gb|EYU18721.1| hypothetical protein MIMGU_mgv1a020836mg, partial [Erythranthe 
guttata]
Length=216

 Score =   127 bits (319),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q DPR  P  L ELA+ T  LV+EM+SG VRIA
Sbjct  36   LAVTPSLGRKVTGTLFGHRRGHVSFAVQYDPRSEPVLLAELAVSTSALVKEMSSGMVRIA  95

Query  363  LECEG-NTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            LECE  +        +    +L  EP W  YCNGRKCG+AA R C   DW VL ++  ++
Sbjct  96   LECEKIHQPRGGVGGRAAAVRLFGEPTWTMYCNGRKCGYAATRACTESDWHVLRTVQSVS  155

Query  186  MGAGVLPGKEDDG  148
            +GAGV+P  +D G
Sbjct  156  VGAGVIPVVDDGG  168


 Score = 76.6 bits (187),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            EL+YMRA++ERVVGSRDSEAFYM++PDG+GGPELSI+LLR 
Sbjct  176  ELLYMRARFERVVGSRDSEAFYMLNPDGNGGPELSIFLLRV  216



>ref|XP_010269747.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nelumbo nucifera]
Length=266

 Score =   124 bits (311),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 5/119 (4%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G +V GTLFG ++G V FA QEDPR  P  L+EL   T  LV+EM+SG VRIALECE  +
Sbjct  100  GRKVTGTLFGHKKGHVSFAVQEDPRSEPVLLLELPTSTCSLVKEMSSGLVRIALECEKGS  159

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
                     +  KL +EP W  YCNGRKCG++  R CG  DW+VL+++  +++GAGV+P
Sbjct  160  -----AGGGRSGKLFQEPVWAMYCNGRKCGYSVSRTCGDSDWQVLSTVQTVSVGAGVIP  213


 Score = 79.3 bits (194),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRA++ERVVGSRDSEAFYMM+PDG+GGPELSI+LLR
Sbjct  226  ELMYMRARFERVVGSRDSEAFYMMNPDGNGGPELSIFLLR  265



>ref|XP_010508693.1| PREDICTED: protein MIZU-KUSSEI 1 [Camelina sativa]
Length=299

 Score =   130 bits (327),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G RRG V F+ Q DPR  P  L++LAM T  LV+E
Sbjct  112  VSNQLISLVTGGSSSLGRRVTGTLYGHRRGHVTFSVQYDPRSDPVLLLDLAMSTATLVKE  171

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE         + +   KL +EP W  YCNGRKCG+A  R   C   DW
Sbjct  172  MSSGLVRIALECE--------KRHRPGTKLFQEPKWTMYCNGRKCGYAVSRGGACTDSDW  223

Query  216  RVLNSIGPITMGAGVLP  166
            RVLN++  +T+GAGV+P
Sbjct  224  RVLNTVSRVTVGAGVIP  240


 Score = 73.2 bits (178),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  259  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  298



>ref|XP_006294692.1| hypothetical protein CARUB_v10023729mg [Capsella rubella]
 gb|EOA27590.1| hypothetical protein CARUB_v10023729mg [Capsella rubella]
Length=300

 Score =   130 bits (326),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G RRG V F+ Q DPR  P  L++LAM T  LV+E
Sbjct  113  VSNQLISLVTGGSSSLGRRVTGTLYGHRRGHVTFSVQYDPRSDPVLLLDLAMSTATLVKE  172

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE         + +   KL +EP W  YCNGRKCG+A  R   C   DW
Sbjct  173  MSSGLVRIALECE--------KRHRPGTKLFQEPKWTMYCNGRKCGYAVSRGGACTDSDW  224

Query  216  RVLNSIGPITMGAGVLP  166
            RVLN++  +T+GAGV+P
Sbjct  225  RVLNTVSRVTVGAGVIP  241


 Score = 72.8 bits (177),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  260  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  299



>ref|XP_003518131.1| PREDICTED: protein MIZU-KUSSEI 1-like [Glycine max]
Length=294

 Score =   126 bits (316),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG + FA Q  PR  P  L+ELAM T  LV+EM+S  VRIA
Sbjct  108  LSVTPSLGRKVTGTLFGHRRGHISFAVQLHPRAEPVLLLELAMSTSSLVKEMSSSLVRIA  167

Query  363  LECEGNTNTWEknkkkk---kaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGP  193
            LEC+  + T           + +L +EPAW  YCNGR CG+A  R CG  D  VL+++  
Sbjct  168  LECQKVSVTAAVAHNNSGGGRRRLFQEPAWTMYCNGRNCGYAVSRTCGDLDLHVLSTVQS  227

Query  192  ITMGAGVLPGKED  154
            +++GAGV+P  ED
Sbjct  228  VSVGAGVIPLLED  240


 Score = 76.6 bits (187),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRA++ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  255  LMYMRARFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  293



>ref|XP_009133503.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
Length=290

 Score =   129 bits (324),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 89/146 (61%), Gaps = 13/146 (9%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            +++ S LT G  S LG RV GTL+G RRG V F+ Q  P   P FL++LAM T  LVREM
Sbjct  107  NQMISFLTGG-SSSLGKRVTGTLYGHRRGHVTFSVQYGPSSAPVFLLDLAMSTATLVREM  165

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE    +          KL  EP W  YCNGRKCG+A  R   C   DWR
Sbjct  166  SSGLVRIALECEKRHRS--------GTKLFHEPKWTMYCNGRKCGYAVSRGSACKESDWR  217

Query  213  VLNSIGPITMGAGVLPGKE--DDGIG  142
            VLN++  +T+GAGV+P  +  DD  G
Sbjct  218  VLNTVSRVTVGAGVIPTAKSIDDASG  243


 Score = 73.2 bits (178),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  250  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  289



>ref|XP_008244250.1| PREDICTED: protein MIZU-KUSSEI 1 [Prunus mume]
Length=285

 Score =   127 bits (318),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 80/130 (62%), Gaps = 2/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V G LFG RRG V FA Q DP   P  L+ELAM T  LV+EM+SG VRIA
Sbjct  108  LSITPSLGRKVTGPLFGNRRGHVSFAVQLDPSSEPVLLLELAMSTSSLVKEMSSGLVRIA  167

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LE E +  +          KL +EP+W  YCNGRKCG+ A R CG  DW VL ++  +++
Sbjct  168  LESERHHGS--SRTGIHGRKLFQEPSWTMYCNGRKCGYTASRTCGESDWHVLTTVRSVSV  225

Query  183  GAGVLPGKED  154
            GAGV+P  +D
Sbjct  226  GAGVIPVVDD  235


 Score = 75.1 bits (183),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++P+G+GGPELSI+LLR
Sbjct  245  ELLYMRARFERVVGSRDSEAFYMLNPEGNGGPELSIFLLR  284



>ref|XP_002879946.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56205.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   127 bits (318),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 84/137 (61%), Gaps = 10/137 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G +RG V F+ Q + R  P  L++LAM T  LV+E
Sbjct  67   VSNQLISLVTGGSSSLGRRVTGTLYGHKRGHVTFSVQYNQRSDPVLLLDLAMSTATLVKE  126

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE    +          KL +EP W  YCNGRKCG+A  R   C   DW
Sbjct  127  MSSGLVRIALECEKRHRS--------GTKLFQEPKWTMYCNGRKCGYAVSRGGACTDTDW  178

Query  216  RVLNSIGPITMGAGVLP  166
            RVLN++  +T+GAGV+P
Sbjct  179  RVLNTVSRVTVGAGVIP  195


 Score = 75.1 bits (183),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR K+ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  214  ELLYMRGKFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  253



>ref|XP_007145593.1| hypothetical protein PHAVU_007G251700g [Phaseolus vulgaris]
 gb|ESW17587.1| hypothetical protein PHAVU_007G251700g [Phaseolus vulgaris]
Length=293

 Score =   125 bits (315),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 1/127 (1%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG RRG + FA Q  PR  P  LVELAM T  LV+EM+SG VR+A
Sbjct  113  LSITPSLGRKVTGTLFGHRRGHISFAVQLHPRAEPLLLVELAMSTSSLVKEMSSGLVRLA  172

Query  363  LEC-EGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            LEC + + +      +++  +L +EP+W  YCNGR CG+A  R CG  DW VL+++  ++
Sbjct  173  LECPKVSFSAAANGGRQQHKRLFQEPSWTMYCNGRNCGYAVSRTCGDLDWHVLSTVQSVS  232

Query  186  MGAGVLP  166
            +GAGV+P
Sbjct  233  VGAGVIP  239


 Score = 76.3 bits (186),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRA++ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  254  LMYMRARFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  292



>ref|XP_006411429.1| hypothetical protein EUTSA_v10016988mg [Eutrema salsugineum]
 gb|ESQ52882.1| hypothetical protein EUTSA_v10016988mg [Eutrema salsugineum]
Length=305

 Score =   128 bits (322),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 85/137 (62%), Gaps = 10/137 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G RRG V F+ Q DPR  P  L++LAM T  LV+E
Sbjct  113  VSNQLISLVTGGSSSLGRRVTGTLYGRRRGHVTFSVQYDPRSDPVLLLDLAMSTATLVKE  172

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE         + +   KL  EP W  YCNGRKCG+A  R   C   DW
Sbjct  173  MSSGLVRIALECE--------KRHRPGTKLFHEPKWTMYCNGRKCGYAVSRGGACTETDW  224

Query  216  RVLNSIGPITMGAGVLP  166
            RVLN++  +T+GAGV+P
Sbjct  225  RVLNTVSRVTVGAGVIP  241


 Score = 73.2 bits (178),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  265  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  304



>emb|CDY35406.1| BnaA03g19540D [Brassica napus]
Length=290

 Score =   129 bits (323),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 89/146 (61%), Gaps = 13/146 (9%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            +++ S LT G  S LG RV GTL+G RRG V F+ Q  P   P FL++LAM T  LVREM
Sbjct  107  NQMISFLTGG-SSSLGKRVTGTLYGHRRGHVTFSVQYGPSSDPVFLLDLAMSTATLVREM  165

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE    +          KL  EP W  YCNGRKCG+A  R   C   DWR
Sbjct  166  SSGLVRIALECEKRHRS--------GTKLFHEPKWTMYCNGRKCGYAVSRGSACKESDWR  217

Query  213  VLNSIGPITMGAGVLPGKE--DDGIG  142
            VLN++  +T+GAGV+P  +  DD  G
Sbjct  218  VLNTVSRVTVGAGVIPTAKSIDDASG  243


 Score = 72.8 bits (177),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  250  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  289



>ref|XP_009142002.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
Length=304

 Score =   128 bits (321),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 85/139 (61%), Gaps = 11/139 (8%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
            +L  G  S LG RV GTL+G RRG V F+ Q  PR  PA L++LAM T  LV+EMASG V
Sbjct  120  SLVRGGSSSLGRRVTGTLYGHRRGHVTFSVQYGPRSDPALLLDLAMSTATLVKEMASGLV  179

Query  372  RIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSI  199
            RIALECE    +          KL +EP W  YCNGRKCG A  R   C   DWRVLN++
Sbjct  180  RIALECEKRHRSG--------TKLFQEPKWTMYCNGRKCGAAVSRGGACTESDWRVLNTV  231

Query  198  GPITMGAGVLP-GKEDDGI  145
              +T+GAGV+P  K  D +
Sbjct  232  SRVTVGAGVIPTAKSIDDV  250


 Score = 73.6 bits (179),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  264  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  303



>emb|CDY06912.1| BnaA04g24030D [Brassica napus]
Length=303

 Score =   127 bits (320),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 85/139 (61%), Gaps = 11/139 (8%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
            +L  G  S LG RV GTL+G RRG V F+ Q  PR  PA L++LAM T  LV+EMASG V
Sbjct  119  SLVRGGSSSLGRRVTGTLYGHRRGHVTFSVQYGPRSDPALLLDLAMSTATLVKEMASGLV  178

Query  372  RIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSI  199
            RIALECE    +          KL +EP W  YCNGRKCG A  R   C   DWRVLN++
Sbjct  179  RIALECEKRHRSG--------TKLFQEPKWTMYCNGRKCGAALSRGGACTESDWRVLNTV  230

Query  198  GPITMGAGVLP-GKEDDGI  145
              +T+GAGV+P  K  D +
Sbjct  231  SRVTVGAGVIPTAKSIDDV  249


 Score = 73.6 bits (179),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  263  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  302



>gb|KGN51547.1| hypothetical protein Csa_5G577380 [Cucumis sativus]
Length=242

 Score =   130 bits (326),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 9/139 (6%)
 Frame = -2

Query  576  TAVSKLRSA--LTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
             +VSKLRSA  L+FGI++    RV+GT+FG RRG VHF+ Q +    P FLVELAMPT  
Sbjct  61   VSVSKLRSAIALSFGIRTR-SCRVLGTIFGHRRGHVHFSVQTEGSAKPMFLVELAMPTTA  119

Query  402  LVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPD  223
            LVREMASG  RIALECE      +K +  ++        WR YCNG+K G A R ECG +
Sbjct  120  LVREMASGVARIALECERGEKKKKKGELNEEG------IWRAYCNGKKYGVAHRFECGAE  173

Query  222  DWRVLNSIGPITMGAGVLP  166
            +WR+L ++GPIT+GAGVLP
Sbjct  174  EWRILRAVGPITVGAGVLP  192


 Score = 71.2 bits (173),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +M+MRA++ERVVGS+DSEAFYM++PDG GGPELSI+LLR 
Sbjct  203  VMFMRARFERVVGSKDSEAFYMINPDGVGGPELSIFLLRV  242



>ref|XP_004147139.1| PREDICTED: uncharacterized protein LOC101223057 [Cucumis sativus]
 ref|XP_004162041.1| PREDICTED: uncharacterized LOC101223057 [Cucumis sativus]
Length=238

 Score =   129 bits (325),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 9/139 (6%)
 Frame = -2

Query  576  TAVSKLRSA--LTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGV  403
             +VSKLRSA  L+FGI++    RV+GT+FG RRG VHF+ Q +    P FLVELAMPT  
Sbjct  57   VSVSKLRSAIALSFGIRTR-SCRVLGTIFGHRRGHVHFSVQTEGSAKPMFLVELAMPTTA  115

Query  402  LVREMASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPD  223
            LVREMASG  RIALECE      +K +  ++        WR YCNG+K G A R ECG +
Sbjct  116  LVREMASGVARIALECERGEKKKKKGELNEEG------IWRAYCNGKKYGVAHRFECGAE  169

Query  222  DWRVLNSIGPITMGAGVLP  166
            +WR+L ++GPIT+GAGVLP
Sbjct  170  EWRILRAVGPITVGAGVLP  188


 Score = 70.9 bits (172),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            +M+MRA++ERVVGS+DSEAFYM++PDG GGPELSI+LLR 
Sbjct  199  VMFMRARFERVVGSKDSEAFYMINPDGVGGPELSIFLLRV  238



>emb|CDY14782.1| BnaC04g47790D [Brassica napus]
Length=304

 Score =   127 bits (318),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 84/139 (60%), Gaps = 11/139 (8%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
            +L  G  S LG RV GTL+G RRG V F+ Q  PR  P  L++LAM T  LV+EMASG V
Sbjct  120  SLVRGGSSSLGRRVTGTLYGHRRGHVTFSVQYGPRSDPVLLLDLAMSTATLVKEMASGLV  179

Query  372  RIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSI  199
            RIALECE    +          KL +EP W  YCNGRKCG A  R   C   DWRVLN++
Sbjct  180  RIALECEKRHRSG--------TKLFQEPKWTMYCNGRKCGAAVSRGGACTESDWRVLNTV  231

Query  198  GPITMGAGVLP-GKEDDGI  145
              +T+GAGV+P  K  D +
Sbjct  232  SRVTVGAGVIPTAKSIDDV  250


 Score = 73.6 bits (179),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  264  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  303



>emb|CDX79925.1| BnaA05g02310D [Brassica napus]
Length=293

 Score =   126 bits (317),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 87/146 (60%), Gaps = 12/146 (8%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            ++L S +T    S LG RV GTL+G RRG V F+ Q  PR  P  L++LAM T  LV+EM
Sbjct  109  NQLISLVTGRSSSSLGRRVTGTLYGHRRGHVTFSVQYGPRTDPVLLLDLAMSTASLVKEM  168

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE    +          KL  EP W  YCNGRKCG A  R   C   DWR
Sbjct  169  SSGLVRIALECEKRHRSG--------TKLFHEPKWTMYCNGRKCGAAVSRGGACNDSDWR  220

Query  213  VLNSIGPITMGAGVLPGKE--DDGIG  142
            VLN++  +T+GAGV+P  +  DD  G
Sbjct  221  VLNTVSSVTVGAGVIPTAKSIDDMAG  246


 Score = 73.2 bits (178),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  253  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  292



>ref|XP_009142763.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
 ref|XP_009112784.1| PREDICTED: protein MIZU-KUSSEI 1-like [Brassica rapa]
Length=293

 Score =   126 bits (316),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 87/146 (60%), Gaps = 12/146 (8%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            ++L S +T    S LG RV GTL+G RRG V F+ Q  PR  P  L++LAM T  LV+EM
Sbjct  109  NQLISLVTGRSSSSLGRRVTGTLYGHRRGHVTFSVQYGPRTDPVLLLDLAMSTASLVKEM  168

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE    +          KL  EP W  YCNGRKCG A  R   C   DWR
Sbjct  169  SSGLVRIALECEKRHRSG--------TKLFHEPKWTMYCNGRKCGAAVSRGGACNDSDWR  220

Query  213  VLNSIGPITMGAGVLPGKE--DDGIG  142
            VLN++  +T+GAGV+P  +  DD  G
Sbjct  221  VLNTVSSVTVGAGVIPTAKSIDDVAG  246


 Score = 73.6 bits (179),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  253  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  292



>ref|XP_008457962.1| PREDICTED: protein MIZU-KUSSEI 1-like [Cucumis melo]
Length=262

 Score =   135 bits (339),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 92/139 (66%), Gaps = 6/139 (4%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            +  L S L+  ++ P G+RV GTLFG+R+GRV  + QE PR  P+ ++ELAM T VL +E
Sbjct  83   IPSLPSGLSDTLRGPSGSRVTGTLFGYRKGRVSLSIQETPRSFPSIVIELAMQTNVLQKE  142

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            M+SG VRIALECE   +  +      K KL++EP W  +CNG+K G+  +RE   +D +V
Sbjct  143  MSSGMVRIALECEKRADKSD------KTKLMDEPLWTMFCNGKKTGYGVKREASDEDLKV  196

Query  210  LNSIGPITMGAGVLPGKED  154
            +  + P++MGAGVLPG  D
Sbjct  197  MELLRPVSMGAGVLPGNSD  215


 Score = 64.3 bits (155),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL YMRA +ERVVGSRDSE FYM+SP+ + GPELSI+ +R
Sbjct  222  ELAYMRAHFERVVGSRDSETFYMLSPEENNGPELSIFFVR  261



>emb|CDY23837.1| BnaC04g02000D [Brassica napus]
Length=292

 Score =   126 bits (316),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 83/136 (61%), Gaps = 10/136 (7%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            ++L S +T    S LG RV GTL+G RRG V F+ Q  PR  P  L++LAM T  LV+EM
Sbjct  108  NQLISLVTGRSSSSLGRRVTGTLYGHRRGHVTFSVQYGPRTDPVLLLDLAMSTASLVKEM  167

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE    +          KL  EP W  YCNGRKCG A  R   C   DWR
Sbjct  168  SSGLVRIALECEKRHRSG--------TKLFHEPKWTMYCNGRKCGAAVSRGGACNDSDWR  219

Query  213  VLNSIGPITMGAGVLP  166
            VLN++  +T+GAGV+P
Sbjct  220  VLNTVSSVTVGAGVIP  235


 Score = 73.2 bits (178),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  252  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  291



>ref|NP_565953.1| uncharacterized protein [Arabidopsis thaliana]
 sp|O22227.1|MIZ1_ARATH RecName: Full=Protein MIZU-KUSSEI 1 [Arabidopsis thaliana]
 gb|AAK31144.1|AF345340_1 unknown [Arabidopsis thaliana]
 gb|AAB84348.1| expressed protein [Arabidopsis thaliana]
 gb|ABG48414.1| At2g41660 [Arabidopsis thaliana]
 dbj|BAE99934.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10013.1| uncharacterized protein AT2G41660 [Arabidopsis thaliana]
Length=297

 Score =   125 bits (313),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
            +L  G  S LG RV GTL+G +RG V F+ Q + R  P  L++LAM T  LV+EM+SG V
Sbjct  116  SLVTGGSSSLGRRVTGTLYGHKRGHVTFSVQYNQRSDPVLLLDLAMSTATLVKEMSSGLV  175

Query  372  RIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSI  199
            RIALECE    +          KL +EP W  YCNGRKCG+A  R   C   DWRVLN++
Sbjct  176  RIALECEKRHRS--------GTKLFQEPKWTMYCNGRKCGYAVSRGGACTDTDWRVLNTV  227

Query  198  GPITMGAGVLP  166
              +T+GAGV+P
Sbjct  228  SRVTVGAGVIP  238


 Score = 74.3 bits (181),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR K+ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  257  ELLYMRGKFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  296



>ref|XP_004164472.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216750 
[Cucumis sativus]
Length=264

 Score =   134 bits (338),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 92/139 (66%), Gaps = 6/139 (4%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            +  L S L+  ++ P G+RV GTLFG+R+GRV  + QE PR  P+ ++ELAM T VL +E
Sbjct  85   IPSLPSGLSDTLRGPSGSRVTGTLFGYRKGRVSLSMQETPRSFPSIVIELAMQTNVLQKE  144

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            M+SG VRIALECE   +  +      K KL++EP W  +CNG+K G+  +RE   +D +V
Sbjct  145  MSSGMVRIALECEKRADKSD------KTKLMDEPLWTMFCNGKKTGYGVKREASDEDLKV  198

Query  210  LNSIGPITMGAGVLPGKED  154
            +  + P++MGAGVLPG  D
Sbjct  199  MELLRPVSMGAGVLPGNSD  217


 Score = 64.3 bits (155),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL YMRA +ERVVGSRDSE FYM+SP+ + GPELSI+ +R
Sbjct  224  ELAYMRAHFERVVGSRDSETFYMLSPEENNGPELSIFFVR  263



>ref|XP_004148469.1| PREDICTED: uncharacterized protein LOC101216750 [Cucumis sativus]
Length=264

 Score =   134 bits (338),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 92/139 (66%), Gaps = 6/139 (4%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            +  L S L+  ++ P G+RV GTLFG+R+GRV  + QE PR  P+ ++ELAM T VL +E
Sbjct  85   IPSLPSGLSDTLRGPSGSRVTGTLFGYRKGRVSLSMQETPRSFPSIVIELAMQTNVLQKE  144

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRV  211
            M+SG VRIALECE   +  +      K KL++EP W  +CNG+K G+  +RE   +D +V
Sbjct  145  MSSGMVRIALECEKRADKSD------KTKLMDEPLWTMFCNGKKTGYGVKREASDEDLKV  198

Query  210  LNSIGPITMGAGVLPGKED  154
            +  + P++MGAGVLPG  D
Sbjct  199  MELLRPVSMGAGVLPGNSD  217


 Score = 64.3 bits (155),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL YMRA +ERVVGSRDSE FYM+SP+ + GPELSI+ +R
Sbjct  224  ELAYMRAHFERVVGSRDSETFYMLSPEENNGPELSIFFVR  263



>ref|XP_002308021.2| hypothetical protein POPTR_0006s04740g [Populus trichocarpa]
 gb|EEE91544.2| hypothetical protein POPTR_0006s04740g [Populus trichocarpa]
Length=233

 Score =   121 bits (303),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG +V GTLFG R G V FA Q+DP   P  L+EL++ T +LV+EM+SG VRIALECE  
Sbjct  62   LGRKVTGTLFGNRHGHVSFAVQDDPGSEPVLLLELSISTAMLVKEMSSGLVRIALECEKV  121

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
                 + +  +  KL  EP W  YCNGRKCG+A  R C   DW VL ++  +++GAGV+P
Sbjct  122  RA--PQVQTGRPGKLFNEPTWTMYCNGRKCGYAVSRRCTYSDWYVLGTVQSVSVGAGVIP  179

Query  165  GKED  154
              ED
Sbjct  180  VVED  183


 Score = 77.4 bits (189),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+P+G+GGPELSI+LLR
Sbjct  193  ELLYMRAKFERVVGSRDSEAFYMMNPEGNGGPELSIFLLR  232



>gb|KEH41636.1| DUF617 family protein [Medicago truncatula]
Length=284

 Score =   120 bits (301),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -2

Query  540  GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIAL  361
             I   LG +V GTLFG RRG + FA Q  PR  P  L+ELAM T  LV+EM+SG VRIAL
Sbjct  107  SISPSLGRKVTGTLFGNRRGHISFAVQLHPRAEPLLLLELAMSTSSLVKEMSSGLVRIAL  166

Query  360  ECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMG  181
            EC   ++T        + +L  EP W  YCNGRKCG+A  R CG  DW VL ++  +++G
Sbjct  167  ECRKTSST-ASAVSGGRVRLFHEPDWTMYCNGRKCGYAVSRTCGELDWHVLTTVQSVSVG  225

Query  180  AGVLP  166
            AGV+P
Sbjct  226  AGVIP  230


 Score = 78.2 bits (191),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -1

Query  130  LMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            LMYMRAK+ERVVGSRDSEAFYM++PDG+GGPELSI+LLR
Sbjct  245  LMYMRAKFERVVGSRDSEAFYMLNPDGNGGPELSIFLLR  283



>ref|XP_004304339.1| PREDICTED: protein MIZU-KUSSEI 1 [Fragaria vesca subsp. vesca]
Length=285

 Score =   125 bits (315),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 84/140 (60%), Gaps = 12/140 (9%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              +   LG +V GTLFG RRG V FA Q DPR  P  L+ELAM T  LV+EM+SG VRIA
Sbjct  110  LSVTPSLGRKVTGTLFGNRRGSVSFAVQLDPRSEPVLLLELAMSTSSLVKEMSSGLVRIA  169

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LE E +  +        +  L  EP W  YCNGRK G AA R CG  DW VL+++  I++
Sbjct  170  LESERHQGSGR------RKPLFHEPTWTMYCNGRKLGCAASRTCGESDWHVLSTVRSISV  223

Query  183  GAGVLPGKED------DGIG  142
            GAGV+P  +D      +GIG
Sbjct  224  GAGVIPVVDDGKKGASEGIG  243


 Score = 72.4 bits (176),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 40/41 (98%), Gaps = 1/41 (2%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDG-HGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PDG +GGPELSI+LLR
Sbjct  244  ELLYMRARFERVVGSRDSEAFYMLNPDGSNGGPELSIFLLR  284



>ref|XP_011048082.1| PREDICTED: protein MIZU-KUSSEI 1 [Populus euphratica]
Length=263

 Score =   120 bits (302),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = -2

Query  543  FGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIA  364
              I   LG +V GTLFG R G V FA Q++P   P  L+EL++ T +LV+EM+SG VRIA
Sbjct  86   LSITPSLGRKVTGTLFGNRHGHVSFAVQDNPGSEPVLLLELSISTAMLVKEMSSGLVRIA  145

Query  363  LECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITM  184
            LEC+       + +  ++ KL  EP W  YCNGRKCG+A  R C   DW VL ++  +++
Sbjct  146  LECD--KVRAPQVQTGRQGKLFNEPTWTMYCNGRKCGYAVSRRCTYSDWYVLGTVQSVSV  203

Query  183  GAGVLPGKED  154
            GAGV+P  ED
Sbjct  204  GAGVIPVVED  213


 Score = 77.4 bits (189),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYMM+P+G+GGPELSI+LLR
Sbjct  223  ELLYMRAKFERVVGSRDSEAFYMMNPEGNGGPELSIFLLR  262



>gb|KFK37008.1| hypothetical protein AALP_AA4G200300 [Arabis alpina]
Length=300

 Score =   124 bits (312),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 87/146 (60%), Gaps = 11/146 (8%)
 Frame = -2

Query  567  SKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM  388
            ++L S +T    S LG RV GTL+G RRG V F+ Q D R  P  L++LAM T  LV+EM
Sbjct  115  NQLISFVTGRSSSSLGRRVTGTLYGHRRGHVTFSVQFDARSDPVLLLDLAMSTATLVKEM  174

Query  387  ASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWR  214
            +SG VRIALECE               KL  EP W  YCNGRKCG+A  R   C   DWR
Sbjct  175  SSGLVRIALECEKQRRPM-------GTKLFHEPKWTMYCNGRKCGYAVSRGGACTESDWR  227

Query  213  VLNSIGPITMGAGVLPGKE--DDGIG  142
            VLN++  +T+GAGV+P  +  DD  G
Sbjct  228  VLNTVSRVTVGAGVIPTAKCIDDVYG  253


 Score = 72.8 bits (177),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  260  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  299



>gb|AAM64986.1| unknown [Arabidopsis thaliana]
Length=297

 Score =   122 bits (307),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = -2

Query  552  ALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPV  373
            +L  G  S LG RV GTL+G +RG V F+ Q +    P  L++LAM T  LV+EM+SG V
Sbjct  116  SLVTGGSSSLGRRVTGTLYGHKRGHVTFSVQYNQSSDPVLLLDLAMSTATLVKEMSSGLV  175

Query  372  RIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSI  199
            RIALECE    +          KL +EP W  YCNGRKCG+A  R   C   DWRVLN++
Sbjct  176  RIALECEKRHRS--------GTKLFQEPKWTMYCNGRKCGYAVSRGGACTDTDWRVLNTV  227

Query  198  GPITMGAGVLP  166
              +T+GAGV+P
Sbjct  228  SRVTVGAGVIP  238


 Score = 74.3 bits (181),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR K+ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  257  ELLYMRGKFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  296



>ref|XP_006843508.1| hypothetical protein AMTR_s00053p00226450 [Amborella trichopoda]
 gb|ERN05183.1| hypothetical protein AMTR_s00053p00226450 [Amborella trichopoda]
Length=254

 Score =   119 bits (299),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 8/120 (7%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG RV GTLFG R+G V F+ Q  P   PA L+ELA+PT  LV+EM SG VRIALEC G 
Sbjct  92   LGRRVTGTLFGHRKGHVTFSVQASPSAEPALLLELAVPTSGLVKEMGSGLVRIALEC-GR  150

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
             ++           L +EP W  YCNGRK G+A  R C   DWRVL+++  +++GAGVLP
Sbjct  151  VHS-------SPRSLFDEPVWSMYCNGRKAGYAVARACSEGDWRVLSAVKAVSVGAGVLP  203


 Score = 77.0 bits (188),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+MYMRA++ERVVGSRDSEAFYM+SPDG+GGPELSI+LLR
Sbjct  214  EVMYMRARFERVVGSRDSEAFYMVSPDGNGGPELSIFLLR  253



>ref|XP_010555003.1| PREDICTED: protein MIZU-KUSSEI 1, partial [Tarenaya hassleriana]
Length=279

 Score =   128 bits (322),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = -2

Query  564  KLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMA  385
            +L +  T G  S LG RV GTL+G RRG V FA Q DPR  P  ++ELAM T  LV+EM+
Sbjct  87   QLITIATGGGSSSLGRRVTGTLYGHRRGHVTFAVQYDPRSDPVLVLELAMSTAALVKEMS  146

Query  384  SGPVRIALECE---GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR-ECGPDDW  217
            SG VRIALECE          + ++++  KL +EP W  YCNG+KCG+A  R  C   DW
Sbjct  147  SGLVRIALECEKRPPAAEEAAERRRRRPVKLFQEPMWTMYCNGKKCGYAVSRGACNESDW  206

Query  216  RVLNSIGPITMGAGVLPGKE  157
            RVLN++  +++GAGV+P ++
Sbjct  207  RVLNTVSRVSVGAGVIPAEK  226


 Score = 68.2 bits (165),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -1

Query  124  YMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            YMR ++ERVVGSRDSEAFYMM+PD +GGPELSI+LLR
Sbjct  242  YMRGRFERVVGSRDSEAFYMMNPDKNGGPELSIFLLR  278



>ref|XP_009767122.1| PREDICTED: protein MIZU-KUSSEI 1 [Nicotiana sylvestris]
Length=260

 Score =   120 bits (302),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = -2

Query  537  IKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALE  358
            I   LG +  GTLFG RRG V FA Q +P   P  L+E A+ T  LV++M+SG VRIALE
Sbjct  89   IPISLGRKFTGTLFGHRRGHVSFAIQNNPTSEPILLIEFAISTSALVKDMSSGLVRIALE  148

Query  357  CEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGA  178
            CE      +  +  +  +L +EP W  YCNGRKCG+A  R C   DW VL ++  +++GA
Sbjct  149  CE------KAPRGSRHVRLFQEPRWTMYCNGRKCGYALSRACTDSDWHVLRTVQNVSVGA  202

Query  177  GVLPGKED  154
            GV+P  +D
Sbjct  203  GVIPVVDD  210


 Score = 75.1 bits (183),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            EL+YMRAK+ERVVG+RDSEAFYMM+ DG+GGPELSI+LLR 
Sbjct  220  ELLYMRAKFERVVGNRDSEAFYMMNLDGNGGPELSIFLLRT  260



>ref|XP_010099883.1| hypothetical protein L484_020066 [Morus notabilis]
 gb|EXB80812.1| hypothetical protein L484_020066 [Morus notabilis]
Length=259

 Score =   128 bits (322),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 83/127 (65%), Gaps = 7/127 (6%)
 Frame = -2

Query  534  KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALEC  355
            +S  G RV GTLFG+R+GRV F+ QE PR  P+ +VELAM T VL REM+SG VRIALEC
Sbjct  93   RSSNGQRVTGTLFGYRKGRVSFSVQETPRCLPSLVVELAMQTNVLQREMSSGMVRIALEC  152

Query  354  EGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG  175
            E           K K +L+EEP W  YC+G+K G+  +RE   +D  V+  +  ++MGAG
Sbjct  153  EKRQE-------KDKTRLMEEPVWTMYCDGKKSGYGVKREANEEDLNVMEILKAVSMGAG  205

Query  174  VLPGKED  154
            VLPG  D
Sbjct  206  VLPGNSD  212


 Score = 66.2 bits (160),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA ++RVVGSRDSE  YM+SPDGH GPEL+I+ +R
Sbjct  219  EMAYMRAHFDRVVGSRDSETLYMLSPDGHSGPELTIFFVR  258



>emb|CDY22533.1| BnaC03g23430D [Brassica napus]
Length=288

 Score =   121 bits (304),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 78/127 (61%), Gaps = 10/127 (8%)
 Frame = -2

Query  540  GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIAL  361
            G  S LG RV GTL+G RRG V F+ Q  P   P FL++LAM T  LV+EM+SG VRIAL
Sbjct  113  GGSSSLGKRVTGTLYGQRRGHVTFSVQYGPSSNPVFLLDLAMSTATLVKEMSSGLVRIAL  172

Query  360  ECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDWRVLNSIGPIT  187
            ECE    +          KL  EP W  YCNGRK G+A  R   C   DWRVLN++  +T
Sbjct  173  ECEKRHRS--------GTKLFHEPKWTMYCNGRKFGYAVSRGGACKESDWRVLNTVSRVT  224

Query  186  MGAGVLP  166
            +GAGV+P
Sbjct  225  VGAGVIP  231


 Score = 71.6 bits (174),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMR ++ERVVG+RDSEAFYMM+PD +GGPELSI+LLR
Sbjct  248  ELLYMRGRFERVVGTRDSEAFYMMNPDKNGGPELSIFLLR  287



>ref|XP_002975521.1| hypothetical protein SELMODRAFT_35960, partial [Selaginella moellendorffii]
 gb|EFJ23150.1| hypothetical protein SELMODRAFT_35960, partial [Selaginella moellendorffii]
Length=166

 Score =   125 bits (313),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = -2

Query  534  KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALEC  355
            +  +G+ VVGTL+G+RRG V  A QEDP+  P  L+ELA PT  LVREM+SG +RIALEC
Sbjct  1    QQSVGSIVVGTLYGYRRGHVFLAVQEDPKSEPVVLLELATPTSCLVREMSSGLLRIALEC  60

Query  354  E-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGA  178
            E G +N         +  L +E  W  +CNGRK G+A  R CG  D RVL  +  ++MGA
Sbjct  61   ERGGSN---------RGFLFQESIWSMFCNGRKAGYAVSRHCGASDTRVLGLVQSVSMGA  111

Query  177  GVLPGK  160
            GVLPG+
Sbjct  112  GVLPGE  117


 Score = 68.2 bits (165),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRAK+ERVVGS DSEA YM++P+G G PELSI+ LR
Sbjct  126  ELMYMRAKFERVVGSNDSEALYMVNPNGSGAPELSIFFLR  165



>ref|XP_002993523.1| hypothetical protein SELMODRAFT_25526, partial [Selaginella moellendorffii]
 gb|EFJ05415.1| hypothetical protein SELMODRAFT_25526, partial [Selaginella moellendorffii]
Length=166

 Score =   124 bits (312),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = -2

Query  534  KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALEC  355
            +  +G+ VVGTL+G+RRG V  A QEDP+  P  L+ELA PT  LVREM+SG +RIALEC
Sbjct  1    QQSVGSIVVGTLYGYRRGHVFLAVQEDPKSEPVVLLELATPTSCLVREMSSGLLRIALEC  60

Query  354  E-GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGA  178
            E G +N         +  L +E  W  +CNGRK G+A  R CG  D RVL  +  ++MGA
Sbjct  61   ERGGSN---------RGFLFQESIWSMFCNGRKAGYAVSRHCGASDARVLGLVQSVSMGA  111

Query  177  GVLPGK  160
            GVLPG+
Sbjct  112  GVLPGE  117


 Score = 68.2 bits (165),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRAK+ERVVGS DSEA YM++P+G G PELSI+ LR
Sbjct  126  ELMYMRAKFERVVGSNDSEALYMVNPNGSGAPELSIFFLR  165



>ref|XP_002323323.2| hypothetical protein POPTR_0016s05720g [Populus trichocarpa]
 gb|EEF05084.2| hypothetical protein POPTR_0016s05720g [Populus trichocarpa]
Length=263

 Score =   117 bits (294),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 82/138 (59%), Gaps = 6/138 (4%)
 Frame = -2

Query  546  TFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
               I   LG +V GT+FG R G V+FA Q+DP   P  L+EL M T +LV+EM+SG VRI
Sbjct  85   NLSITPSLGRKVTGTIFGNRHGHVNFAVQDDPVSEPVLLLELPMSTAMLVKEMSSGLVRI  144

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALEC+       + +  ++ KL  EP W  YCNGRKCG+A  R C   D  V  ++  ++
Sbjct  145  ALECD--KVRAPQVQTGRQGKLFNEPTWTMYCNGRKCGYAVSRRCTYSDQYVFETVKSVS  202

Query  186  MGAGVLPGKED----DGI  145
             GAGV+P  ED    DG+
Sbjct  203  AGAGVIPVIEDGHKSDGV  220


 Score = 74.3 bits (181),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            ELMYMRAK+ERVVGSRDSEA+YMM+P+G+G PELSI+LLR
Sbjct  223  ELMYMRAKFERVVGSRDSEAYYMMNPEGNGVPELSIFLLR  262



>ref|XP_008246160.1| PREDICTED: protein MIZU-KUSSEI 1 [Prunus mume]
Length=248

 Score =   128 bits (322),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE PR  P+ +VELAM T VL +EM SG VRIALECE   
Sbjct  86   GTRVSGTLFGYRKGRVSLSIQETPRCLPSLVVELAMQTNVLQKEMGSGMVRIALECEKRA  145

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +       K K  LL+EP W  YCNG+K G+A +RE   +D  V+  +  +TMGA VLPG
Sbjct  146  D-------KDKTSLLDEPMWTMYCNGKKSGYAVKREAAEEDLSVMELLKAVTMGAAVLPG  198

Query  162  KED  154
            K +
Sbjct  199  KSE  201


 Score = 63.5 bits (153),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E++YMRA +ER+VGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  208  EMVYMRALFERIVGSKDSETLYMLSPEGNNGPELSIFFVR  247



>ref|XP_007207067.1| hypothetical protein PRUPE_ppa026544mg [Prunus persica]
 gb|EMJ08266.1| hypothetical protein PRUPE_ppa026544mg [Prunus persica]
Length=248

 Score =   127 bits (320),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE PR  P+ +VELAM T VL +EM SG VRIALECE   
Sbjct  86   GTRVSGTLFGYRKGRVSLSIQETPRCLPSLVVELAMQTNVLQKEMGSGMVRIALECEKRA  145

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +       + K  LL+EP W  YCNG+K G+A +RE   +D  V+  +  +TMGA VLPG
Sbjct  146  D-------RDKTSLLDEPVWTMYCNGKKSGYAVKREATEEDLSVMELLKAVTMGAAVLPG  198

Query  162  KED  154
            K +
Sbjct  199  KSE  201


 Score = 63.9 bits (154),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E++YMRA +ER+VGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  208  EMVYMRALFERIVGSKDSETLYMLSPEGNNGPELSIFFVR  247



>ref|XP_009334887.1| PREDICTED: protein MIZU-KUSSEI 1 [Pyrus x bretschneideri]
Length=252

 Score =   127 bits (318),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE PR  P+ +VELAM T VL +EM SG VRIALECE   
Sbjct  90   GTRVSGTLFGYRKGRVSLSVQETPRCLPSLVVELAMQTNVLQKEMGSGMVRIALECEKRA  149

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +  +        +L++EP W  YCNG+K G+  +RE   +D  V+  +  +TMGAGVLPG
Sbjct  150  DKEK-------TRLIDEPVWTIYCNGKKTGYGVKREATEEDLNVMELLKAVTMGAGVLPG  202

Query  162  KED  154
            K +
Sbjct  203  KSE  205


 Score = 64.7 bits (156),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E++YMRA +ERVVGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  212  EMVYMRALFERVVGSKDSETLYMLSPEGNNGPELSIFFVR  251



>ref|XP_010030390.1| PREDICTED: protein MIZU-KUSSEI 1 [Eucalyptus grandis]
 gb|KCW54376.1| hypothetical protein EUGRSUZ_I00327 [Eucalyptus grandis]
Length=246

 Score =   128 bits (321),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 11/137 (8%)
 Frame = -2

Query  552  ALTFGIKSPL----GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMA  385
            +L  GI  P     G+RV GTLFG+R+GRV  + QE P+  P  +VELAM T VL +E++
Sbjct  70   SLPMGIPDPHRTASGSRVTGTLFGYRKGRVSLSMQETPKCLPTLVVELAMQTNVLQKELS  129

Query  384  SGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLN  205
            SG VRIALECE   +       K K K+L+EP W  YCNG+K G+  +RE   +D  V+ 
Sbjct  130  SGMVRIALECEKRPD-------KDKTKILDEPLWTMYCNGKKAGYGVKREASAEDLSVME  182

Query  204  SIGPITMGAGVLPGKED  154
             + P++MGAGVLPG  D
Sbjct  183  HLKPVSMGAGVLPGNSD  199


 Score = 63.5 bits (153),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL YMRA +ERVVGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  206  ELAYMRAHFERVVGSKDSETLYMLSPEGNTGPELSIFFVR  245



>gb|EYU20757.1| hypothetical protein MIMGU_mgv1a020233mg, partial [Erythranthe 
guttata]
Length=247

 Score =   115 bits (288),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 3/129 (2%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE--  352
            LG +V GTLFG R G V FA Q DP+  P  ++ELA+ T  LV+EM+S  VRIALECE  
Sbjct  67   LGRKVTGTLFGNRHGYVSFAVQVDPKSVPVLVIELAVSTAALVKEMSSALVRIALECEKP  126

Query  351  -GNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG  175
                         K A+L  EP W  YCNGR+CG A  R C   DW VL ++  +++GAG
Sbjct  127  QTPRRGGGGGPGGKAARLYGEPGWTMYCNGRQCGNAQVRACTESDWHVLRTVQSVSVGAG  186

Query  174  VLPGKEDDG  148
            V+P  +D G
Sbjct  187  VIPVVDDGG  195


 Score = 75.5 bits (184),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRA++ERVVGSRDSEAFYM++PDG+ GPELSI+LLR
Sbjct  207  ELLYMRARFERVVGSRDSEAFYMLNPDGNSGPELSIFLLR  246



>ref|XP_008359614.1| PREDICTED: LOW QUALITY PROTEIN: protein MIZU-KUSSEI 1-like [Malus 
domestica]
Length=266

 Score =   127 bits (318),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE PR  P+ +VE+AM T VL +EM SG VRIALECE   
Sbjct  104  GTRVSGTLFGYRKGRVSLSVQETPRCLPSLVVEMAMQTNVLQKEMGSGMVRIALECEKRA  163

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +  +        +L++EP W  YCNG+K G+  +RE   +D  V+  +  +TMGAGVLPG
Sbjct  164  DKEK-------TRLIDEPVWTIYCNGKKTGYGMKREATEEDLNVMELLKAVTMGAGVLPG  216

Query  162  KED  154
            K +
Sbjct  217  KSE  219


 Score = 63.5 bits (153),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA +ERVVGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  226  EMAYMRALFERVVGSKDSETLYMLSPEGNNGPELSIFFVR  265



>ref|XP_006827095.1| hypothetical protein AMTR_s00010p00241490 [Amborella trichopoda]
 gb|ERM94332.1| hypothetical protein AMTR_s00010p00241490 [Amborella trichopoda]
Length=242

 Score =   119 bits (298),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 81/128 (63%), Gaps = 11/128 (9%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G+R+ GTLFG R+GRV  + QE+PR  P  ++ELAM T  L++EMASG VRIALE E   
Sbjct  82   GSRITGTLFGHRKGRVSLSIQENPRCLPTAIIELAMQTNSLLKEMASGLVRIALETEKKA  141

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP-  166
                      K KLL+EP W  YCNGRK G+  RRE   +D  V+  +  ++MGAGVLP 
Sbjct  142  --------ADKTKLLDEPLWSMYCNGRKAGYGVRREAAEEDLGVMQMLQAVSMGAGVLPT  193

Query  165  --GKEDDG  148
              G+ +DG
Sbjct  194  ASGEGEDG  201


 Score = 70.5 bits (171),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA +ERVVGSRDSEAFYM++PDG+GGPELSI+ +R
Sbjct  202  EMTYMRAHFERVVGSRDSEAFYMLNPDGNGGPELSIFFVR  241



>ref|XP_009589332.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana tomentosiformis]
Length=262

 Score =   115 bits (288),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = -2

Query  525  LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGN  346
            LG +  GTLFG RRG V FA Q +P   P  L+E A+ T  LV++M+SG VRIALECE  
Sbjct  95   LGRKFTGTLFGHRRGHVSFAIQNNPTSEPILLIEFAISTSALVKDMSSGLVRIALECE--  152

Query  345  TNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP  166
                +  +  +  +L +EP W  YCNGRKCG+A  R C   D  VL ++  +++GAGV+P
Sbjct  153  ----KAPRGSRHVRLFKEPRWTMYCNGRKCGYALSRACAGSDRHVLRTVQNVSVGAGVIP  208

Query  165  GKED  154
              +D
Sbjct  209  VVDD  212


 Score = 73.9 bits (180),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLRA  11
            EL+YMRAK+ERVVG+RDSEAFYMM+ DG+GGPELSI+L+R 
Sbjct  222  ELLYMRAKFERVVGNRDSEAFYMMNLDGNGGPELSIFLIRT  262



>ref|XP_004302225.1| PREDICTED: protein MIZU-KUSSEI 1 [Fragaria vesca subsp. vesca]
Length=263

 Score =   125 bits (314),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 82/123 (67%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE     P+F+VELAM T VL +EM+SG VRIALECE   
Sbjct  101  GVRVSGTLFGYRKGRVCLSIQESSNTLPSFIVELAMQTNVLQKEMSSGMVRIALECEKRG  160

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +       K K +L++EP W  +CNG+K G+A +RE   +D  V+  +  +TMGAGVLPG
Sbjct  161  D-------KDKTRLMDEPVWTMFCNGKKTGYAVKREATEEDLNVMELLKAVTMGAGVLPG  213

Query  162  KED  154
            K D
Sbjct  214  KSD  216


 Score = 63.5 bits (153),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA +ERVVGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  223  EMAYMRALFERVVGSKDSETLYMLSPEGNNGPELSIFFVR  262



>ref|XP_008465295.1| PREDICTED: protein MIZU-KUSSEI 1-like [Cucumis melo]
Length=267

 Score =   113 bits (283),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -2

Query  543  FGIKSPLGARVV-GTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRI  367
              ++  LG RVV GTLFG RRG V FA Q  P+  P  L+ELA  T  LV+EM+SG VRI
Sbjct  92   LSVRPSLGRRVVTGTLFGRRRGHVTFAVQIHPQSEPVLLLELATSTSSLVKEMSSGLVRI  151

Query  366  ALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPIT  187
            ALE E            +  KL EEP W  YCNGRKCG +  R CG  D  VLN +  ++
Sbjct  152  ALESEA-----PAYNDGRPKKLFEEPRWTMYCNGRKCGHSMLRTCGEFDRYVLNMVQSVS  206

Query  186  MGAGVLPGKEDDG  148
            +GAGV+P  E+ G
Sbjct  207  VGAGVIPVVENGG  219


 Score = 75.5 bits (184),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            EL+YMRAK+ERVVGSRDSEAFYM++PD +GGPELSI+LLR
Sbjct  227  ELLYMRAKFERVVGSRDSEAFYMINPDSNGGPELSIFLLR  266



>ref|XP_008359600.1| PREDICTED: protein MIZU-KUSSEI 1-like [Malus domestica]
Length=252

 Score =   124 bits (312),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G RV GTLFG+R+GRV  + QE PR  P+ +VE AM T VL +EM SG VRIALECE   
Sbjct  90   GTRVSGTLFGYRKGRVSLSVQETPRCLPSLVVEXAMQTNVLQKEMGSGMVRIALECEKRA  149

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
            +  +        +L++EP W  YCNG+K G+  +RE   +D  V+  +  +TMGAGVLPG
Sbjct  150  DKEK-------TRLIDEPVWTIYCNGKKTGYGMKREATEEDLNVMELLKAVTMGAGVLPG  202

Query  162  KED  154
            K +
Sbjct  203  KSE  205


 Score = 63.5 bits (153),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA +ERVVGS+DSE  YM+SP+G+ GPELSI+ +R
Sbjct  212  EMAYMRALFERVVGSKDSETLYMLSPEGNNGPELSIFFVR  251



>ref|XP_006294693.1| hypothetical protein CARUB_v10023729mg [Capsella rubella]
 gb|EOA27591.1| hypothetical protein CARUB_v10023729mg [Capsella rubella]
Length=296

 Score =   130 bits (326),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 86/137 (63%), Gaps = 10/137 (7%)
 Frame = -2

Query  570  VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE  391
            VS    +L  G  S LG RV GTL+G RRG V F+ Q DPR  P  L++LAM T  LV+E
Sbjct  113  VSNQLISLVTGGSSSLGRRVTGTLYGHRRGHVTFSVQYDPRSDPVLLLDLAMSTATLVKE  172

Query  390  MASGPVRIALECEGNTNTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARR--ECGPDDW  217
            M+SG VRIALECE         + +   KL +EP W  YCNGRKCG+A  R   C   DW
Sbjct  173  MSSGLVRIALECE--------KRHRPGTKLFQEPKWTMYCNGRKCGYAVSRGGACTDSDW  224

Query  216  RVLNSIGPITMGAGVLP  166
            RVLN++  +T+GAGV+P
Sbjct  225  RVLNTVSRVTVGAGVIP  241


 Score = 57.8 bits (138),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE  35
            EL+YMR ++ERVVGSRDSEAFYMM+PD +GG E
Sbjct  260  ELLYMRGRFERVVGSRDSEAFYMMNPDKNGGKE  292



>ref|XP_009764440.1| PREDICTED: protein MIZU-KUSSEI 1-like [Nicotiana sylvestris]
Length=250

 Score =   127 bits (320),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -2

Query  522  GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT  343
            G+R+ GTLFG+R+GRV  + QE+PR  P  +VELA+ T VL +EM  G VRIALECE   
Sbjct  88   GSRITGTLFGYRKGRVSISIQENPRTLPTVVVELALQTNVLQKEMNLGMVRIALECEKRD  147

Query  342  NTWEknkkkkkaKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG  163
               +         LLEEP W  YCNG+K G+  +RE   +D  V+  + P++MGAGVLPG
Sbjct  148  KKEK-------INLLEEPLWSMYCNGKKTGYGVKREATEEDLNVMEILKPVSMGAGVLPG  200

Query  162  KED  154
            K D
Sbjct  201  KSD  203


 Score = 60.1 bits (144),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  133  ELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPELSIYLLR  14
            E+ YMRA +ERVV S+D+E  YM+SPD + GPELSI+ +R
Sbjct  210  EMTYMRAHFERVVKSKDAETLYMLSPDANDGPELSIFFVR  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335