BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001P06

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    294   5e-92   
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    293   5e-92   
ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    293   1e-91   Nicotiana sylvestris
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      276   4e-90   
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    293   2e-89   
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    293   2e-89   
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    287   3e-89   Nicotiana tomentosiformis
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    293   4e-89   Nicotiana tomentosiformis
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    293   4e-89   Nicotiana tomentosiformis
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    292   1e-88   Nicotiana sylvestris
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    290   5e-88   Solanum tuberosum [potatoes]
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    282   1e-87   Nicotiana sylvestris
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    290   1e-87   Solanum lycopersicum
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    272   7e-87   
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    285   2e-86   Nicotiana tomentosiformis
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    285   2e-86   Nicotiana tomentosiformis
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             286   2e-86   Prunus persica
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    286   2e-86   Nicotiana tomentosiformis
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    278   4e-86   
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                285   7e-86   Erythranthe guttata [common monkey flower]
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    278   9e-86   Cucumis melo [Oriental melon]
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    284   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    285   1e-85   Prunus mume [ume]
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    284   1e-85   Prunus mume [ume]
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    284   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    277   2e-85   Glycine max [soybeans]
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    276   2e-85   Vitis vinifera
emb|CBI23694.3|  unnamed protein product                                284   2e-85   Vitis vinifera
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    283   2e-85   Fragaria vesca subsp. vesca
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    283   2e-85   
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    283   2e-85   
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    283   3e-85   
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    281   4e-85   
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    276   5e-85   
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    281   1e-84   Sesamum indicum [beniseed]
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    273   5e-84   Populus euphratica
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g            276   9e-84   Phaseolus vulgaris [French bean]
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...    275   1e-83   
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg             278   1e-83   
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    278   2e-83   
gb|KHN01041.1|  Putative fatty acid methyltransferase                   277   2e-83   Glycine soja [wild soybean]
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       260   2e-83   Cucumis sativus [cucumbers]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    278   2e-83   Cucumis melo [Oriental melon]
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    278   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    278   3e-83   Nicotiana tomentosiformis
emb|CDY67345.1|  BnaCnng54600D                                          268   4e-83   Brassica napus [oilseed rape]
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    268   4e-83   Populus euphratica
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    277   4e-83   
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...    275   5e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             277   5e-83   Capsella rubella
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    277   6e-83   Glycine max [soybeans]
gb|KHN30725.1|  Putative fatty acid methyltransferase                   275   6e-83   Glycine soja [wild soybean]
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    276   1e-82   Citrus sinensis [apfelsine]
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    265   1e-82   Populus euphratica
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    276   2e-82   Vitis vinifera
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    275   2e-82   Glycine max [soybeans]
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    275   2e-82   Nelumbo nucifera [Indian lotus]
emb|CBI23697.3|  unnamed protein product                                276   2e-82   Vitis vinifera
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             275   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_011470583.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahyd...    265   2e-82   Fragaria vesca subsp. vesca
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...    273   3e-82   Populus euphratica
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    275   5e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    274   5e-82   
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    265   8e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       274   8e-82   Cucumis sativus [cucumbers]
emb|CDY09021.1|  BnaC01g30700D                                          273   9e-82   Brassica napus [oilseed rape]
emb|CDO99279.1|  unnamed protein product                                273   1e-81   Coffea canephora [robusta coffee]
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...    273   1e-81   Solanum lycopersicum
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    268   1e-81   Brassica rapa
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...    272   2e-81   Camelina sativa [gold-of-pleasure]
emb|CDX77504.1|  BnaA07g06420D                                          273   2e-81   
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    273   2e-81   Populus euphratica
emb|CDX85109.1|  BnaC07g07970D                                          273   2e-81   
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    273   2e-81   Populus euphratica
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    273   2e-81   Solanum lycopersicum
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    272   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    258   5e-81   
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         271   7e-81   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           271   7e-81   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68017.1|  hypothetical protein VITISV_025151                     271   7e-81   Vitis vinifera
gb|AAL57657.1|  AT3g23510/MEE5_5                                        271   7e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    262   8e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         261   9e-81   Solanum tuberosum [potatoes]
dbj|BAD44154.1|  unnamed protein product                                271   9e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    271   1e-80   Brassica rapa
ref|XP_004307322.2|  PREDICTED: uncharacterized protein LOC101300392    251   1e-80   Fragaria vesca subsp. vesca
emb|CDX77513.1|  BnaA07g06510D                                          268   3e-80   
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           269   4e-80   Medicago truncatula
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    263   4e-80   
ref|XP_011470580.1|  PREDICTED: sterol 24-C-methyltransferase-like      254   4e-80   Fragaria vesca subsp. vesca
gb|EPS65744.1|  cyclopropane fatty acid synthase                        263   4e-80   Genlisea aurea
dbj|BAB01742.1|  unnamed protein product                                268   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             269   6e-80   
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         268   1e-79   Jatropha curcas
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             268   1e-79   Eutrema salsugineum [saltwater cress]
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    268   1e-79   Brassica rapa
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             259   1e-79   
emb|CDX92987.1|  BnaA03g37090D                                          268   1e-79   
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    268   2e-79   
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    268   2e-79   Theobroma cacao [chocolate]
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    268   2e-79   Brassica rapa
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       252   2e-79   Cucumis sativus [cucumbers]
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         267   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    267   3e-79   Populus euphratica
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    267   3e-79   Populus euphratica
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    260   3e-79   
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    253   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX94854.1|  BnaC03g43340D                                          266   6e-79   
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    266   6e-79   Tarenaya hassleriana [spider flower]
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...    263   7e-79   
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  251   1e-78   Citrus sinensis [apfelsine]
emb|CDX77514.1|  BnaA07g06520D                                          264   2e-78   
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    264   3e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             248   4e-78   
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    264   4e-78   
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    251   4e-78   
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...    262   5e-78   Nicotiana tomentosiformis
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    264   5e-78   
ref|XP_002528810.1|  methyltransferase, putative                        263   7e-78   Ricinus communis
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    259   9e-78   
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    259   9e-78   Phoenix dactylifera
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    263   1e-77   Eucalyptus grandis [rose gum]
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    262   2e-77   Nicotiana tomentosiformis
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    262   2e-77   Nicotiana tomentosiformis
gb|AAT74602.1|  cyclopropane fatty acid synthase                        262   2e-77   Gossypium hirsutum [American cotton]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    261   3e-77   Gossypium raimondii
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    252   3e-77   Arabis alpina [alpine rockcress]
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    261   4e-77   Solanum tuberosum [potatoes]
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    260   6e-77   
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    261   6e-77   Eucalyptus grandis [rose gum]
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             252   6e-77   
gb|KJB38366.1|  hypothetical protein B456_006G251800                    259   7e-77   Gossypium raimondii
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    249   9e-77   
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    251   1e-76   Solanum lycopersicum
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    260   1e-76   Tarenaya hassleriana [spider flower]
gb|KHG28468.1|  putative fatty acid methyltransferase                   259   1e-76   Gossypium arboreum [tree cotton]
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    251   1e-76   Eucalyptus grandis [rose gum]
gb|KJB38367.1|  hypothetical protein B456_006G251800                    260   1e-76   Gossypium raimondii
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    260   1e-76   
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    260   1e-76   Phoenix dactylifera
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  249   1e-76   Citrus sinensis [apfelsine]
gb|KHG28467.1|  putative fatty acid methyltransferase                   259   1e-76   Gossypium arboreum [tree cotton]
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         249   5e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          258   6e-76   
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             248   1e-75   
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    257   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338    256   1e-75   
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             248   2e-75   
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    251   3e-75   
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    253   4e-75   Citrus sinensis [apfelsine]
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    252   5e-75   Populus euphratica
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             246   8e-75   
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      254   2e-74   
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    251   2e-74   Elaeis guineensis
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    251   2e-74   Citrus sinensis [apfelsine]
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    252   2e-74   
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    253   5e-74   Citrus sinensis [apfelsine]
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    241   1e-73   Tarenaya hassleriana [spider flower]
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       251   1e-73   Cucumis sativus [cucumbers]
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     251   1e-73   Eucalyptus grandis [rose gum]
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    251   2e-73   Elaeis guineensis
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    251   2e-73   
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    250   3e-73   Eucalyptus grandis [rose gum]
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    251   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    241   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             249   7e-73   
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      240   4e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           246   9e-72   Medicago truncatula
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    231   2e-71   Nicotiana sylvestris
emb|CDY18120.1|  BnaA01g23810D                                          236   5e-71   Brassica napus [oilseed rape]
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          237   9e-71   
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    236   1e-70   Brassica rapa
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    242   2e-70   
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   231   5e-70   
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    241   8e-70   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ91247.1|  predicted protein                                      229   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001059618.1|  Os07g0474600                                       229   4e-69   
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    230   1e-68   Tarenaya hassleriana [spider flower]
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  237   1e-68   Citrus sinensis [apfelsine]
ref|NP_001066537.1|  Os12g0267200                                       237   2e-68   
ref|XP_002883432.1|  predicted protein                                  225   6e-68   
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    228   8e-68   
gb|ABG37642.1|  cyclopropane fatty acid synthase                        239   9e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         227   9e-68   
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...    235   9e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   235   9e-68   
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         227   1e-67   
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             223   1e-67   
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    235   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    238   3e-67   
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    226   3e-67   
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    226   3e-67   Camelina sativa [gold-of-pleasure]
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           233   3e-67   Triticum urartu
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    233   4e-67   
gb|EEC78767.1|  hypothetical protein OsI_18995                          237   4e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    233   5e-67   Populus euphratica
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             233   5e-67   
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    233   7e-67   
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   233   8e-67   Zea mays [maize]
gb|EEE62857.1|  hypothetical protein OsJ_17660                          231   3e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67149.1|  hypothetical protein OsJ_24210                          229   3e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    231   5e-66   Setaria italica
dbj|BAJ95828.1|  predicted protein                                      229   6e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          228   9e-66   
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    229   9e-66   
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    229   1e-65   Brachypodium distachyon [annual false brome]
dbj|BAJ93367.1|  predicted protein                                      229   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC82010.1|  hypothetical protein OsI_25960                          229   2e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    229   2e-65   Citrus sinensis [apfelsine]
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   229   2e-65   
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           228   3e-65   
dbj|BAK04927.1|  predicted protein                                      210   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    218   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296401.1|  PREDICTED: uncharacterized protein LOC101310979    218   4e-64   Fragaria vesca subsp. vesca
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         218   4e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09025.1|  BnaC01g30660D                                          207   8e-64   Brassica napus [oilseed rape]
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    223   4e-63   Sesamum indicum [beniseed]
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    222   5e-63   
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    217   5e-63   
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   222   5e-63   Citrus sinensis [apfelsine]
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    222   6e-63   Sesamum indicum [beniseed]
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    221   9e-63   Sesamum indicum [beniseed]
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    219   4e-62   Oryza brachyantha
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         219   8e-62   Sterculia foetida
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   213   8e-62   
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           216   1e-61   Triticum urartu
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    216   4e-61   
dbj|BAJ86532.1|  predicted protein                                      202   3e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             211   4e-59   Selaginella moellendorffii
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase           211   4e-59   Gossypium arboreum [tree cotton]
gb|EPS70161.1|  hypothetical protein M569_04599                         211   4e-59   Genlisea aurea
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    204   8e-59   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12590.1|  hypothetical protein B456_002G025800                    209   2e-58   Gossypium raimondii
gb|KJB12595.1|  hypothetical protein B456_002G026100                    209   2e-58   Gossypium raimondii
gb|AAT74601.1|  cyclopropane fatty acid synthase                        209   2e-58   Gossypium hirsutum [American cotton]
gb|AAT74600.1|  cyclopropane fatty acid synthase                        208   6e-58   Gossypium hirsutum [American cotton]
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           205   2e-57   Triticum urartu
gb|EMT01203.1|  Cyclopropane-fatty-acyl-phospholipid synthase           192   7e-57   
ref|XP_001769171.1|  predicted protein                                  205   7e-57   
gb|KJB70811.1|  hypothetical protein B456_011G092100                    204   1e-56   Gossypium raimondii
dbj|BAK05892.1|  predicted protein                                      202   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05129.1|  predicted protein                                      202   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             193   4e-55   
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           198   5e-55   Triticum urartu
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             181   3e-52   
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                191   3e-52   Erythranthe guttata [common monkey flower]
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           191   3e-52   
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           191   5e-52   Triticum urartu
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    191   8e-52   
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    191   9e-52   
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    191   1e-51   Setaria italica
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    191   1e-51   Setaria italica
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          189   2e-51   Sorghum bicolor [broomcorn]
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           189   1e-50   Triticum urartu
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    187   2e-50   Zea mays [maize]
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    187   2e-50   Zea mays [maize]
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    181   5e-50   
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   176   1e-49   Citrus sinensis [apfelsine]
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    181   3e-48   Zea mays [maize]
emb|CDX85102.1|  BnaC07g08040D                                          166   6e-47   
gb|KJB28509.1|  hypothetical protein B456_005G052800                    169   7e-46   Gossypium raimondii
gb|KJB70810.1|  hypothetical protein B456_011G092100                    174   8e-46   Gossypium raimondii
gb|KJB28512.1|  hypothetical protein B456_005G052900                    171   1e-44   Gossypium raimondii
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          168   4e-44   
ref|XP_005717868.1|  unnamed protein product                            165   5e-44   Chondrus crispus [carageen]
gb|KDO40251.1|  hypothetical protein CISIN_1g042963mg                   152   6e-42   Citrus sinensis [apfelsine]
ref|XP_004147183.1|  PREDICTED: uncharacterized protein LOC101213610    161   3e-41   
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    155   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_005537745.1|  probable mycolic acid methyl transferase           157   1e-39   Cyanidioschyzon merolae strain 10D
ref|WP_012012891.1|  cyclopropane-fatty-acyl-phospholipid synthase      148   6e-38   Arcobacter butzleri
emb|CDY54629.1|  BnaCnng27480D                                          143   7e-38   Brassica napus [oilseed rape]
ref|WP_017221214.1|  hypothetical protein                               148   8e-38   Moritella dasanensis
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      149   1e-37   Desulfomicrobium escambiense
ref|WP_019440999.1|  hypothetical protein                               147   2e-37   Moritella marina
ref|WP_043771147.1|  hypothetical protein                               146   3e-37   
ref|WP_011758933.1|  cyclopropane-fatty-acyl-phospholipid synthase      146   4e-37   Shewanella amazonensis
ref|WP_028630133.1|  cyclopropane-fatty-acyl-phospholipid synthase      145   6e-37   Pseudomonas resinovorans
ref|WP_003182274.1|  cyclopropane-fatty-acyl-phospholipid synthase      145   7e-37   Pseudomonas fluorescens
ref|WP_024775005.1|  cyclopropane-fatty-acyl-phospholipid synthase      145   7e-37   Arcobacter cibarius
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               146   8e-37   
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  148   1e-36   
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      147   1e-36   
ref|WP_038097960.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   1e-36   
ref|WP_042145087.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
gb|ADW18290.1|  Cyclopropane-fatty-acyl-phospholipid synthase           146   2e-36   
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
ref|WP_030138826.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           144   2e-36   
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    144   2e-36   
gb|EKO15287.1|  cyclopropane-fatty-acyl-phospholipid synthase           144   2e-36   
ref|WP_010384712.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   2e-36   
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   3e-36   
ref|WP_027697442.1|  cyclopropane-fatty-acyl-phospholipid synthase      143   4e-36   
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   4e-36   
ref|WP_039591068.1|  cyclopropane-fatty-acyl-phospholipid synthase      143   5e-36   
ref|WP_009836691.1|  cyclopropane-fatty-acyl-phospholipid synthase      143   5e-36   
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   142   6e-36   
ref|WP_025258609.1|  cyclopropane-fatty-acyl-phospholipid synthase      143   6e-36   
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   7e-36   
ref|WP_013135425.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   8e-36   
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    127   8e-36   
ref|WP_008107386.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   8e-36   
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          142   1e-35   
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   1e-35   
ref|WP_041149642.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   1e-35   
ref|WP_020414996.1|  hypothetical protein                               142   1e-35   
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   1e-35   
ref|WP_027331136.1|  cyclopropane-fatty-acyl-phospholipid synthase      141   2e-35   
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   2e-35   
ref|WP_040415201.1|  cyclopropane-fatty-acyl-phospholipid synthase      141   2e-35   
gb|EPR40260.1|  Cyclopropane-fatty-acyl-phospholipid synthase           141   2e-35   
ref|WP_009575288.1|  cyclopropane-fatty-acyl-phospholipid synthase      141   2e-35   
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      141   3e-35   
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   5e-35   
ref|WP_015487921.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   5e-35   
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              140   5e-35   
ref|WP_040352724.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   5e-35   
gb|EAQ78945.1|  cyclopropane-fatty-acyl-phospholipid synthase           140   6e-35   
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   6e-35   
gb|EFA79547.1|  cyclopropane fatty acid synthase                        140   6e-35   
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   6e-35   
ref|WP_005993583.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   7e-35   
ref|WP_039423507.1|  cyclopropane-fatty-acyl-phospholipid synthase      140   8e-35   
ref|WP_022973428.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_008898188.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_020770137.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_041479999.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_017011088.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
gb|EWH09403.1|  cyclopropane-fatty-acyl-phospholipid synthase           139   1e-34   
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_035015231.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   1e-34   
ref|WP_028761302.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
emb|CEL43918.1|  Putative cyclopropane-fatty-acyl-phospholipid sy...    136   2e-34   
ref|WP_016551412.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
gb|EPN68324.1|  cyclopropane-fatty-acyl-phospholipid synthase           132   2e-34   
ref|WP_010409431.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_041585800.1|  hypothetical protein                               136   2e-34   
ref|WP_006082541.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_039514269.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_043298452.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_024940524.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_016903512.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_028773824.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   2e-34   
ref|WP_006451778.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   2e-34   
ref|WP_040151432.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   3e-34   
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   3e-34   
ref|WP_007236107.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   3e-34   
gb|EMS68326.1|  Cyclopropane-fatty-acyl-phospholipid synthase           137   3e-34   
gb|EPE84491.1|  cyclopropane-fatty-acyl-phospholipid synthase           134   3e-34   
gb|EPJ77588.1|  cyclopropane-fatty-acyl-phospholipid synthase           137   3e-34   
ref|WP_016773216.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   4e-34   
ref|WP_010568252.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   4e-34   
ref|WP_017171442.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   4e-34   
ref|WP_003456705.1|  SAM dependent methyltransferase, cyclopropan...    138   4e-34   
ref|WP_011919691.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   4e-34   
ref|XP_004356254.1|  cyclopropane fatty acid synthase                   138   4e-34   
ref|WP_007951699.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   4e-34   
ref|WP_024014288.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   4e-34   
ref|WP_038858777.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   4e-34   
ref|WP_042609708.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   4e-34   
ref|WP_010572522.1|  cyclopropane-fatty-acyl-phospholipid synthase      138   5e-34   
dbj|BAC83502.1|  putative cyclopropane synthase                         140   5e-34   
ref|WP_017163033.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_043042257.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_012587152.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_033062920.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_014339200.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_039011882.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_013693276.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    137   5e-34   
ref|WP_028237012.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_003201531.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    137   5e-34   
ref|WP_003208420.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    137   5e-34   
ref|WP_039574900.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_012089763.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   5e-34   
ref|WP_017168650.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_011408294.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_039442644.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_010366079.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_017160022.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
gb|ABC78887.1|  cyclopropane-fatty-acyl-phospholipid synthase           136   6e-34   
ref|WP_017155651.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_039433432.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_011258655.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   6e-34   
ref|WP_016493425.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_008025867.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    137   7e-34   
ref|WP_028573790.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   7e-34   
ref|WP_002814454.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
gb|KGK59141.1|  cyclopropane-fatty-acyl-phospholipid synthase           137   7e-34   
ref|WP_013659680.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_003479409.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_014503964.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_040372386.1|  hypothetical protein                               139   7e-34   
ref|WP_011847383.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   7e-34   
ref|WP_021701492.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   8e-34   
gb|ERB64848.1|  hypothetical protein N779_13070                         133   8e-34   
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   8e-34   
dbj|BAP41523.1|  cyclopropane-fatty-acyl-phospholipid synthase          137   8e-34   
ref|WP_017475993.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   8e-34   
ref|WP_003485448.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   8e-34   
ref|WP_014611029.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_019408878.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_037337739.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   9e-34   
ref|WP_005924870.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_038639059.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_007646211.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_024744102.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_011788652.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   9e-34   
ref|WP_007967668.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
ref|WP_024652616.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
ref|WP_023903310.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
ref|WP_011266739.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
ref|WP_024682685.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
ref|WP_004406950.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_039766323.1|  cyclopropane-fatty-acyl-phospholipid synthase      137   1e-33   
gb|EGH75650.1|  cyclopropane-fatty-acyl-phospholipid synthase           136   1e-33   
ref|WP_016781761.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_024691823.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_003421694.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_016987210.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
gb|EGH44451.1|  cyclopropane-fatty-acyl-phospholipid synthase           136   1e-33   
ref|WP_032658908.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_016567259.1|  Cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_011073246.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_024665589.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
gb|EGH32293.1|  cyclopropane-fatty-acyl-phospholipid synthase           136   1e-33   
ref|WP_017277944.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_044311961.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_003415046.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_004419129.1|  Cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_008242442.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_003433715.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_003408647.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_010428686.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_032615929.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_003365609.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_017529903.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_010177020.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   1e-33   
ref|WP_005911656.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    136   2e-33   
ref|WP_035517956.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_024661275.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_044343954.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_005746219.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_010342347.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_005733596.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_011167849.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_011346862.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_039580557.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_016850267.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_019742551.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_002552156.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_044319716.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_037420850.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    136   2e-33   
ref|WP_040280933.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_024647595.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_042827312.1|  cyclopropane-fatty-acyl-phospholipid synthase      134   2e-33   
ref|WP_011050875.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    136   2e-33   
ref|WP_019825100.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_010380444.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_009583767.1|  Cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_029148983.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_003467054.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_010458259.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
ref|WP_039761286.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   2e-33   
gb|EPM75350.1|  cyclopropane-fatty-acyl-phospholipid synthase           134   2e-33   
ref|WP_008373278.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   2e-33   
ref|WP_012916972.1|  cyclopropane-fatty-acyl-phospholipid synthase      136   2e-33   
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           135   2e-33   
gb|AAM36246.1|  cyclopropane-fatty-acyl-phospholipid synthase           136   2e-33   
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_017340747.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_019301959.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_027925959.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_019304527.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_016965510.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_004663912.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_017072351.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      139   3e-33   
ref|WP_024710277.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_034225625.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_009852233.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_011103434.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_005768844.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    135   3e-33   
ref|WP_017061279.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_017070213.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_017126570.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_017067826.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   3e-33   
ref|WP_031570949.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_017912728.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_024617109.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_009835536.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_017915334.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_011335916.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_024656809.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_005891172.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   
ref|WP_007145559.1|  cyclopropane-fatty-acyl-phospholipid synthase      135   4e-33   



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  387  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  446

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  447  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  506

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  507  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  387  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  446

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  447  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  506

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  507  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF   ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  397  RYDRIISCEMLEAVGHEFMEEFFTCSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKE  456

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  457  YIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  516

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  517  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_010109738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
 gb|EXC24409.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
Length=161

 Score =   276 bits (705),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -1

Query  730  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  551
            HEFM +FFG CES LAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT
Sbjct  7    HEFMEDFFGSCESALAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVT  66

Query  550  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  371
            SAMAA+SRLCVEH+E+IGIHY+QTLRCWR NFLE+QS+IL LGF++KFIRTWEYYFDYCA
Sbjct  67   SAMAAASRLCVEHIENIGIHYHQTLRCWRKNFLEKQSEILALGFNEKFIRTWEYYFDYCA  126

Query  370  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            AGF + TLG+YQIVFSRPGNV AF +PYK   SA
Sbjct  127  AGFKSHTLGNYQIVFSRPGNVAAFRNPYKSFPSA  160



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  639  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  698

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  699  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  758

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  759  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  808



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  633  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  693  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  753  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  802



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  397  RYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKE  456

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  457  YIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  516

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  517  NKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  756  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  756  YIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF   ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMEEFFTCSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  756  YIFPGGCLPSLSRVTSAMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  865



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMEEFFTCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD
Sbjct  756  YIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGL  278
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G+
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNGV  861



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 147/172 (85%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H+FM EFF  CES LAE+G+LV+QFISIPDERYDEYRQSSDFI
Sbjct  374  KYDRII--SCGMLEHVGHDFMGEFFSCCESALAEDGLLVVQFISIPDERYDEYRQSSDFI  431

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QSQI  LG
Sbjct  432  KEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQSQIRALG  491

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  492  FDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  543



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMEEFFTCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD
Sbjct  756  YIFPGGCLPALSRVTSAMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPY G
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYNG  860



>ref|XP_004173387.1| PREDICTED: probable fatty acid methyltransferase-like, partial 
[Cucumis sativus]
Length=291

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKE
Sbjct  122  KYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKE  181

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL LGFD
Sbjct  182  YIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKILQLGFD  241

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  242  ESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  291



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  633  RYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  693  YIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  753  NKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  802



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  639  RYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKE  698

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  699  YIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  758

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  759  NKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  808



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRII      S  HEFM+EFF  CESVLA+NG+LVLQFISIPDERYDEYR+SSDFI
Sbjct  693  NYKYDRIISCEMLESVGHEFMDEFFACCESVLADNGLLVLQFISIPDERYDEYRRSSDFI  752

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LG
Sbjct  753  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALG  812

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            F++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  813  FNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFADPYKGFPSA  863



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKE
Sbjct  696  RYDRIISCEMLEAVGHEFMEEFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG CLP+LSRVTSAMAA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD
Sbjct  756  YIFPGACLPALSRVTSAMAAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  816  NKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  865



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      S  HEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKE
Sbjct  386  KYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKE  445

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL LGFD
Sbjct  446  YIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEILALGFD  505

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  506  EKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  550



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   285 bits (729),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII         HE+M EFFG CES LAE+G+ VLQFISIPDERY EYR+SSDFIKE
Sbjct  700  KYNRIISCEMLEAVGHEYMEEFFGCCESALAEDGLFVLQFISIPDERYTEYRRSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAA+SRLCVEH+EDIGIHYYQTLRCWR NFL R S+I +LGFD
Sbjct  760  YIFPGGCLPSLSRVTSAMAAASRLCVEHVEDIGIHYYQTLRCWRENFLNRTSEIKNLGFD  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV AFGDPYK +  AY
Sbjct  820  EKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAAFGDPYKSVPCAY  869



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM +FFG CESVLAENG+ VLQFISIPDERYDEYR SSDFIKE
Sbjct  388  RYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYDEYRLSSDFIKE  447

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL LGFD
Sbjct  448  YIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKILQLGFD  507

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  508  ESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  557



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRII      S  HEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFI
Sbjct  693  NNKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFI  752

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LG
Sbjct  753  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALG  812

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            FD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  813  FDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRII      S  HEFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFI
Sbjct  698  NYKYDRIISCEMLESVGHEFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFI  757

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LG
Sbjct  758  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALG  817

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            F++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  818  FNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  868



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRII      S  HEFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFI
Sbjct  693  NYKYDRIISCEMLESVGHEFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFI  752

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LG
Sbjct  753  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALG  812

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            F++ FIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  813  FNENFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  863



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRII      S  HEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFI
Sbjct  693  NNKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFI  752

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LG
Sbjct  753  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALG  812

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            FD+KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  813  FDEKFIRTWEYYFDYCAAGFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  402  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  461

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF+
Sbjct  462  YIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFN  521

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  522  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  565



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  387  KYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKE  446

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF+
Sbjct  447  YIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFN  506

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  507  EKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  556



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   284 bits (726),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFI
Sbjct  712  KYDRII--SCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFI  769

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LG
Sbjct  770  KEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELG  829

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  830  FNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  881



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = -1

Query  778  NCRYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N + DRII      S  HEFMN+FF  CESVLAENG+LVLQFISIPDERYDEYR+SSDFI
Sbjct  694  NYKCDRIISCEMLESVGHEFMNDFFASCESVLAENGLLVLQFISIPDERYDEYRRSSDFI  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVTSAM  SSRLCVEH+E+IGIHYYQTLR WR NFLERQS+IL LG
Sbjct  754  KEYIFPGGCLPSLSRVTSAMVNSSRLCVEHIENIGIHYYQTLRYWRKNFLERQSEILALG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  814  FNEKFIRTWEYYFDYCAAGFKTYTLGNYQIVFSRPGNVPAFSNPYKGFPSAY  865



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFI
Sbjct  699  KYDRII--SCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFI  756

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LG
Sbjct  757  KEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELG  816

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  817  FNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  868



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFI
Sbjct  697  KYDRII--SCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFI  754

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LG
Sbjct  755  KEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELG  814

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  815  FNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  866



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   283 bits (725),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFI
Sbjct  696  KYDRII--SCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFI  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LG
Sbjct  754  KEYIFPGGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  814  FNEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  865



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVL E+GILVLQFISIPDERY+EYRQS+DFIKE
Sbjct  633  KYDRIISCEMLEAVGHEYMEEFFRCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD
Sbjct  693  YIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFD  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  753  EKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  802



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  402  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  461

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF+
Sbjct  462  YIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFN  521

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  522  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  565



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVL E+GILVLQFISIPDERY+EYRQS+DFIKE
Sbjct  700  KYDRIISCEMLEAVGHEYMEEFFRCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AM+A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD
Sbjct  760  YIFPGGCLPSLSRVTTAMSAASRLCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFD  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  820  EKFIRTWEYYFDYCAAGFKTCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  869



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKE
Sbjct  397  KYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKE  456

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF+
Sbjct  457  YIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFN  516

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  517  EKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  566



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =   276 bits (705),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  530  KFDRIISCEMIEAVGHEYMEEFFGCCESVLAQNGLLVLQFISIPDERYDEYRRSSDFIKE  589

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMA +SRLCVEH+E++GIHYYQTLRCWR NF+ERQ++IL LGF+
Sbjct  590  YIFPGGCLPSLSRITSAMATTSRLCVEHVENLGIHYYQTLRCWRKNFMERQNEILALGFN  649

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV AFGDPYK
Sbjct  650  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAAFGDPYK  693



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  515  KYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKE  574

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF+
Sbjct  575  YIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFN  634

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  635  EKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  684



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKE
Sbjct  633  KYDRIISCEMIEAVGHEFMEEFFGCCESMLAEDGLLVLQFISIPDERYNEYRLSSDFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  693  YIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFN  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  753  DKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  802



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVR-CGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      S  HEFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKE
Sbjct  695  KYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL LGFD
Sbjct  755  YIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEILALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  815  EKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNVPAFSNPYKG  859



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  630  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  689

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF+
Sbjct  690  YIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFN  749

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  750  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  793



>gb|KGN61577.1| hypothetical protein Csa_2G172470 [Cucumis sativus]
Length=213

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HEFM +FFG CESVL ENG+LV+QFIS+PD+RYDE+R SSDF+
Sbjct  41   KYDRII--SCGLLESVGHEFMEDFFGLCESVLVENGLLVVQFISMPDDRYDEHRLSSDFM  98

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LG
Sbjct  99   REYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELG  158

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  159  FDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  209



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM +FFG CESVLAENG+ VLQFISIPDERYDEYR SSDFIKE
Sbjct  696  RYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYDEYRLSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL LGFD
Sbjct  756  YIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKILQLGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  816  ESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCES LAE+G++VLQFISIP+ERYDEYR SSDFIKE
Sbjct  699  KYDRIISCEMLEAVGHEFMETFFSRCESALAEDGVIVLQFISIPEERYDEYRLSSDFIKE  758

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLRCWR NFLERQ QI+ LGF+
Sbjct  759  YIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRCWRKNFLERQKQIMALGFN  818

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            ++FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN  AFGDPY+   SA+
Sbjct  819  EEFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNTAAFGDPYRSFPSAH  868



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 148/174 (85%), Gaps = 5/174 (3%)
 Frame = -1

Query  778  NCRYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSD  608
            N +YDRII   CG      H+F+ EFF  CE+ LAE+G+LV+QFISIPDERY+EYR+SSD
Sbjct  694  NYKYDRII--SCGMLEHVGHDFIGEFFSCCETALAEDGLLVVQFISIPDERYEEYRRSSD  751

Query  607  FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  428
            FIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  FL+ QSQI  
Sbjct  752  FIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKFLKNQSQIRA  811

Query  427  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  812  LGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  865



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  284  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  343

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IG+HYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  344  YIFPGGCLPSLARVISAMASSSRLSVENVENIGLHYYQTLRCWRKNFLENQKQIMDLGFD  403

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  404  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKE
Sbjct  287  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD
Sbjct  347  YIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*AHSLL  248
            +KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY  H LL
Sbjct  407  EKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY--HHLL  460



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   277 bits (709),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKE
Sbjct  689  KYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKE  748

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMAASSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF+
Sbjct  749  YIFPGGCLPSLTRITSAMAASSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFN  808

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  809  EKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  858



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EF G CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  607  KYDRIISCEMLEAVGHEYMEEFLGCCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKE  666

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS+IL LGFD
Sbjct  667  YIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQSEILALGFD  726

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  727  EKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  776



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   277 bits (709),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERYDEYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYDEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  EKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  697  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  756

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF+
Sbjct  757  YIFPGGCLPSLSRITSAMAATSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFN  816

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  817  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVPALGDPYK  860



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  623  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  682

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF+
Sbjct  683  YIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFN  742

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  743  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  786



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM EFFG CES+L E+G+LVLQFISIPDERY+EYR SSDFIKE
Sbjct  700  KYDRIISCEMIEAVGHEFMEEFFGCCESLLVEDGLLVLQFISIPDERYNEYRLSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  760  YIFPGGCLPSLSRITSAMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFN  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  820  DKFIRTWEYYFDYCAAGFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  869



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKE
Sbjct  246  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKE  305

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD
Sbjct  306  YIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFD  365

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  366  EKFIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY  415



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF+
Sbjct  756  YIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  816  EKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  865



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEEFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF+
Sbjct  756  YIFPGGCLPSLSRITSAMAATSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNV A GDPYK
Sbjct  816  EKFIRTWEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAALGDPYK  859



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EF G CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMLEAVGHEYMEEFLGCCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSLSRVTSAMA++SRLCVEHLE+IGIHYYQTL  WR +F+E+QS+IL LGFD
Sbjct  756  YIFPGGCIPSLSRVTSAMASASRLCVEHLENIGIHYYQTLIYWRNSFMEKQSEILALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYF YCAAGF + TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  816  EKFIRTWEYYFIYCAAGFRSRTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  865



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   276 bits (705),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  729  KYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKE  788

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF+
Sbjct  789  YIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFN  848

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  849  EKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  898



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRVWRKNFLERQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_011470583.1| PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahydroprotoberberine 
N-methyltransferase-like [Fragaria vesca subsp. vesca]
Length=445

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = -1

Query  778  NCRYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSS  611
            N  YDR+I    L   G   H+FM EFFG CES+LAE G+LVLQF S+PDERYD+YRQSS
Sbjct  274  NSTYDRVISCEMLEHVG---HKFMEEFFGCCESLLAEKGLLVLQFTSLPDERYDKYRQSS  330

Query  610  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  431
            DFI EYIFPG C+PSLSRVTSAMA SS+L VEHLE+IGIHYY TL+CW+  FLE Q++IL
Sbjct  331  DFINEYIFPGACIPSLSRVTSAMATSSKLSVEHLENIGIHYYPTLKCWKKIFLENQNEIL  390

Query  430  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             LGFD++FIRTWEYYFDYCAAGF++CTLG+YQIVFSRPGNV   G+P+KG  SAY
Sbjct  391  ALGFDEEFIRTWEYYFDYCAAGFNSCTLGNYQIVFSRPGNVPVLGNPFKGFPSAY  445



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKE
Sbjct  563  KYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKE  622

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF+
Sbjct  623  YIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFN  682

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  683  EKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  732



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   275 bits (702),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  690  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  749

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  750  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFD  809

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  810  DKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  859



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII         HE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  288  KYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKE  347

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD
Sbjct  348  YIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFD  407

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  408  EKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  452



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   274 bits (700),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL LGFD
Sbjct  756  YIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKILQLGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  816  ESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   273 bits (697),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKE
Sbjct  634  KYDRIISCEMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKE  693

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL RVTSAMA+SSRLCVE++E+IGIHYYQTLRCWR NFLERQ QI+DLGFD
Sbjct  694  YIFPGGCLPSLGRVTSAMASSSRLCVENVENIGIHYYQTLRCWRKNFLERQKQIIDLGFD  753

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  754  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHCFPSA  802



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM ++F  C SVLAE+GILVLQFISIPDERY+EYRQSSDFI+E
Sbjct  682  KYDRIISCEMLEAVGHEFMEKYFSSCNSVLAEDGILVLQFISIPDERYEEYRQSSDFIRE  741

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAA+S LCVEHLE+ GIHYY TLR WR NFL +QS+IL+LGFD
Sbjct  742  YIFPGGCLPSLSRVTSAMAAASGLCVEHLENFGIHYYHTLRRWRTNFLSKQSEILELGFD  801

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF TCTLG+YQ+VFSRPGNV +FG+  KG+ SAY
Sbjct  802  EKFIRTWEYYFDYCAAGFKTCTLGNYQVVFSRPGNVVSFGNLQKGVPSAY  851



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H+F+ EFF  CES LAE G+LVLQFISIPDERY+EYRQSSDF+
Sbjct  633  KYDRII--SCGMLEHVGHDFIGEFFTCCESALAEYGLLVLQFISIPDERYEEYRQSSDFM  690

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +SQI  LG
Sbjct  691  KEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKSQIRSLG  750

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  751  FDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  802



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  449  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  508

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  509  YIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFD  568

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  569  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  618



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  631  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  690

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D
Sbjct  691  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGID  750

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  751  DKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  800



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  689  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKE  748

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD
Sbjct  749  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFD  808

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  809  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  858



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF+
Sbjct  756  YIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  816  EKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  865



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  696  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD
Sbjct  756  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  816  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  865



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKE
Sbjct  697  KYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKE  756

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF+
Sbjct  757  YIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFN  816

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  817  EKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  866



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 145/172 (84%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H+F+ EFF  CES LAE G+LVLQFISIPDERY+EYRQSSDF+
Sbjct  696  KYDRII--SCGMLEHVGHDFIGEFFTCCESALAEYGLLVLQFISIPDERYEEYRQSSDFM  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQTLRCWR NFL+ +SQI  LG
Sbjct  754  KEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQTLRCWRENFLKNKSQIRSLG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  814  FDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  865



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D
Sbjct  755  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGID  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFIRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_009414043.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M +FFG CES+LAE+GI VLQFISIPDERYDEYR+SSDFIKE
Sbjct  163  KYDRIISCEMIEEVGHEYMEQFFGCCESLLAEDGIFVLQFISIPDERYDEYRRSSDFIKE  222

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+T+AMA SSR C+EHLE+IGIHYYQTLRCWR NF   + +IL LGFD
Sbjct  223  YIFPGGCLPSLSRITTAMATSSRFCIEHLENIGIHYYQTLRCWRNNFFANKEKILALGFD  282

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KF RTWEYYF Y AAGF +CTLGDYQIVFSRPGN+ AFG+P+  + + 
Sbjct  283  EKFFRTWEYYFMYRAAGFKSCTLGDYQIVFSRPGNLRAFGEPFNSIPAT  331



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   271 bits (694),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  670  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  729

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD
Sbjct  730  YIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFD  789

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  790  DKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  839



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   271 bits (694),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  683  KYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKE  742

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMAA+SRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF+
Sbjct  743  YIFPGGCLPSLSRVTTAMAAASRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFN  802

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PYK
Sbjct  803  EKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYK  846



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   271 bits (693),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 9/170 (5%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRII    L   G   HEFM  FF  CE+ L E+GI ++QFISIP+ERY+EYR +SDF
Sbjct  280  KYDRIISCEMLEHAG---HEFMETFFSHCEAALTEDGITIIQFISIPEERYNEYRLNSDF  336

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+R +QI+DL
Sbjct  337  IKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRHNQIMDL  396

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKG  281
            GFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV AFG  DP++ 
Sbjct  397  GFDDKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVAAFGDDDPFRS  446



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII+        HEF+ EFF  CES L E+G+LVLQFIS+PD  YDEYR S+ FI E
Sbjct  269  KYDRIIVCEVLEHVGHEFIGEFFSCCESALTEDGLLVLQFISMPDPMYDEYRHSAGFINE  328

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+SRLCV HLEDIG+HYYQTLRCWR NFL+ +SQI  LGFD
Sbjct  329  YIFPGGCLPALSRVTSAMAAASRLCVVHLEDIGVHYYQTLRCWRKNFLKNKSQIHALGFD  388

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK-GLASAY  266
             KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  389  DKFIRTWEYYFDYCAAGFKTHTLGDYQIVFSRPGNVATFGDPYNVTMPSAY  439



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD
Sbjct  755  YIFPGGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRENFLARQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFVRTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  698  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKE  757

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD
Sbjct  758  YIFPGGCLPSLARVTSAMSSSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFD  817

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF + YKG  SAY
Sbjct  818  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAAFANSYKGFPSAY  867



>ref|XP_004307322.2| PREDICTED: uncharacterized protein LOC101300392 [Fragaria vesca 
subsp. vesca]
Length=161

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  730  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  551
            HE+M EFF  C+S LAENG+LVLQF S+PDE YDEYR+   FI+EYIFPGGCLPSLSR+T
Sbjct  7    HEYMEEFFACCDSALAENGLLVLQFTSLPDELYDEYRRCPSFIREYIFPGGCLPSLSRLT  66

Query  550  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  371
            +AMAASSRL VEHLE+IG HYY+TL+ WR  FLE+QS+IL LGFD KFIRTWEYYFDYCA
Sbjct  67   AAMAASSRLSVEHLENIGSHYYRTLKYWRKKFLEKQSEILALGFDDKFIRTWEYYFDYCA  126

Query  370  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            AGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  127  AGFNACTLGNYQIVFSRPGNVALLNDPYKGFPSAY  161



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  608  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  667

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  668  YIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFD  727

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  728  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  777



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESV+A +G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  694  KYDRIISCEMIEAVGHEYMEEFFGCCESVMANDGLLVLQFISIPDERYDEYRRSSDFIKE  753

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TS+MA++SRLCVEH+E+ GIHYYQTLR WR NFLERQS+IL LGF+
Sbjct  754  YIFPGGCLPSLSRITSSMASTSRLCVEHVENFGIHYYQTLRLWRKNFLERQSEILALGFN  813

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYC AGF + TLG+YQ+VFSRPGNVTAF DPYK
Sbjct  814  EKFIRTWEYYFDYCGAGFKSRTLGNYQVVFSRPGNVTAFTDPYK  857



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   263 bits (673),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   S  HEFM +FFG CESVL ENG+LV+QFIS+PD+RYDE+R SSDF+
Sbjct  405  KYDRII--SCGLLESVGHEFMEDFFGLCESVLVENGLLVVQFISMPDDRYDEHRLSSDFM  462

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LG
Sbjct  463  REYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELG  522

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+ FIRTWEYYFDYCAAGF + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  523  FDESFIRTWEYYFDYCAAGFKSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  573



>ref|XP_011470580.1| PREDICTED: sterol 24-C-methyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=270

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N +YDRI+         HE+M EFF  C+S LAENG+LVLQF S+PDE YDEYR+   FI
Sbjct  99   NYKYDRIVSCEMVEHVGHEYMEEFFACCDSALAENGLLVLQFTSLPDELYDEYRRCPSFI  158

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYI PGGCLPSLSR+T+AMAASSRL VEHLE+IG HYY+TL+ WR NFLE+QS+I  LG
Sbjct  159  REYILPGGCLPSLSRLTAAMAASSRLSVEHLENIGSHYYRTLKYWRKNFLEKQSEIQALG  218

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRPGNV    DPYKG  SAY
Sbjct  219  FDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRPGNVVLLNDPYKGFPSAY  270



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HEFM EFF  CES+L ++G+LVLQFISIPD RYD YR+SSDFIKE
Sbjct  399  RYDRIISCEMLEAVGHEFMEEFFSCCESLLVKDGLLVLQFISIPDVRYDTYRRSSDFIKE  458

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVT+AMA +SR CVEHLEDIGIHYY TLRCWR  FL  + +I DLGFD
Sbjct  459  YIFPGGCLPSLSRVTAAMATASRFCVEHLEDIGIHYYPTLRCWREKFLGSRKEIEDLGFD  518

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTW YYFDYCAAGF +CTLG+YQIV SRPGNVTAFG+PY  L SA
Sbjct  519  EKFIRTWVYYFDYCAAGFKSCTLGNYQIVMSRPGNVTAFGNPYSSLPSA  567



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKE
Sbjct  621  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKE  680

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  681  YIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFD  740

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  741  DKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  790



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   269 bits (687),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKE
Sbjct  685  KYDRIISCEMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKE  744

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLER+ QI+DLGFD
Sbjct  745  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRSWRKTFLEREKQIMDLGFD  804

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  805  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHSFPSA  853



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   268 bits (686),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 1/172 (1%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            N RYDRII         HE+M EFFG CESVLAE+G++VLQFISIP+ERY+EYRQSSDFI
Sbjct  698  NYRYDRIISCEMIEAVGHEYMEEFFGCCESVLAEDGLIVLQFISIPEERYEEYRQSSDFI  757

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL+R+ SAM+A+SRLC+EH+E+IGIHYYQTLR WR NFL+ Q +IL LG
Sbjct  758  KEYIFPGGCLPSLTRIASAMSAASRLCMEHVENIGIHYYQTLRYWRKNFLDNQGKILALG  817

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGN+ A G+P++G  SAY
Sbjct  818  FNEKFIRTWEYYFDYCAAGFKTHTLGNYQVVLSRPGNIAALGNPFQGFPSAY  869



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LA++G++VLQFISIP+ERY+EYR SSDFIKE
Sbjct  698  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAQDGLIVLQFISIPEERYNEYRLSSDFIKE  757

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLR WR NFLERQ  I+ LGFD
Sbjct  758  YIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYKTLRLWRKNFLERQKPIIALGFD  817

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             +FIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGN+ AF D YKG  SAY
Sbjct  818  DQFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNLAAFADSYKGFPSAY  867



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKE
Sbjct  700  KYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD
Sbjct  760  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFD  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  820  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  868



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKE
Sbjct  287  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD
Sbjct  347  YIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY +AGF + TL DYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  407  EKFIRTWEYYFDYSSAGFKSYTLRDYQVVFSRPGNVEALGNPYKGFPSAY  456



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKE
Sbjct  706  KYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKE  765

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD
Sbjct  766  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFD  825

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  826  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  874



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YD II         HE+M EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKE
Sbjct  700  KYDTIISCEMIEAVGHEYMEEFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q + L LGF+
Sbjct  760  YIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQRETLSLGFN  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  820  EKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVVALSNPYRGFPSAY  869



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M +FF  CESVLAE+G+LVLQFISIP+ERYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMVEAVGHEYMEDFFSCCESVLAEDGLLVLQFISIPEERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE+QS+IL LGF+
Sbjct  756  YIFPGGCLPSLTRITSAMSAASRLCVEHVENIGLHYYQTLRHWRKNFLEKQSKILALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   +A
Sbjct  816  EKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYKRFPTA  864



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  701  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  760

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  761  YIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFD  820

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  821  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  870



>gb|KGN61575.1| hypothetical protein Csa_2G171960 [Cucumis sativus]
Length=273

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRII---LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   ++ C    HEFM +FFG CES L ENG+LVLQFIS+PD++YDE+R SS F+
Sbjct  101  KYDRIISCGMLECVG--HEFMEDFFGSCESALVENGLLVLQFISMPDDQYDEHRLSSGFM  158

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LG
Sbjct  159  REYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELG  218

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  219  FDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  269



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKE
Sbjct  695  KYDRIISCEMLEAVGHEFMEMFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSL++VTSAM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD
Sbjct  755  YIFPGACVPSLAKVTSAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  815  DKFVRTWEYYFDYCAAGFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKE
Sbjct  699  KYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKE  758

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF+
Sbjct  759  YIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFN  818

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  819  EKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  868



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKE
Sbjct  700  KYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF+
Sbjct  760  YIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFN  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  820  EKFIRTWEYYFDYCAAGFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  869



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  389  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  448

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  449  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  508

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  509  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  557



>ref|XP_009388106.1| PREDICTED: uncharacterized protein LOC103974927, partial [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M +FFG CES+LAE+GI VLQFISIPDERYDEYR+SSDFIKE
Sbjct  171  KYDRIISCEMIEGVGHEYMEQFFGCCESLLAEDGIFVLQFISIPDERYDEYRRSSDFIKE  230

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL R+T+AM ASSR C+EHLE+IGIHY QTLRCWR N    + +IL LGFD
Sbjct  231  YIFPGGCLPSLGRITTAMVASSRFCIEHLENIGIHYNQTLRCWRNNIFANKEKILALGFD  290

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KF RTWEYYF YCAAGF +CTL +YQIVFSRPGN+ AFG P+  + + 
Sbjct  291  EKFFRTWEYYFMYCAAGFKSCTLANYQIVFSRPGNLRAFGGPFNSIPAT  339



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   266 bits (681),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKE
Sbjct  724  KYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKE  783

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD
Sbjct  784  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFD  843

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP +   SA
Sbjct  844  DKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPSRSFPSA  892



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   266 bits (680),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 143/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII +       HEF+  FF RCESVLAE+G+LVLQ ISIP+ERYDEYR SSDFIKE
Sbjct  696  KYDRIISIEMLEEVGHEFIETFFNRCESVLAEDGLLVLQTISIPEERYDEYRLSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+ SL+R+TSAMA+SSRLC+E +E+IGIHYY+TLRCWR N LERQ +I+DLGFD
Sbjct  756  YIFPGGCILSLARITSAMASSSRLCIEQVENIGIHYYRTLRCWRQNLLERQKRIVDLGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDY AAGF T TLGDYQ+VFSRPGN   FGDPY+G  SA
Sbjct  816  EKFIRTWEYYFDYSAAGFKTLTLGDYQMVFSRPGNAALFGDPYRGFPSA  864



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =   263 bits (673),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII         HE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  556  KYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKE  615

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD
Sbjct  616  YIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFD  675

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  676  EKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  720



>gb|KDO40332.1| hypothetical protein CISIN_1g0240962mg [Citrus sinensis]
Length=272

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FI
Sbjct  101  KYDRII--SCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFI  158

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LG
Sbjct  159  KEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALG  218

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  219  FNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  270



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  633  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  693  YIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFD  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  753  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  802



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII         HE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  697  KYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKE  756

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD
Sbjct  757  YIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFD  816

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  281
            +KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  817  EKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  861



>ref|XP_006420311.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
 gb|ESR33551.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
Length=246

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  730  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  551
            H++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ EYIFPGGC+PSLSRVT
Sbjct  90   HDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCVPSLSRVT  149

Query  550  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  371
            +AM +SSRLCVEH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWEYYFDYCA
Sbjct  150  AAMTSSSRLCVEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWEYYFDYCA  209

Query  370  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            A F +  +G+YQIVFSRPG+V+AF +PY+GL SAY
Sbjct  210  ASFKSRIIGNYQIVFSRPGDVSAFSNPYEGLPSAY  244



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII         HE+M EFFG CES+LA++G+LVLQFISIPDERYDEYR+SSDFIKE
Sbjct  696  KFDRIISCEMIEAVGHEYMEEFFGCCESLLADDGLLVLQFISIPDERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLC--VEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            YIFPGGCLPSLSR+TSAMA++S+LC  VEH+E++GIHYYQTLR WR NFLERQS+ILDLG
Sbjct  756  YIFPGGCLPSLSRITSAMASTSKLCCSVEHVENMGIHYYQTLRWWRKNFLERQSEILDLG  815

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            F++KFIRTWEYYFDYC  GF + TLG+YQ+VFSRPGNVT F DPYK
Sbjct  816  FNEKFIRTWEYYFDYCGGGFKSRTLGNYQVVFSRPGNVTTFSDPYK  861



>ref|XP_004173332.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acid methyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKE
Sbjct  156  KYDRIISCEMIEAVGHEFMEDFFGTCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKE  215

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD
Sbjct  216  YIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFD  275

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  276  ESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  325



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y RII +       HEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKE
Sbjct  578  KYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKE  637

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD
Sbjct  638  YIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFD  697

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  698  DKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  746



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKE
Sbjct  692  KYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKE  751

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD
Sbjct  752  YIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFD  811

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  812  DKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  861



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   263 bits (673),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
             C+YDRII         HE+M +FF  CESVLA++G++VLQFISIP+ERY+EYR+SSDFI
Sbjct  694  TCKYDRIISCEMIEAVGHEYMEKFFSCCESVLAKDGVIVLQFISIPEERYEEYRRSSDFI  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL+R+T+AMAAS+RLCVEH+E+IGIHYYQTLR WR NF+E +S+I+ LG
Sbjct  754  KEYIFPGGCLPSLTRITTAMAASTRLCVEHVENIGIHYYQTLRYWRKNFVENKSKIMALG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            F++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PYK   +A
Sbjct  814  FNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYKEFPAA  864



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  515  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  574

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  575  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  634

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  635  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  683



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  514  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  573

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  574  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  633

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  634  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  682



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVLA+NG+LVLQFISIPDERYDE+R+SS F+KE
Sbjct  696  KYDRIISCEMIEAVGHEYMEEFFSCCESVLAKNGLLVLQFISIPDERYDEHRRSSSFMKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NFLE++ +IL LGF+
Sbjct  756  YIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFLEKKRKILALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            ++FIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF DPY G  S+
Sbjct  816  EEFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNDAAFADPYVGFLSS  864



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y RII +       HEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKE
Sbjct  695  KYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD
Sbjct  755  YIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  815  DKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y RII +       HEFM+EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKE
Sbjct  695  KYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD
Sbjct  755  YIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  815  DKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M +FFG CESVLA++G+LVLQFISIP+ERY+EYR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEDFFGCCESVLADDGLLVLQFISIPEERYNEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS+I  LGF+
Sbjct  756  YIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQSKIHALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  816  DKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   261 bits (668),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M +FFG CESVLA++G+LVLQFISIP+ERY+EYR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEDFFGCCESVLADDGLLVLQFISIPEERYNEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+T+AM A+S+LCVEH+E+IG+HYYQTLR WR NFLE+QS+I  LGF+
Sbjct  756  YIFPGGCLPSLARITTAMNAASKLCVEHVENIGLHYYQTLRYWRKNFLEKQSKIHALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  816  DKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 138/165 (84%), Gaps = 5/165 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   C    H   +F   FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFI
Sbjct  273  KYDRII--SCEMIEHVGDKFFETFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFI  330

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TL+ WR NFLE+Q +I+DLG
Sbjct  331  REYIFPGGCLPSLARVTSAMSSSSRLCIESVENIGIHYYHTLKYWRKNFLEKQKEIMDLG  390

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            F+ KFIRTWEYYFDYCAAGF T TLGDYQ+VFSRPGNV AFGDP+
Sbjct  391  FNDKFIRTWEYYFDYCAAGFKTLTLGDYQVVFSRPGNVAAFGDPF  435



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII +       H++M EFF  CES L E+G+L LQFIS+PD RYDEYR S+ FIKE
Sbjct  696  KYDRIISIGMIEHVGHDYMEEFFTCCESALTEDGLLALQFISMPDGRYDEYRHSTGFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR NF + +SQI  LGFD
Sbjct  756  YIFPGGCLPSLSRVTSAMAATSRLCVVHLEEIGIHYYQTLRCWRKNFQKNKSQIHALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG-LASAY  266
             KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  816  DKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVATFGDPYNDTMPSAY  866



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   260 bits (664),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  642  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  701

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  702  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  761

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  762  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  810



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   261 bits (666),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVLA++G++VLQFISIPDERYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLVVLQFISIPDERYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGIHYYQTL+CWR NF+E++ +IL LGF+
Sbjct  756  YIFPGGCLPSLSRITSAMASASRLCVEHLDNIGIHYYQTLQCWRKNFMEKKRKILALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            ++FIRTWEYYFDYCAAGF   TLG+YQIVFSRPGN  AF DPY    S+
Sbjct  816  EEFIRTWEYYFDYCAAGFKLHTLGNYQIVFSRPGNDDAFADPYVSFPSS  864



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKE
Sbjct  291  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKE  350

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD
Sbjct  351  YIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFD  410

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  411  EKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  460



>gb|KJB38366.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=802

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKE
Sbjct  633  KYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKE  692

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+
Sbjct  693  YIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFN  752

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  753  EKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  796



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 138/167 (83%), Gaps = 1/167 (1%)
 Frame = -1

Query  766  DRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYI  590
            DRII         HE+M E+FG CESVLA++G++VLQF SIP+ERY+EYR+SSD IKEYI
Sbjct  206  DRIISCEMLEAVGHEYMEEYFGCCESVLADDGLIVLQFTSIPEERYEEYRRSSDVIKEYI  265

Query  589  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  410
            FPG C+PSL+R+T AMAAS+RLCVEH+E+IG+HYYQTLR WR NFLE +S+I  LGF++K
Sbjct  266  FPGTCVPSLTRITIAMAASTRLCVEHVENIGMHYYQTLRLWRKNFLESKSKITALGFNEK  325

Query  409  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A G+PY    +A
Sbjct  326  FIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAALGNPYNEFPAA  372



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII+        HEF+ EFF  CES LAE+G+LVLQFIS+PD  YDE R SS FIKE
Sbjct  269  KYDRIIVCEVLEHVGHEFIGEFFSCCESALAEDGLLVLQFISLPDTMYDENRLSSGFIKE  328

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG LP+LSRVTSAMA++SRLCV HLEDIG+HYYQTLRCWR NFL  +SQI  LGFD
Sbjct  329  YIFPGGYLPALSRVTSAMASASRLCVVHLEDIGVHYYQTLRCWRKNFLNNKSQIRALGFD  388

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PY  287
            +KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPGNV  FGD PY
Sbjct  389  EKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNVATFGDHPY  432



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 138/171 (81%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      HEFM  FF RCES LAE G+LVLQF+SIPD RYDE R SSDFI
Sbjct  698  KYDRII--SCGMIEHVGHEFMEAFFNRCESALAEEGLLVLQFVSIPDSRYDENRLSSDFI  755

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KE+IFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGI+YY+TLRCWR NFLERQ Q+  LG
Sbjct  756  KEHIFPGGCLPSLARVTSAMASSSRLCIEHVENIGINYYKTLRCWRHNFLERQEQVKALG  815

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+KFIR WEYY DY AAGF T TLGDYQ+VFSRPGN   FGDPY    SA
Sbjct  816  FDEKFIRKWEYYLDYFAAGFKTLTLGDYQVVFSRPGNTAVFGDPYMSFPSA  866



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKE
Sbjct  659  KYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKE  718

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+
Sbjct  719  YIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFN  778

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
             KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  779  DKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  822



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKE
Sbjct  289  KYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKE  348

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF+
Sbjct  349  YIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFN  408

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            +KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  409  EKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  451



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+
Sbjct  756  YIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  816  EKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  859



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  696  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  756  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  816  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  864



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+E
Sbjct  695  KYDRIISCEMIEGVGHEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIRE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD
Sbjct  755  YIFPGGCLPSLSRITSAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  815  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  863



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ E
Sbjct  218  KYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNE  277

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  278  YIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFN  337

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V AF +PY+GL SAY
Sbjct  338  EKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVAAFSNPYEGLPSAY  387



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M+EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKE
Sbjct  664  KYDRIISCEMIEAVGHEYMDEFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKE  723

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS +R+TSAM+A+SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+
Sbjct  724  YIFPGGCLPSFTRITSAMSATSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFN  783

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
             KFIRTWEYYFDYCAAGF + TLG+YQ+VFSRPGNV A G+PYK
Sbjct  784  DKFIRTWEYYFDYCAAGFKSNTLGNYQVVFSRPGNVAALGNPYK  827



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 134/167 (80%), Gaps = 3/167 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM++FF  CE  LAENGI VLQF +IP+  YDE R +S FI E
Sbjct  287  KYDRIIACEMIEAVGHEFMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLRCWR NFLERQ QI+DLGFD
Sbjct  347  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYHTLRCWRKNFLERQKQIIDLGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKG  281
             KFIRTWEYYFDYCAAGF T TL  YQIVFSRPGNV AFG  DP++ 
Sbjct  407  DKFIRTWEYYFDYCAAGFKTLTLRSYQIVFSRPGNVAAFGDDDPFRS  453



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE++ EF  RC+S LAENGILVLQFISIPD+RYDEYR+SSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYIEEFLMRCDSHLAENGILVLQFISIPDQRYDEYRRSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS SR+TSAMAA S+LCVEH+E+IGIHYYQTL  WR NF+  +S+I++LGFD
Sbjct  756  YIFPGGCLPSFSRLTSAMAAVSKLCVEHVENIGIHYYQTLIKWRDNFMANKSKIMELGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYF YCAAGF +CTL DYQ+VFSRPGNV AFG+PYK
Sbjct  816  EKFIRTWEYYFIYCAAGFKSCTLEDYQVVFSRPGNVNAFGNPYK  859



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FF  CE+ LA+NGI VLQF +IP++ YDE R SS FI E
Sbjct  250  KYDRIIACEMIEAVGHEFMEKFFSCCEAALAQNGIFVLQFTAIPEKLYDESRLSSGFITE  309

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+ GIHYY TLRCWR NFLERQ QI+DLGFD
Sbjct  310  YIFPGGCLPSLARVTSAMASSSRLCIENVENFGIHYYHTLRCWRKNFLERQKQIMDLGFD  369

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  293
             KFIRTWEYYFDYCAAGF T TL +YQIVFSRPGN+ AFGD
Sbjct  370  DKFIRTWEYYFDYCAAGFKTLTLKNYQIVFSRPGNLAAFGD  410



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 138/171 (81%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG   +  HEFM  FF RCE VLAE+G+LVLQFI++PD RYDE R S  FI
Sbjct  695  KYDRIIA--CGMIEAVGHEFMEIFFNRCEVVLAEDGLLVLQFITVPDSRYDEIRLSPGFI  752

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
             EYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYY+TLRCWR NF ERQ +I  +G
Sbjct  753  TEYIFPGGCLPSLTRVTSAMASSSRLCIEHVENIGIHYYKTLRCWRQNFKERQEEIKAIG  812

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+KFIR WEYYFDYCAAGF T T+GDYQ+VFSRPGN   FGDPY    SA
Sbjct  813  FDEKFIRKWEYYFDYCAAGFKTLTVGDYQVVFSRPGNTATFGDPYMNFPSA  863



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = -1

Query  772  RYDRII---LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   ++ C    HEFM +FFG CES L ENG+LVLQFIS+PD++YDE+R SS F+
Sbjct  628  KYDRIISCGMLECVG--HEFMEDFFGSCESALVENGLLVLQFISMPDDQYDEHRLSSGFM  685

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LG
Sbjct  686  REYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELG  745

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            FD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  746  FDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNVTTFNNPYQGIPSA  796



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKE
Sbjct  287  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSLSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD
Sbjct  347  YIFPGACVPSLSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  407  EKFIRTWEYYFDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ E
Sbjct  432  KYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNE  491

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  492  YIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFN  551

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  552  EKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  601



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FI
Sbjct  503  KYDRII--SCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFI  560

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LG
Sbjct  561  KEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALG  620

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  621  FNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  672



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  730  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  551
            HE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+T
Sbjct  268  HEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRIT  327

Query  550  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  371
            SAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCA
Sbjct  328  SAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCA  387

Query  370  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            AGF + TL +YQIVFSRPGNV   G+PYKG  SAY
Sbjct  388  AGFKSYTLWNYQIVFSRPGNVGVLGNPYKGFPSAY  422



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   246 bits (629),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M +FF  CES LAE+G+LVLQ ISI DE YDE+R+SS F++E
Sbjct  293  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSISIADECYDEHRRSSCFMRE  352

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR  FLE +S+IL +GFD
Sbjct  353  YIFPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKTFLENKSKILAMGFD  412

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRPGNV   G+PYKG  SAY
Sbjct  413  EKFIRTWEYYFDYCAAGFKSYTLGDYQIVFSRPGNVGVLGNPYKGFPSAY  462



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   C    H   E++ +FF  CES LAE+G+LVLQFISIP+ER++EYR+SSDFI
Sbjct  689  KYDRII--SCEMIEHLGDEYVEQFFRCCESALAEDGLLVLQFISIPEERFEEYRRSSDFI  746

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL+R+ + MAA+SRLCVEH+E+IG++YY TLRCWR NFLE QS+IL LG
Sbjct  747  KEYIFPGGCLPSLNRIVTGMAAASRLCVEHVENIGMNYYLTLRCWRKNFLENQSKILALG  806

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD+KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGN  A G PY+G  SAY
Sbjct  807  FDEKFMRTWEYYFDYCAAGFRTYTLGDYQVVFSRPGNYKALGYPYQGFPSAY  858



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKE
Sbjct  514  KYDRIISCEMIEGVGHEYMEEFFGCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKE  573

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            Y+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD
Sbjct  574  YVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFD  633

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  634  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  676



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 141/170 (83%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ E
Sbjct  503  KYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNE  562

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  563  YIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFN  622

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  623  EKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FI
Sbjct  608  KYDRII--SCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFI  665

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LG
Sbjct  666  KEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALG  725

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  726  FNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  777



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      H++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FI
Sbjct  700  KYDRII--SCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFI  757

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LG
Sbjct  758  KEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALG  817

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            F++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  818  FNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  869



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF RCES LAE G+LVLQF ++PD RYDE R S  FI E
Sbjct  216  KYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESRLSPGFITE  275

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ ++  +GFD
Sbjct  276  YIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQEEVKAIGFD  335

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  336  EKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  384



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKE
Sbjct  696  KYDRIISCEMIEAVGHEFMEDFFGTCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD
Sbjct  756  YIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFD  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  816  ESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  865



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HE+M EFFG CESVLA++G+ VLQFISIPDERY+EYR+SSDFIKE
Sbjct  638  RYDRIISCEMIEAVGHEYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYRRSSDFIKE  697

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSRVTSAMA++SRL VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF+
Sbjct  698  YIFPGGCLPSLSRVTSAMASASRLSVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFN  757

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            +KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  758  EKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  800



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M EFFG CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKE
Sbjct  695  KYDRIISCEMIEGVGHEYMEEFFGCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKE  754

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            Y+FPGGC+PSLSR+TSAMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD
Sbjct  755  YVFPGGCIPSLSRITSAMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFD  814

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            +KFIRTWEYYF YCAAGF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  815  EKFIRTWEYYFIYCAAGFRSRTLGNYQMVFSRPGNLTALGSLY  857



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 142/172 (83%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      HE+M EFF  CESVLAE+G+LVLQFI+IPD+RYDE R+S DF+
Sbjct  696  KYDRII--SCGMIEHVGHEYMEEFFDCCESVLAEDGLLVLQFIAIPDKRYDEVRKSIDFL  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL R+TSAM  +SRLC+EH+E+IG +YY TL+CWR NFL+ + +IL +G
Sbjct  754  KEYIFPGGCLPSLYRITSAMRTASRLCMEHVENIGSNYYLTLKCWRKNFLKNKEKILAMG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD+KFIRTWEYYFDYCAAGF + TL DYQIVFSRPGN+ A G+PYKG  SAY
Sbjct  814  FDEKFIRTWEYYFDYCAAGFKSYTLLDYQIVFSRPGNIAALGNPYKGFPSAY  865



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKE
Sbjct  696  KYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSLSR+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF+
Sbjct  756  YIFPGCCVPSLSRITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFN  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            +KFIRTWEYYFDYCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  816  EKFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  858



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  769  YDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEY  593
            YDRII         HEFM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR SSDFIKEY
Sbjct  704  YDRIISCEMLEAVGHEFMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEY  763

Query  592  IFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDK  413
            IF GGCLPSL+R+TSAMA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+ QI+DLGFD+
Sbjct  764  IFHGGCLPSLARLTSAMASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRQIMDLGFDE  823

Query  412  KFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            KFIRTWEYYFDYC+AGF T TLG+YQ+VFSR G+ +AFGDPY+   SAY
Sbjct  824  KFIRTWEYYFDYCSAGFRTFTLGNYQMVFSRLGSTSAFGDPYRSFPSAY  872



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF RCES LAE G+LVLQF ++PD RYDE R S  FI E
Sbjct  267  KYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESRLSPGFITE  326

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGIHY++TLRCWR NFL+RQ ++  +GFD
Sbjct  327  YIFPGACHPSLARVTSAMASSSRLCIEHVENIGIHYHKTLRCWRQNFLKRQEEVKAIGFD  386

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  387  EKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  435



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   249 bits (637),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM  FF  CE+ LAE+GI+V QFI+IP+ERY+EYR +SDF++E
Sbjct  699  KYDRIISCEMMEHIGHEFMETFFSHCEAALAEDGIIVHQFIAIPEERYNEYRLNSDFVRE  758

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLCVE++E+IG HYY+TLR WR NFLE + QI+DLGFD
Sbjct  759  YIFPGGCLPSLARVTSAMASSSRLCVENVENIGNHYYKTLRSWRKNFLENEKQIMDLGFD  818

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDY AA   T T+ DYQ+VFSRPGNV A GDP++   SA
Sbjct  819  DKFIRTWEYYFDYSAAALKTLTIADYQVVFSRPGNVAALGDPFRSFPSA  867



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI E
Sbjct  264  KYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITE  323

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD
Sbjct  324  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFD  383

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKGLA  275
            +KF+RTWEYYFDYCAAGF T TL +YQIVFSRPGNV AFG  DP+   A
Sbjct  384  EKFLRTWEYYFDYCAAGFKTLTLRNYQIVFSRPGNVAAFGNDDPFHSSA  432



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   246 bits (628),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKE
Sbjct  658  KYDRIVSCEMIEAVGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKE  717

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C+PSLSRVT AMAA+SRLCVEH E+IGIHYY TLR WR NF+E  S+IL LGFD
Sbjct  718  YIFPGCCIPSLSRVTLAMAAASRLCVEHAENIGIHYYPTLRWWRKNFMENHSKILALGFD  777

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  272
            +KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  778  EKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  825



>ref|XP_009758040.1| PREDICTED: uncharacterized protein LOC104210742, partial [Nicotiana 
sylvestris]
Length=251

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y RII +       HEFM+EFF  CES LAE+G+LVLQF+S+PDERYDEYR S  FIKE
Sbjct  102  KYHRIISIGMIEHVGHEFMDEFFTCCESSLAEDGLLVLQFVSMPDERYDEYRYSIGFIKE  161

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP+LSRVTSAMAA+S+LCV HLE+IGIHYYQTLRCWR NFLE QSQI  LGFD
Sbjct  162  YIFPGGCLPALSRVTSAMAAASKLCVVHLEEIGIHYYQTLRCWRKNFLENQSQIRALGFD  221

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
             KFIRTWEYYFDYCAAGF T T+GDYQ+
Sbjct  222  DKFIRTWEYYFDYCAAGFKTRTIGDYQV  249



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII         HEF   FF  CE  LA++GI V+QF ++P+E YDE R SS FI E
Sbjct  287  KYNRIIACEMIEAVGHEFYEAFFSCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD
Sbjct  347  YIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFGDP+    SA
Sbjct  407  DKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGDPFHSFPSA  455



>ref|XP_002460494.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
 gb|EER97015.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
Length=490

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 139/171 (81%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CE++LA++GI VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  316  KYDRIISCEMIEGVGHEYMDDFFGCCETLLAQDGIFVLQFISIPEERYEEYRRSSDFIKE  375

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+PSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  376  YIFPGGCIPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMVNKDAILALGFD  435

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  269
            +KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  ++  GDPY    +A
Sbjct  436  EKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLSNNGDPYASFPAA  486



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII         HEF   FFG CE  LA++GI V+QF ++P+E YDE R SS FI E
Sbjct  287  KHDRIIACEMIEAVGHEFYEAFFGCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITE  346

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD
Sbjct  347  YIFPGGCLPSLARVTSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFD  406

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
             KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ AFG P+    SA
Sbjct  407  DKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIAAFGHPFHSFPSA  455



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 139/173 (80%), Gaps = 11/173 (6%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            RYDRII         HE+M EFFG CESVLA++G+ VLQFISIPDERY+EYR+SSDFIKE
Sbjct  662  RYDRIISCEMIEAVGHEYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYRRSSDFIKE  721

Query  595  YIFPGGCLPSLSRVTSAMAASSRL----------CVEHLEDIGIHYYQTLRCWRANFLER  446
            YIFPGGCLPSLSRVTSAMA++SRL           VEH+++IGIHY+QTLRCWR NF+E+
Sbjct  722  YIFPGGCLPSLSRVTSAMASASRLRYNCITSSAQSVEHVDNIGIHYHQTLRCWRKNFMEK  781

Query  445  QSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
            Q +IL  GF++KFIRTW+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  782  QRKILAPGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  834



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 137/172 (80%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   C    H   E++ EFF  CES+LA++G+ VLQFIS+ +E++ EY +S  F+
Sbjct  204  KYDRII--SCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEYLRSPGFV  261

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL LG
Sbjct  262  KEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILALG  321

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G  SAY
Sbjct  322  FDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPSAY  373



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   241 bits (616),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = -1

Query  775  CRYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            C+YDRII   CG      HE+  +FF  CESVLA+NG+LVLQFIS+PDE YD +R+SS F
Sbjct  704  CKYDRII--SCGMIEHVGHEYYEDFFRTCESVLADNGLLVLQFISVPDELYDGFRRSSGF  761

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            + EYIFPGGCLPSLSR+TSAM ++SRLCVEH+E+IGIHY QTLRCWR NFLE  S+I  L
Sbjct  762  VYEYIFPGGCLPSLSRITSAMVSASRLCVEHVENIGIHYGQTLRCWRKNFLENHSKIRSL  821

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            GFD+KF+R WEYYFDY A+ F T  LGDYQIVFSR GN+ AF DPY+ ++S+
Sbjct  822  GFDEKFMRAWEYYFDYTASAFKTRALGDYQIVFSRLGNLVAFSDPYETISSS  873



>dbj|BAJ91247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  155  KYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKE  214

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  215  YIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFD  274

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  269
             KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  275  DKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  325



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  219  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKE  278

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD
Sbjct  279  YIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFD  338

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  339  DKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  390



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF RCES LAE G+LVLQF ++PD RYDE R S  FI E
Sbjct  267  KYDRIISCEMIEAVGHKFMETFFNRCESALAEEGLLVLQFSAVPDSRYDESRLSPGFITE  326

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPG C PSL+RVTSAMA+SS   +EH+E+IGIHY++TLRCWR NFL+RQ ++  +GFD
Sbjct  327  YIFPGACHPSLARVTSAMASSS--SIEHVENIGIHYHKTLRCWRQNFLKRQEEVKAIGFD  384

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIR WEYYFDYCAAGF T  L  YQ+VFSRPGN T FGDPY    SA
Sbjct  385  EKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPGNTTMFGDPYMSYPSA  433



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKE
Sbjct  638  KYDRIISCEMIEAVGHEFMEEFFGCCESLLAEDGLLVLQFISIPDERYNEYRLSSDFIKE  697

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+ +SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  698  YIFPGGCLPSLSRITSAMSVASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFN  757

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
             KFIRTWEYYFDYCAAGF + TLG+YQ
Sbjct  758  DKFIRTWEYYFDYCAAGFKSYTLGNYQ  784



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 133/159 (84%), Gaps = 7/159 (4%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRII    +   G   HE+M+EFFG CES+LAENGI V QFISIP+ERYDEYR+SSDF
Sbjct  676  KYDRIICCEMIEEVG---HEYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYRRSSDF  732

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL L
Sbjct  733  IKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILAL  792

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  308
            GFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  793  GFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  831



>ref|XP_002883432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59691.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = -1

Query  772  RYDRIILV-RCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII   R     H+FM  FF  CE+ LAE+GI VL FISIP+ERY+EYR +SDFIKE
Sbjct  180  KYDRIISCERLEHVGHKFMETFFSHCEAALAEDGIFVLLFISIPEERYNEYRLNSDFIKE  239

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAM++SSRLC+E++E+IGIHYYQTLR WR NFLERQ QI+DLGFD
Sbjct  240  YIFPGGCLPSLARVTSAMSSSSRLCIENVENIGIHYYQTLRLWRKNFLERQKQIIDLGFD  299

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
             KFIR WEYYFDYCAAGF T TLG +++
Sbjct  300  DKFIRIWEYYFDYCAAGFKTLTLGPWRL  327



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 9/152 (6%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRI+    L   G   HEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDF
Sbjct  284  KYDRIVSCEMLEHVG---HEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDF  338

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DL
Sbjct  339  IKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDL  398

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            GFD KFIRTWEYY+DYCAAGF T TLGDYQ+ 
Sbjct  399  GFDNKFIRTWEYYYDYCAAGFKTRTLGDYQVT  430



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   239 bits (610),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 4/168 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YD II         HE+M EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKE
Sbjct  613  KYDTIISCEMIEAVGHEYMEEFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKE  672

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF+
Sbjct  673  YIFPGGCLPSLTRITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFN  732

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVF-SRPGNVTAFGDPYKGLA  275
            +KFIRTWEYYFDYCAAGF T TLG+YQ++   RPG  T   DP   +A
Sbjct  733  EKFIRTWEYYFDYCAAGFKTHTLGNYQLLNPDRPGGSTR--DPVDPVA  778


 Score =   167 bits (424),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 101/148 (68%), Gaps = 28/148 (19%)
 Frame = -1

Query  772   RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
             +YDRI+         HE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKE
Sbjct  1218  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKE  1277

Query  595   YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
             YIFPGGCLPSLSR+TSAM  +SRLC                           +IL +GFD
Sbjct  1278  YIFPGGCLPSLSRITSAMGVASRLC---------------------------KILAMGFD  1310

Query  415   KKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
             +KFIRTWEYYFDY +AGF + TLGDYQ+
Sbjct  1311  EKFIRTWEYYFDYSSAGFKSYTLGDYQL  1338


 Score =   159 bits (403),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 97/147 (66%), Gaps = 28/147 (19%)
 Frame = -1

Query  772   RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
             +YDRI+         HE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKE
Sbjct  1505  KYDRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKE  1564

Query  595   YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
             YIFPGGCLPSLSR+TSAM  +SRLC                           +IL +GFD
Sbjct  1565  YIFPGGCLPSLSRITSAMGVASRLC---------------------------KILAMGFD  1597

Query  415   KKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
             +KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1598  EKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 136/172 (79%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   C    H   E++ EFF  CES+LA++G+ VLQFIS+ +E++ E+ +S  F+
Sbjct  241  KYDRII--SCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEHLRSPGFV  298

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL LG
Sbjct  299  KEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILALG  358

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  359  FDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  410



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            ++DRII   CG   H   E+  +FF  CES+LA+ G+LVLQ ISIPDERYD +R+SSDF+
Sbjct  621  KFDRII--SCGMLEHVGDEYYEDFFRHCESLLADTGLLVLQTISIPDERYDGHRKSSDFM  678

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I  LG
Sbjct  679  REYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIRSLG  738

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  739  FDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  790



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   235 bits (599),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 137/178 (77%), Gaps = 11/178 (6%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRI+         HE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKE
Sbjct  616  KYDRIVSCEMIEAVGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKE  675

Query  595  YIFPGGCLPSLSRVTSAMAASSRLC----------VEHLEDIGIHYYQTLRCWRANFLER  446
            YIFPG C+PSLSRVT AMAA+SRL           VEH E+IGIHYY TLR WR NF+E 
Sbjct  676  YIFPGCCIPSLSRVTLAMAAASRLWYMLYFNTANNVEHAENIGIHYYPTLRWWRKNFMEN  735

Query  445  QSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  272
             S+IL LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  736  HSKILALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  793



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 136/172 (79%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   C    H   E++ EFF  CES+LA++G+ VLQFIS+ +E++ E+ +S  F+
Sbjct  262  KYDRII--SCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQFISMTEEQFPEHLRSPGFV  319

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL LG
Sbjct  320  KEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILALG  379

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A GDPY+G   AY
Sbjct  380  FDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALGDPYQGFPLAY  431



>ref|XP_006420313.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
 gb|ESR33553.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
Length=296

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE++ EFFG CES+LAE G+L+LQF S+PD+ YD +R S  FI E
Sbjct  128  KYDRIISCEMIENVGHEYIEEFFGCCESLLAEQGLLLLQFSSVPDQCYDGHRLSPGFITE  187

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            Y+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQT RCWR N +E+QS+IL LGF+
Sbjct  188  YVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTRRCWRTNLMEKQSEILALGFN  247

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDYCAAGF + TLG+YQIVFS P NV AF +P++   SA
Sbjct  248  EKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSHPSNVAAFSNPHESFPSA  296



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            ++DRII   CG   H   E+  +FF  CES+LA+ G+LVLQ ISIPDERYD +R+SSDF+
Sbjct  700  KFDRII--SCGMLEHVGDEYYEDFFRHCESLLADTGLLVLQTISIPDERYDGHRKSSDFM  757

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            +EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I  LG
Sbjct  758  REYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIRSLG  817

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            FD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  818  FDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  869



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   238 bits (606),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 133/174 (76%), Gaps = 5/174 (3%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEFM +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKE
Sbjct  617  KYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKE  676

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLP LSRVT+AM  +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD
Sbjct  677  YIFPGGCLPCLSRVTTAMTKASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFD  736

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN----VTAFGDPYKGLASAY  266
            + FIRTWEYYFDYCAAGF + TL +YQIV+SRPGN    V   G    GL SA+
Sbjct  737  ESFIRTWEYYFDYCAAGFKSRTLNNYQIVYSRPGNVAMKVAVVGGGISGLVSAF  790


 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 121/170 (71%), Gaps = 28/170 (16%)
 Frame = -1

Query  772   RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
             +YDRII         HEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKE
Sbjct  1469  KYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKE  1528

Query  595   YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
             YIFPGGCLP LSR+T+AMA +SRLC                           +IL LGFD
Sbjct  1529  YIFPGGCLPCLSRLTTAMANASRLC---------------------------KILQLGFD  1561

Query  415   KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             + FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  1562  ESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  1611



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 9/150 (6%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRI+    L   G   HEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDF
Sbjct  284  KYDRIVSCEMLEHVG---HEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDF  338

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DL
Sbjct  339  IKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDL  398

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            GFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  399  GFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 124/150 (83%), Gaps = 9/150 (6%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRI+    L   G   HEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDF
Sbjct  284  KYDRIVSCEMLEHVG---HEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDF  338

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DL
Sbjct  339  IKEYIFPGGCLPSLARVTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDL  398

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            GFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  399  GFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 3/172 (2%)
 Frame = -1

Query  775  CRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  599
            C+YDRII      G  HEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIK
Sbjct  655  CKYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIK  714

Query  598  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  419
            EYIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGF
Sbjct  715  EYIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYSTLIRWRDNFMANKDAILALGF  774

Query  418  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  269
            D KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +PY  L +A
Sbjct  775  DDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLACADNPYASLPAA  826



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M+EFFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  593  KYDRIISCEMIEGVGHEYMDEFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKE  652

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+ASSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD
Sbjct  653  YIFPGGCLPSLSRITSAMSASSRLCIEHLENIGYHYYPTLIRWRDNFMVNREEISALGFD  712

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN  +  F D PY    +A
Sbjct  713  DKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLMPFADNPYTTFPAA  764



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   237 bits (604),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 7/159 (4%)
 Frame = -1

Query  772   RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
             +YDRII    +   G   HE+M+EFFG CES+LAENGI V QF SIP+ERYDEYR+SSDF
Sbjct  1268  KYDRIICCEMIEEVG---HEYMDEFFGCCESLLAENGIFVTQFTSIPEERYDEYRRSSDF  1324

Query  604   IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
             IKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL L
Sbjct  1325  IKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILAL  1384

Query  424   GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  308
             GFD+KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGN 
Sbjct  1385  GFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNT  1423


 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -1

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            L+FISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  557  LEFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKE
Sbjct  700  KYDRIISCEMIEAVGHEYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKE  759

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+++TSAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF+
Sbjct  760  YIFPGGCLPSLTKITSAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFN  819

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  820  EKFIRTWEYYFDYCAAGFKTHTLGNYQV  847



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKE
Sbjct  642  KYDRIISCEMIEAVGHDYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKE  701

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHYYQTLRCWR NFLE+QS+IL LGF 
Sbjct  702  YIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQSKILALGFS  761

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  762  EKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  810



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   233 bits (593),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  636  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKE  695

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  696  YIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFD  755

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            +KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  756  EKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  790



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   233 bits (594),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  706  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKE  765

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  766  YIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFD  825

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            +KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN
Sbjct  826  EKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGN  860



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 133/166 (80%), Gaps = 14/166 (8%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRII    +   G   HE+M+EFFG CES+LAENGI V QFISIP+ERYDEYR+SSDF
Sbjct  628  KYDRIICCEMIEEVG---HEYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYRRSSDF  684

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL L
Sbjct  685  IKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILAL  744

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ-------IVFSRPGNV  308
            GFD+KFIRTWEYYF YCAAGF + TLGDYQ       IVFSRPGN 
Sbjct  745  GFDEKFIRTWEYYFIYCAAGFKSRTLGDYQASTVLLYIVFSRPGNT  790



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  548  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKE  607

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD
Sbjct  608  YIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFD  667

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  668  DKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  719



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  706  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKE  765

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  I  LGFD
Sbjct  766  YIFPGGCLPSLARITSAMSAASRLCIEHLENIGYHYYPTLIRWRDNFMANKDAISALGFD  825

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGDPYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN      DPY    +A
Sbjct  826  DKFIRIWEYYFIYCAAGFKSRTLGNYQIVFSRPGNDKLGDNDPYASFPAA  875



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  579  KYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKE  638

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  639  YIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFD  698

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  269
             KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  699  DKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  749



>ref|XP_002467653.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
 gb|EER94651.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
Length=685

 Score =   228 bits (581),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M++FF  CE  L E+G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  528  KYDRIISCEMIEHVGHEYMDDFFSCCEQHLKEHGLFVLQFISIPEERYEEYRRSSDFIKE  587

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+ +SRLC+EH+E+IG HYY TL CWR NF+  + ++L +GFD
Sbjct  588  YIFPGGCLPSLARITSAMSNASRLCIEHVENIGYHYYTTLMCWRDNFMTHRDKVLAIGFD  647

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  308
            +KFIRTWEYYF YCAAGF + TLGDYQIVFSRPGNV
Sbjct  648  EKFIRTWEYYFIYCAAGFKSRTLGDYQIVFSRPGNV  683



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   229 bits (585),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HEFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKE
Sbjct  651  KYDRIISCEMIEGVGHEFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKE  710

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD
Sbjct  711  YIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFD  770

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  771  DKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  821



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 136/171 (80%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HEFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKE
Sbjct  706  KYDRIISCEMIEGVGHEFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKE  765

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD
Sbjct  766  YIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFD  825

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  826  DKFIRIWEYYFMYCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  876



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 134/171 (78%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  702  KYDRIISCEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKE  761

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD
Sbjct  762  YIFPGGCLPSLARITSAMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFD  821

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  269
             KFIR WEYYF YCAAGF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  822  DKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  872



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII      G  HE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKE
Sbjct  719  KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKE  778

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD
Sbjct  779  YIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFD  838

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  269
             KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  839  DKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  890



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKE
Sbjct  696  KYDRIISCEMIEAVGHDYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHY+QTLRCWR NFLE+QS+I  LGF 
Sbjct  756  YIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYFQTLRCWRKNFLEKQSKIRALGFS  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  816  EKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  864



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 134/174 (77%), Gaps = 5/174 (3%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSD  608
             C+YDRII   C    H   E++ EFF  CES+LA++G+ VLQFIS+ +E + EY +S  
Sbjct  744  TCKYDRII--SCEMTEHVGNEYIEEFFRCCESILAKDGLFVLQFISVTEELFHEYLRSPG  801

Query  607  FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  428
            F KEYIFPGGCL SL+R+ SAM A SRL VEH+E+IG +Y QTLRCWR NFLE +S+IL 
Sbjct  802  FAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHVENIGPNYVQTLRCWRKNFLENKSKILA  861

Query  427  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRP N  A GDPY+G  SAY
Sbjct  862  LGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPSNFAALGDPYQGFPSAY  915



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 137/182 (75%), Gaps = 13/182 (7%)
 Frame = -1

Query  775  CRYDRII------LVRCGSGC-----HEFMNEFFGRCESVLAENGILVLQFISIPDERYD  629
            C+YDRII      LV   S       HEFM++FFG CES+LA +G+ VLQFISIP+ERY+
Sbjct  648  CKYDRIISWKYLPLVDTHSEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYE  707

Query  628  EYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE  449
            EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+E +E+IG HYY TL  WR NF+ 
Sbjct  708  EYRRSSDFIKEYIFPGGCLPSLARITSAMSTASRLCIEQVENIGYHYYPTLIRWRDNFMA  767

Query  448  RQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLA  275
             +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIVFSRPGN   A+ D PY  L 
Sbjct  768  NKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLAYADNPYASLP  827

Query  274  SA  269
            +A
Sbjct  828  AA  829



>dbj|BAK04927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  551
            HE+M+EFF  CES LAE+GILVLQFIS P+ERY++YR+ +DFIKEYIFPGGCLPSL RV 
Sbjct  10   HEYMDEFFACCESYLAEDGILVLQFISAPEERYEQYRRRTDFIKEYIFPGGCLPSLGRVM  69

Query  550  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  371
            SAM  SSR C+EH+E+IG HYY TL  WR NF+  + Q+L LGFD+KFIR WE+Y  Y A
Sbjct  70   SAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVLALGFDEKFIRIWEFYLIYSA  129

Query  370  AGFHTCTLGDYQIVFSRPGN  311
            AGF + T+GDYQ+VFSRPGN
Sbjct  130  AGFKSRTVGDYQVVFSRPGN  149



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI E
Sbjct  274  KYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITE  333

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD
Sbjct  334  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFD  393

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
            +KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  394  EKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  430



>ref|XP_004296401.1| PREDICTED: uncharacterized protein LOC101310979 [Fragaria vesca 
subsp. vesca]
Length=455

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 131/171 (77%), Gaps = 3/171 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HEF++EFF  CESVL ENG+ +LQFIS+PD+RYD+YR+ + FIKE
Sbjct  285  KYDRIISCEMIEHVGHEFVDEFFSCCESVLEENGLFILQFISMPDDRYDDYRRGTGFIKE  344

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE-RQSQILDLGF  419
            YIFPGGCLPSL RV SAMAASSRLCVEHLE+IGI    T+  ++  FL    S+IL LGF
Sbjct  345  YIFPGGCLPSLGRVISAMAASSRLCVEHLENIGIFMTATV-LYKMQFLFCIYSEILALGF  403

Query  418  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            ++ FIRTWEYYFDYCAAGF +  +GDYQIVFSRPGN   + +PYKG  SAY
Sbjct  404  NENFIRTWEYYFDYCAAGFKSHIVGDYQIVFSRPGNALTYNNPYKGFPSAY  454



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         H+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI E
Sbjct  285  KYDRIISCEMIEHVGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITE  344

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD
Sbjct  345  YIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFD  404

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
            +KF+RTWEYYFDYCAAGF T TL +YQ+  +    +T
Sbjct  405  EKFLRTWEYYFDYCAAGFKTLTLRNYQVTHTHSSTLT  441



>emb|CDY09025.1| BnaC01g30660D [Brassica napus]
Length=137

 Score =   207 bits (528),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            +QF ++P+E YDE R SS FI EYIFPGGCLPSL+RVTSAM+ SS+LC+E +E+IGIHYY
Sbjct  1    MQFTAVPEELYDEIRLSSGFITEYIFPGGCLPSLARVTSAMSFSSKLCIEDVENIGIHYY  60

Query  484  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
             TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ 
Sbjct  61   YTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIA  120

Query  304  AFGDPYKGLASA  269
            AFGDP++   SA
Sbjct  121  AFGDPFRSFPSA  132



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 128/173 (74%), Gaps = 6/173 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YDRII   CG      HE M EFF  CES LAENG+LVLQFI+  DE+YDE R+S  F+
Sbjct  696  KYDRII--SCGMIEHVGHEVMEEFFRCCESALAENGLLVLQFIASADEKYDESRRSPGFV  753

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGC PSLS V S MAA+SRL   HLE+IG HY+ TLR WR N L+  S+IL +G
Sbjct  754  KEYIFPGGCTPSLSHVISCMAAASRLSAVHLEEIGCHYFHTLRRWRENLLKNHSKILAMG  813

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYKGLASAY  266
            F++KFIRTWEYYFDYCAAGF  C LGDYQIVFSRPG+V AF + PY  +   Y
Sbjct  814  FNEKFIRTWEYYFDYCAAGFKYCILGDYQIVFSRPGDVAAFSNKPYNAVPGDY  866



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YD II         HE++ EFFG CES+LAE+G+L+LQF S+PD+ YD +R S  FI E
Sbjct  697  KYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITE  756

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            Y+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF+
Sbjct  757  YVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFN  816

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            +KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP NV AF +P++
Sbjct  817  EKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSNVAAFSNPHE  860



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 122/150 (81%), Gaps = 7/150 (5%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRII    L   G   H+F+ +FF  CES LAE+G+LVLQFISIPDERYD +R S+DF
Sbjct  366  KYDRIISCEMLEHIG---HDFIGKFFTCCESSLAEDGLLVLQFISIPDERYDSHRHSTDF  422

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            ++EYIFPGG L + S+VTS MAA+SRLCVEHLE+IGIHYYQTL+CWR NF + QSQI  L
Sbjct  423  MREYIFPGGGLNAPSQVTSVMAAASRLCVEHLENIGIHYYQTLKCWRRNFFKNQSQIRAL  482

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            GFD KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  483  GFDDKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YD II         HE++ EFFG CES+LAE+G+L+LQF S+PD+ YD +R S  FI E
Sbjct  682  KYDTIISCEMIENVGHEYIEEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITE  741

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            Y+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF+
Sbjct  742  YVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFN  801

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP  V AF +P++   SA
Sbjct  802  EKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAAFSNPHESFPSA  850



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            NC+YDRII         HE++ EFF  CES L ENGILVLQFI+I DE+YDE+  S+ FI
Sbjct  641  NCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILVLQFIAIADEKYDEFTHSAGFI  700

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+LG
Sbjct  701  KEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILELG  760

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PYKGLAS  272
            FD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY  + +
Sbjct  761  FDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPYNPVPA  811



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            NC+YDRII         HE++ EFF  CES L ENGILVLQFI+I DE+YDE+  S+ FI
Sbjct  695  NCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILVLQFIAIADEKYDEFTHSAGFI  754

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+LG
Sbjct  755  KEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILELG  814

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD-PY  287
            FD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ AFG+ PY
Sbjct  815  FDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIAAFGNKPY  860



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII         HE+M+EFFG CES+LAE+GI V+QF SIP+ERYDEYR+SSDFIKE
Sbjct  657  KYDRIICCEMIEEVGHEYMDEFFGCCESLLAEDGIFVIQFSSIPEERYDEYRRSSDFIKE  716

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGC+P L+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD
Sbjct  717  YIFPGGCIPCLTRITSAMSAASRLCIEHVENIGHHYYPTLVRWRDNFMANKDKILALGFD  776

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  284
            ++F RTWEYYF Y AAGF + TLG YQIVFSRPGN    G  +K
Sbjct  777  ERFTRTWEYYFMYSAAGFKSRTLGVYQIVFSRPGNAK-LGSGFK  819



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   219 bits (558),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII V        E++ EFF  C+S+LAENG+ VLQFISIP+    E +Q++ F+KE
Sbjct  690  KYDRIISVEMVEHVGEEYIEEFFRCCDSLLAENGLFVLQFISIPEILSKEIQQTAGFLKE  749

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA+SR  VEH+E+IGI YY TLR WR NFL  +S++L LGFD
Sbjct  750  YIFPGGTLLSLDRTLSAMAAASRFSVEHVENIGISYYHTLRWWRKNFLANESKVLALGFD  809

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN  A GDPY G  SAY
Sbjct  810  EKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFAALGDPYIGFPSAY  859



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 128/174 (74%), Gaps = 5/174 (3%)
 Frame = -1

Query  778  NCRYDRIILVRCGSGCH---EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSD  608
             C+YDRII   C    H   E++ EFF  CES+LA++G+ VLQF S+ +  Y EY +S  
Sbjct  288  TCKYDRII--SCEMSEHVGNEYIEEFFRCCESILAKDGLFVLQFTSVTEGLYHEYLRSPG  345

Query  607  FIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILD  428
            F KEYIFPG CL SL+R+ SAMA +SRL VEH+E+IG +Y QTL+ WR NFL+ +S+IL 
Sbjct  346  FAKEYIFPGACLLSLTRILSAMATASRLSVEHVENIGSNYVQTLKGWRKNFLKNKSKILA  405

Query  427  LGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            LGFD+KF RTWEY+FDY AAGF + TL  YQ+VFSRPGN  A GDPY+G  SAY
Sbjct  406  LGFDEKFTRTWEYFFDYAAAGFKSRTLETYQVVFSRPGNFAALGDPYQGFPSAY  459



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 5/158 (3%)
 Frame = -1

Query  775  CRYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            C+YD II   CG      HE+M+EFF  CES LAE+GILVLQFIS PDERY++YR+ +DF
Sbjct  463  CKYDAII--SCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISAPDERYEQYRRRTDF  520

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL RV SAM  SSR C+EH+E+IG HYY TL  WR NF+  + Q+L L
Sbjct  521  IKEYIFPGGCLPSLGRVVSAMTTSSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVLAL  580

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            GFD+KF+R WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  581  GFDEKFMRIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  618



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -1

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            LQFIS+P+ERYDEYR+SS+F+KEYIFPG C PSL+R+T+AMA+S+RLC+EH+E+IGIHYY
Sbjct  677  LQFISMPEERYDEYRKSSEFLKEYIFPGLCAPSLTRITTAMASSTRLCMEHVENIGIHYY  736

Query  484  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
            QTLR WR NFLE +S+IL LGF++KFIRTWEYYFDYCA+GF T TLGDYQ+V SRP NV 
Sbjct  737  QTLRYWRKNFLENKSKILALGFNEKFIRTWEYYFDYCASGFKTRTLGDYQVVLSRPRNVA  796

Query  304  AFGDPYKGLASA  269
            A G+PY   A+A
Sbjct  797  ALGNPYDEFAAA  808



>dbj|BAJ86532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 5/158 (3%)
 Frame = -1

Query  775  CRYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            C+Y  II   CG      HE+M+EFF  CES LAE+GILVLQFIS P+ERY++YR+ +DF
Sbjct  98   CKYGAII--SCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISAPEERYEQYRRRTDF  155

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RV SAM  SSR  +EH+E+IG HYY TL  WR NF+  + +IL L
Sbjct  156  IKEYIFPGGCLPSLARVMSAMTTSSRFSIEHVENIGPHYYTTLMRWRDNFMINKDEILAL  215

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            GFD KF+R WEYY  + A+ F + TLGDYQ+VFSRPGN
Sbjct  216  GFDDKFMRIWEYYLIFSASCFKSRTLGDYQVVFSRPGN  253



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   211 bits (538),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +Y+RII          E+ +EFF +C+ +LAE+G+ V+Q I++P+ERYDE R+SS+FIKE
Sbjct  696  KYNRIISCEMMEAVGPEYYDEFFAKCDYLLAEDGLAVIQVITVPEERYDELRRSSEFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG LP L+ +T+AM  +S LCVEHLE+IG+HYYQTL CWR NF  + S+I  LGF 
Sbjct  756  YIFPGGSLPCLAALTAAMFRASSLCVEHLENIGLHYYQTLMCWRRNFNSKTSEIAKLGFS  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            + F+R W+YYF YCAAGF TCTLG+ QIVFSR GN  A G+PY+   +A
Sbjct  816  ESFMRKWDYYFIYCAAGFLTCTLGNLQIVFSRSGNAAALGNPYRSFPTA  864



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII V        E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KE
Sbjct  625  QFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKE  684

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L LGFD
Sbjct  685  YIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFD  744

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            KKF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  745  KKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  794



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGCH-EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII          E+  EFF  CES+L E+G+LV+QF ++PD R++  R++S FI E
Sbjct  688  KYDRIISCEMLESIGVEYTKEFFSICESLLVEDGLLVVQFTTVPDSRFENNRRTSGFISE  747

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIF G C+PSLS VTSAM A+SR  VEHLEDIG+HYY  LRCWR NFL  ++QI  LGFD
Sbjct  748  YIFQGSCIPSLSYVTSAMGAASRFWVEHLEDIGVHYYPALRCWRDNFLRNRNQIEALGFD  807

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  287
             KF+R +EYYFDYCA+ F TC +G+YQ+V SRPGNV  FGDPY
Sbjct  808  DKFVRMFEYYFDYCASAFKTCAIGNYQLVLSRPGNVAIFGDPY  850



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII          E++ EFF  C+S L  NG+LVLQF ++ DE Y+++R+   FI E
Sbjct  267  KYDRIIACEMIEAVGDEYIEEFFRCCDSSLTTNGLLVLQFTAVRDEGYEKFRKCPGFIPE  326

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SLSRVTSAM  +S+L VEH+E+IG HYYQTLRCWR NFLE QS+IL LGF+
Sbjct  327  YIFPGGHLFSLSRVTSAMGTASKLSVEHVENIGEHYYQTLRCWRKNFLENQSKILSLGFN  386

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KFI+TWEYYFDYCAAGF    L +YQIVFSR G  TAF DP   + SA+
Sbjct  387  EKFIQTWEYYFDYCAAGFKMRFLKNYQIVFSRRG--TAFNDPSATIPSAH  434



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII V        E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KE
Sbjct  699  QFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKE  758

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L LGFD
Sbjct  759  YIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFD  818

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  819  EKFMRTWEYYFDYCAAGFKTGTLTDYQVVFSRAGNFGTLGDPYKGFRSAY  868



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII V        E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KE
Sbjct  691  QFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKE  750

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L LGFD
Sbjct  751  YIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFD  810

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  811  EKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII V        E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KE
Sbjct  691  QFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKE  750

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FLE  S++L LGFD
Sbjct  751  YIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFD  810

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  811  EKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 125/170 (74%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII V        E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KE
Sbjct  699  QFDRIISVEMVEHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKE  758

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L SL R  SAMAA++R  VEH+E+IG+ YY TLR WR  FL+  S++L LGFD
Sbjct  759  YIFPGGTLLSLDRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLKNTSKVLALGFD  818

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
            +KF+RTWEYYFDYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  819  EKFMRTWEYYFDYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  868



>gb|EMS47377.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=640

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  775  CRYDRIILV-RCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  599
            C+YD II +       HE++ EFF  CES LAE+GI+ LQFIS+PDERY++YR+  DFIK
Sbjct  475  CKYDAIISICMIEHVGHEYLGEFFACCESYLAEDGIMALQFISVPDERYEQYRRKPDFIK  534

Query  598  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  419
            EYIFPGGCLPSLSRV SAM  SSR  +EH E+IG HYY TL CW  N++  + +IL LGF
Sbjct  535  EYIFPGGCLPSLSRVMSAMTTSSRFSIEHAENIGPHYYTTLMCWMDNYIANRDKILALGF  594

Query  418  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            D+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  595  DEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  630



>gb|EMT01203.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=198

 Score =   192 bits (487),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -1

Query  772  RYDRIILV-RCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YD II +       HE M+EFF  CES LAE+GI+ LQFIS P+ERY++YR+  DF+ E
Sbjct  34   KYDAIISICMIEHVGHECMDEFFACCESYLAEDGIMALQFISAPEERYEQYRKRPDFLTE  93

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAM+ SSR C+EH+E+IG +YY TL CW  NF   + ++L LGFD
Sbjct  94   YIFPGGCLPSLARVVSAMSTSSRFCIEHVENIGPNYYPTLMCWMDNFTANKDKMLALGFD  153

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            +KFIR WEYY  + AA   + TLG YQ+VFSRPGN
Sbjct  154  EKFIRIWEYYLIFSAACMKSRTLGVYQVVFSRPGN  188



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +++RII         HE+  E+F RC+++LA++G++V+Q ISIP+ERYD YRQSSDFIKE
Sbjct  696  KFNRIISCEMLEAVGHEYYAEWFRRCDTLLAKDGLVVVQVISIPEERYDGYRQSSDFIKE  755

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPS + +T+AM++ S  CVEH+E+IGIHY +TL  W+  F   +++I+ LGF 
Sbjct  756  YIFPGGCLPSFAALTTAMSSGSSFCVEHMENIGIHYCETLLRWQEQFTRNRNKIMKLGFG  815

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            +KFIRTW+YYF YCAAGF +CTLG  QIVFSRPGN    G PY    +A
Sbjct  816  EKFIRTWDYYFFYCAAGFKSCTLGVLQIVFSRPGNEAFLGCPYVSFPTA  864



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 122/170 (72%), Gaps = 1/170 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII V        E++ EF+  C+ +L ++G+ VLQFI++P+E   E +Q++ FIKE
Sbjct  691  QYDRIISVEMVEHVGKEYIEEFYRCCDQLLKKDGLFVLQFITLPEELSKEVQQTAGFIKE  750

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGG L S +   SAMAA+S  CVEH+E+IG  YY TLR WR NFLE  S++L LGFD
Sbjct  751  YIFPGGMLLSFNTHLSAMAAASGFCVEHVENIGSSYYHTLRWWRKNFLENTSKVLALGFD  810

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  266
             KF+RTWEYYFDYCAAGF T TL DYQ+VFSR  N    GDPYKG  SAY
Sbjct  811  DKFMRTWEYYFDYCAAGFKTGTLLDYQVVFSRADNFATLGDPYKGFPSAY  860



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  775  CRYDRIILV-RCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  599
            C+YD II +       HE++++FF  CES LAE+GI+ LQFIS+PDERY++YR+  DFIK
Sbjct  707  CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYRRKPDFIK  766

Query  598  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  419
            EYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL LGF
Sbjct  767  EYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKILALGF  826

Query  418  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            D+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  827  DEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  775  CRYDRIILV-RCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  599
            C+YD II +       HE++++FF  CES LAE+GI+ LQFIS+PDERY++YR+  DFIK
Sbjct  707  CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYRRKPDFIK  766

Query  598  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  419
            EYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL LGF
Sbjct  767  EYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKILALGF  826

Query  418  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            D+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  827  DEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862



>ref|XP_006406023.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
 gb|ESQ47476.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
Length=394

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            +YDRII          EF   FF  CE+VLA  GI V+QF ++PDERYDE R SSDFIKE
Sbjct  250  KYDRIIACEMIEAVGDEFYETFFSCCEAVLAPYGIFVMQFTALPDERYDECRLSSDFIKE  309

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RVTSAMA+SSRLCVE +E+IGIHYY TL+ WR +FLERQ +I++LGFD
Sbjct  310  YIFPGGCLPSLARVTSAMASSSRLCVEDVENIGIHYYLTLKFWRKSFLERQKEIMNLGFD  369

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGD  341
             KFIRTW YYF+Y AAGF   +L +
Sbjct  370  DKFIRTWVYYFNYYAAGFKAHSLKN  394



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 5/157 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YD II   CG      HE+M+EFF  CES LAE+GILVLQFISI +ERY++YR+   F+
Sbjct  516  KYDAII--SCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISIAEERYEQYRRRPHFV  573

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGC+PSL+RV SAM  SSR  +EH+E+IG +YY TL  WR NF+  + Q+L+LG
Sbjct  574  KEYIFPGGCIPSLARVMSAMTTSSRFSIEHVENIGPNYYTTLMHWRDNFMANKDQVLELG  633

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  311
            FD+KFI  WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  634  FDEKFILIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  670



>ref|XP_002862681.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38939.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 107/164 (65%), Gaps = 41/164 (25%)
 Frame = -1

Query  772  RYDRII----LVRCGSGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  605
            +YDRII    L   G   H+FM  FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDF
Sbjct  72   KYDRIISCEMLEHVG---HKFMETFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDF  128

Query  604  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  425
            IKEYIFPGGCLPSL+RVTSA+                                  QI+DL
Sbjct  129  IKEYIFPGGCLPSLARVTSAI----------------------------------QIIDL  154

Query  424  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGD  293
            GFD KFIR WEYYFDYCAAGF T TLGDYQI FSRPGNV AFGD
Sbjct  155  GFDDKFIRIWEYYFDYCAAGFKTLTLGDYQIFFSRPGNVVAFGD  198



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = -1

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            LQ  SI D++YDE+R S  FIKEYIFPGG LPSLSR+TS MA++SRLCV H EDIG HYY
Sbjct  680  LQTSSIVDQKYDEFRLSHGFIKEYIFPGGFLPSLSRITSTMASASRLCVVHAEDIGSHYY  739

Query  484  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
            QTLRCWR NFL  Q +I+ LGFD+KFIRTWEYYF Y AAGF    +G+YQIVF+RPG+V 
Sbjct  740  QTLRCWRENFLRNQRKIMALGFDEKFIRTWEYYFSYTAAGFKMSIMGNYQIVFTRPGDVA  799

Query  304  AFG-DP  290
            AFG DP
Sbjct  800  AFGNDP  805



>gb|EMT06798.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=783

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 114/149 (77%), Gaps = 5/149 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YD II   CG      HE+M+EFF  CES LAE+GILVLQFIS+P+ERY++YR+  DFI
Sbjct  633  KYDTII--SCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISVPEERYEQYRKRPDFI  690

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL+R+ SAM  SSR C+EH+E+IG +YY TL  WR NF+  + ++L LG
Sbjct  691  KEYIFPGGCLPSLARIMSAMTTSSRFCIEHVENIGPNYYTTLMHWRDNFMANKDEVLALG  750

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            FD++F+R WEYY  + AAGF +  LGDYQ
Sbjct  751  FDERFLRIWEYYLIFSAAGFKSRALGDYQ  779



>gb|EMS64510.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=772

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 112/149 (75%), Gaps = 5/149 (3%)
 Frame = -1

Query  772  RYDRIILVRCG---SGCHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  602
            +YD II   CG      HE+M+EFF  CES LAE+GILVLQFISI +ERYD+YR+  DFI
Sbjct  555  KYDAII--SCGMIEHVGHEYMDEFFACCESYLAEDGILVLQFISIAEERYDQYRKRPDFI  612

Query  601  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  422
            KEYIFPGGCLPSL+RV SAM  SSR  +EH+E+IG +YY TL  WR NF+  + Q+L LG
Sbjct  613  KEYIFPGGCLPSLARVMSAMTTSSRFSIEHVENIGPNYYTTLMHWRDNFMANKDQVLKLG  672

Query  421  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            FD+KFIR WE+Y  Y AAGF +  +GDYQ
Sbjct  673  FDEKFIRIWEFYLIYSAAGFKSRAVGDYQ  701



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = -1

Query  727  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  548
            E++ EFFG CE VL E+G+LVLQF S  DE Y +YR +SDF+KEYIFPG C PSL R++S
Sbjct  770  EYLEEFFGWCEKVLTEDGLLVLQFSSTSDEGYHDYRHTSDFLKEYIFPGICPPSLGRISS  829

Query  547  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  368
            AMAA++RLCVEH+E+IG  Y++T+R W+   L+ +S+I+ LGF+++FIR WEYY DY AA
Sbjct  830  AMAATTRLCVEHVENIGSQYHRTVRFWKNKLLDNKSKIVALGFNEEFIRMWEYYLDYVAA  889

Query  367  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  269
            G ++ T  +YQ+VFSR G   A G+P KG +SA
Sbjct  890  GMNSRTHLNYQVVFSRHGYPAAPGNPDKGFSSA  922



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   191 bits (485),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 116/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  772  RYDRIILVRCGSGC-HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  596
            ++DRII         HE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KE
Sbjct  748  KFDRIISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKLRTRPEFLKE  807

Query  595  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  416
            YIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + ++  LGFD
Sbjct  808  YIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFD  867

Query  415  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  308
            +KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  868  EKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  903



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730