BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001L21

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN63457.1|  hypothetical protein VITISV_008241                     350   2e-114   Vitis vinifera
ref|XP_010658715.1|  PREDICTED: BTB/POZ domain-containing protein...    350   2e-114   Vitis vinifera
gb|KDO76413.1|  hypothetical protein CISIN_1g007950mg                   342   7e-113   Citrus sinensis [apfelsine]
ref|XP_010261456.1|  PREDICTED: BTB/POZ domain-containing protein...    341   3e-112   
ref|XP_007040414.1|  POZ/BTB containin G-protein 1 isoform 3            342   4e-112   
ref|XP_007040413.1|  POZ/BTB containin G-protein 1 isoform 2            341   5e-112   
ref|XP_006439420.1|  hypothetical protein CICLE_v10019554mg             342   5e-112   
gb|KDO76412.1|  hypothetical protein CISIN_1g007950mg                   342   2e-111   Citrus sinensis [apfelsine]
ref|XP_007040415.1|  POZ/BTB containin G-protein 1 isoform 4            340   2e-111   
ref|XP_009626291.1|  PREDICTED: BTB/POZ domain-containing protein...    343   2e-111   Nicotiana tomentosiformis
gb|KDO76410.1|  hypothetical protein CISIN_1g007950mg                   342   4e-111   Citrus sinensis [apfelsine]
ref|XP_006476450.1|  PREDICTED: BTB/POZ domain-containing protein...    342   4e-111   Citrus sinensis [apfelsine]
ref|XP_006439421.1|  hypothetical protein CICLE_v10019554mg             342   4e-111   Citrus clementina [clementine]
gb|KDP25348.1|  hypothetical protein JCGZ_20504                         342   6e-111   Jatropha curcas
ref|XP_010261454.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010261455.1|  PREDICTED: BTB/POZ domain-containing protein...    340   1e-110   Nelumbo nucifera [Indian lotus]
gb|KDO76409.1|  hypothetical protein CISIN_1g007950mg                   342   1e-110   Citrus sinensis [apfelsine]
ref|XP_007040412.1|  POZ/BTB containin G-protein 1 isoform 1            341   1e-110   Theobroma cacao [chocolate]
gb|KDO76407.1|  hypothetical protein CISIN_1g007950mg                   341   2e-110   Citrus sinensis [apfelsine]
gb|KCW78131.1|  hypothetical protein EUGRSUZ_D02337                     338   2e-110   Eucalyptus grandis [rose gum]
gb|KJB52233.1|  hypothetical protein B456_008G251700                    340   2e-110   Gossypium raimondii
emb|CBI40464.3|  unnamed protein product                                338   3e-110   Vitis vinifera
gb|KJB52235.1|  hypothetical protein B456_008G251700                    340   4e-110   Gossypium raimondii
ref|XP_011073542.1|  PREDICTED: BTB/POZ domain-containing protein...    339   4e-110   Sesamum indicum [beniseed]
gb|KDO86374.1|  hypothetical protein CISIN_1g008916mg                   333   6e-110   Citrus sinensis [apfelsine]
ref|XP_010053775.1|  PREDICTED: BTB/POZ domain-containing protein...    338   9e-110   Eucalyptus grandis [rose gum]
gb|KDO86375.1|  hypothetical protein CISIN_1g008916mg                   332   1e-109   Citrus sinensis [apfelsine]
ref|XP_010661871.1|  PREDICTED: BTB/POZ domain-containing protein...    338   1e-109   Vitis vinifera
ref|XP_002279915.1|  PREDICTED: BTB/POZ domain-containing protein...    338   1e-109   Vitis vinifera
ref|XP_010251562.1|  PREDICTED: BTB/POZ domain-containing protein...    338   1e-109   Nelumbo nucifera [Indian lotus]
ref|XP_010251563.1|  PREDICTED: BTB/POZ domain-containing protein...    338   1e-109   Nelumbo nucifera [Indian lotus]
ref|XP_007051652.1|  POZ/BTB containin G-protein 1 isoform 5            332   2e-109   
gb|KDO86372.1|  hypothetical protein CISIN_1g008916mg                   333   2e-109   Citrus sinensis [apfelsine]
ref|XP_007051651.1|  POZ/BTB containin G-protein 1 isoform 4            332   4e-109   
ref|XP_010053177.1|  PREDICTED: BTB/POZ domain-containing protein...    337   4e-109   
gb|KDO86371.1|  hypothetical protein CISIN_1g008916mg                   333   7e-109   Citrus sinensis [apfelsine]
ref|XP_007051649.1|  POZ/BTB containin G-protein 1 isoform 2            333   1e-108   
ref|XP_010544783.1|  PREDICTED: BTB/POZ domain-containing protein...    336   1e-108   Tarenaya hassleriana [spider flower]
ref|XP_009789895.1|  PREDICTED: BTB/POZ domain-containing protein...    335   2e-108   Nicotiana sylvestris
gb|KJB49507.1|  hypothetical protein B456_008G122900                    335   2e-108   Gossypium raimondii
ref|XP_002511951.1|  atpob1, putative                                   335   3e-108   Ricinus communis
ref|XP_009625070.1|  PREDICTED: BTB/POZ domain-containing protein...    334   4e-108   Nicotiana tomentosiformis
ref|XP_007051650.1|  POZ/BTB containin G-protein 1 isoform 3            332   5e-108   
gb|KHG17323.1|  BTB/POZ domain-containing POB1 -like protein            334   5e-108   Gossypium arboreum [tree cotton]
gb|ADN34171.1|  ATPOB protein binding                                   334   6e-108   Cucumis melo subsp. melo
ref|XP_008437944.1|  PREDICTED: BTB/POZ domain-containing protein...    334   6e-108   Cucumis melo [Oriental melon]
ref|XP_009789090.1|  PREDICTED: BTB/POZ domain-containing protein...    334   6e-108   Nicotiana sylvestris
gb|KJB41445.1|  hypothetical protein B456_007G104800                    334   6e-108   Gossypium raimondii
gb|KJB22359.1|  hypothetical protein B456_004G043000                    328   7e-108   Gossypium raimondii
ref|XP_009625060.1|  PREDICTED: BTB/POZ domain-containing protein...    334   7e-108   Nicotiana tomentosiformis
ref|XP_004133826.1|  PREDICTED: BTB/POZ domain-containing protein...    334   7e-108   Cucumis sativus [cucumbers]
ref|XP_002320175.2|  BTB/POZ domain-containing family protein           333   7e-108   
ref|XP_009789089.1|  PREDICTED: BTB/POZ domain-containing protein...    334   8e-108   Nicotiana sylvestris
gb|KHG04846.1|  BTB/POZ domain-containing POB1 -like protein            333   1e-107   Gossypium arboreum [tree cotton]
ref|XP_007051653.1|  POZ/BTB containin G-protein 1 isoform 6            332   1e-107   
ref|XP_011037494.1|  PREDICTED: BTB/POZ domain-containing protein...    333   2e-107   Populus euphratica
gb|KDO86370.1|  hypothetical protein CISIN_1g008916mg                   332   2e-107   Citrus sinensis [apfelsine]
ref|XP_006444906.1|  hypothetical protein CICLE_v10019570mg             332   2e-107   
ref|XP_006444905.1|  hypothetical protein CICLE_v10019570mg             332   2e-107   Citrus clementina [clementine]
ref|XP_011093267.1|  PREDICTED: BTB/POZ domain-containing protein...    332   3e-107   Sesamum indicum [beniseed]
gb|KHN27269.1|  BTB/POZ domain-containing protein POB1                  330   3e-107   Glycine soja [wild soybean]
ref|XP_011093257.1|  PREDICTED: BTB/POZ domain-containing protein...    332   3e-107   
ref|XP_011468961.1|  PREDICTED: BTB/POZ domain-containing protein...    332   4e-107   Fragaria vesca subsp. vesca
ref|XP_008233229.1|  PREDICTED: BTB/POZ domain-containing protein...    332   4e-107   Prunus mume [ume]
ref|XP_007218966.1|  hypothetical protein PRUPE_ppa003673mg             332   5e-107   
gb|ACQ59090.1|  BTB/POZ protein                                         332   5e-107   Nicotiana benthamiana
gb|EYU40044.1|  hypothetical protein MIMGU_mgv1a004127mg                331   6e-107   Erythranthe guttata [common monkey flower]
ref|XP_002301391.1|  BTB/POZ domain-containing family protein           332   6e-107   
ref|XP_007135186.1|  hypothetical protein PHAVU_010G108200g             331   6e-107   Phaseolus vulgaris [French bean]
gb|EYU38917.1|  hypothetical protein MIMGU_mgv1a0037492mg               322   7e-107   Erythranthe guttata [common monkey flower]
gb|KJB22358.1|  hypothetical protein B456_004G043000                    328   8e-107   Gossypium raimondii
ref|XP_007051648.1|  POZ/BTB containin G-protein 1 isoform 1            331   8e-107   
ref|XP_003528818.1|  PREDICTED: BTB/POZ domain-containing protein...    331   9e-107   Glycine max [soybeans]
ref|XP_009104326.1|  PREDICTED: BTB/POZ domain-containing protein...    331   9e-107   Brassica rapa
gb|KHN15978.1|  BTB/POZ domain-containing protein POB1                  331   9e-107   Glycine soja [wild soybean]
ref|XP_009104323.1|  PREDICTED: BTB/POZ domain-containing protein...    331   1e-106   Brassica rapa
ref|XP_009104325.1|  PREDICTED: BTB/POZ domain-containing protein...    331   1e-106   Brassica rapa
ref|XP_003548592.1|  PREDICTED: BTB/POZ domain-containing protein...    331   1e-106   Glycine max [soybeans]
ref|XP_009377240.1|  PREDICTED: BTB/POZ domain-containing protein...    331   1e-106   Pyrus x bretschneideri [bai li]
ref|XP_008348526.1|  PREDICTED: BTB/POZ domain-containing protein...    331   1e-106   
emb|CDY52008.1|  BnaC06g42880D                                          331   1e-106   Brassica napus [oilseed rape]
ref|XP_009104327.1|  PREDICTED: BTB/POZ domain-containing protein...    330   1e-106   Brassica rapa
dbj|BAO57282.1|  POZ/BTB containing protein                             330   2e-106   Ipomoea nil [qian niu]
ref|XP_007135185.1|  hypothetical protein PHAVU_010G108100g             329   3e-106   Phaseolus vulgaris [French bean]
ref|XP_006402466.1|  hypothetical protein EUTSA_v10005840mg             331   3e-106   Eutrema salsugineum [saltwater cress]
ref|XP_006402465.1|  hypothetical protein EUTSA_v10005840mg             331   4e-106   Eutrema salsugineum [saltwater cress]
gb|KHG04418.1|  BTB/POZ domain-containing POB1 -like protein            329   5e-106   Gossypium arboreum [tree cotton]
ref|XP_008357345.1|  PREDICTED: BTB/POZ domain-containing protein...    328   7e-106   
ref|XP_003637208.1|  Kelch-like protein                                 328   7e-106   
dbj|BAD94357.1|  hypothetical protein                                   320   8e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KEH18742.1|  BTB/POZ domain protein POB1                             328   8e-106   Medicago truncatula
gb|AGV54323.1|  BTB/POZ domain-containing protein POB1-like protein     328   9e-106   Phaseolus vulgaris [French bean]
emb|CDP08731.1|  unnamed protein product                                328   9e-106   Coffea canephora [robusta coffee]
ref|XP_006290834.1|  hypothetical protein CARUB_v10016944mg             328   1e-105   Capsella rubella
ref|XP_011023241.1|  PREDICTED: BTB/POZ domain-containing protein...    328   1e-105   Populus euphratica
ref|XP_010469102.1|  PREDICTED: BTB/POZ domain-containing protein...    326   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_003637209.1|  Kelch-like protein                                 328   2e-105   
gb|KDP28535.1|  hypothetical protein JCGZ_14306                         327   2e-105   Jatropha curcas
gb|KJB22357.1|  hypothetical protein B456_004G043000                    327   2e-105   Gossypium raimondii
ref|XP_004510713.1|  PREDICTED: BTB/POZ domain-containing protein...    327   3e-105   Cicer arietinum [garbanzo]
ref|XP_010512512.1|  PREDICTED: BTB/POZ domain-containing protein...    327   4e-105   Camelina sativa [gold-of-pleasure]
emb|CAB71090.1|  putative protein                                       326   4e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876624.1|  BTB/POZ domain-containing protein                  327   5e-105   
ref|NP_850733.1|  POZ/BTB containin G-protein 1                         327   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567115.1|  POZ/BTB containin G-protein 1                         327   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413379.1|  PREDICTED: BTB/POZ domain-containing protein...    327   6e-105   Camelina sativa [gold-of-pleasure]
gb|KFK35342.1|  hypothetical protein AALP_AA5G272300                    326   1e-104   Arabis alpina [alpine rockcress]
ref|XP_009772583.1|  PREDICTED: BTB/POZ domain-containing protein...    325   1e-104   Nicotiana sylvestris
gb|KFK35343.1|  hypothetical protein AALP_AA5G272300                    325   1e-104   Arabis alpina [alpine rockcress]
ref|XP_010469101.1|  PREDICTED: BTB/POZ domain-containing protein...    326   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010469099.1|  PREDICTED: BTB/POZ domain-containing protein...    326   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010669540.1|  PREDICTED: BTB/POZ domain-containing protein...    325   1e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009614366.1|  PREDICTED: BTB/POZ domain-containing protein...    325   2e-104   Nicotiana tomentosiformis
ref|XP_009614365.1|  PREDICTED: BTB/POZ domain-containing protein...    325   2e-104   Nicotiana tomentosiformis
gb|AFK39130.1|  unknown                                                 325   2e-104   Lotus japonicus
ref|XP_004248069.1|  PREDICTED: BTB/POZ domain-containing protein...    324   3e-104   Solanum lycopersicum
ref|XP_010326992.1|  PREDICTED: BTB/POZ domain-containing protein...    324   6e-104   Solanum lycopersicum
ref|XP_003554745.1|  PREDICTED: BTB/POZ domain-containing protein...    323   6e-104   Glycine max [soybeans]
ref|XP_010326766.1|  PREDICTED: BTB/POZ domain-containing protein...    323   7e-104   
emb|CDX95684.1|  BnaC03g25650D                                          323   1e-103   
ref|XP_010326760.1|  PREDICTED: BTB/POZ domain-containing protein...    323   1e-103   Solanum lycopersicum
gb|AAM61110.1|  unknown                                                 322   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006339663.1|  PREDICTED: BTB/POZ domain-containing protein...    323   1e-103   Solanum tuberosum [potatoes]
ref|NP_566069.1|  protein LIGHT-RESPONSE BTB 1                          323   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133768.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-103   Brassica rapa
ref|XP_006358650.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-103   Solanum tuberosum [potatoes]
emb|CDX83375.1|  BnaA03g21310D                                          322   3e-103   
ref|XP_003521793.1|  PREDICTED: BTB/POZ domain-containing protein...    322   3e-103   Glycine max [soybeans]
ref|XP_007147261.1|  hypothetical protein PHAVU_006G109600g             322   4e-103   Phaseolus vulgaris [French bean]
ref|XP_006293933.1|  hypothetical protein CARUB_v10022924mg             318   4e-103   
ref|XP_004138466.1|  PREDICTED: BTB/POZ domain-containing protein...    321   4e-103   Cucumis sativus [cucumbers]
gb|KJB39679.1|  hypothetical protein B456_007G025100                    322   5e-103   Gossypium raimondii
ref|XP_004138465.1|  PREDICTED: BTB/POZ domain-containing protein...    321   5e-103   
ref|XP_008458155.1|  PREDICTED: BTB/POZ domain-containing protein...    321   6e-103   Cucumis melo [Oriental melon]
gb|KHN35353.1|  BTB/POZ domain-containing protein POB1                  320   1e-102   Glycine soja [wild soybean]
ref|XP_009617879.1|  PREDICTED: BTB/POZ domain-containing protein...    319   3e-102   Nicotiana tomentosiformis
ref|XP_010676365.1|  PREDICTED: BTB/POZ domain-containing protein...    319   3e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010522934.1|  PREDICTED: BTB/POZ domain-containing protein...    319   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_010522935.1|  PREDICTED: BTB/POZ domain-containing protein...    318   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_010522933.1|  PREDICTED: BTB/POZ domain-containing protein...    318   5e-102   Tarenaya hassleriana [spider flower]
ref|XP_011022567.1|  PREDICTED: BTB/POZ domain-containing protein...    319   6e-102   Populus euphratica
ref|XP_006293934.1|  hypothetical protein CARUB_v10022924mg             318   7e-102   Capsella rubella
ref|XP_010914379.1|  PREDICTED: BTB/POZ domain-containing protein...    317   2e-101   Elaeis guineensis
ref|XP_002880228.1|  BTB/POZ domain-containing protein                  317   2e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_002303620.1|  hypothetical protein POPTR_0003s13510g             317   3e-101   Populus trichocarpa [western balsam poplar]
ref|XP_006360698.1|  PREDICTED: BTB/POZ domain-containing protein...    316   4e-101   
gb|KHG30067.1|  BTB/POZ domain-containing POB1 -like protein            317   4e-101   Gossypium arboreum [tree cotton]
gb|EYU32197.1|  hypothetical protein MIMGU_mgv1a003926mg                316   4e-101   Erythranthe guttata [common monkey flower]
ref|XP_004494778.1|  PREDICTED: BTB/POZ domain-containing protein...    315   8e-101   Cicer arietinum [garbanzo]
ref|XP_010518296.1|  PREDICTED: BTB/POZ domain-containing protein...    315   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009772687.1|  PREDICTED: BTB/POZ domain-containing protein...    315   2e-100   Nicotiana sylvestris
emb|CDX71727.1|  BnaC08g31470D                                          315   2e-100   
ref|XP_006842894.1|  hypothetical protein AMTR_s00075p00054260          305   3e-100   
ref|XP_009410864.1|  PREDICTED: BTB/POZ domain-containing protein...    313   4e-100   
ref|XP_006397812.1|  hypothetical protein EUTSA_v10001385mg             313   4e-100   
ref|XP_006397813.1|  hypothetical protein EUTSA_v10001385mg             313   6e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009410863.1|  PREDICTED: BTB/POZ domain-containing protein...    313   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011093067.1|  PREDICTED: BTB/POZ domain-containing protein...    311   7e-100   Sesamum indicum [beniseed]
ref|XP_010925791.1|  PREDICTED: BTB/POZ domain-containing protein...    311   1e-99    Elaeis guineensis
ref|XP_010506624.1|  PREDICTED: BTB/POZ domain-containing protein...    313   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010506625.1|  PREDICTED: BTB/POZ domain-containing protein...    312   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010092900.1|  BTB/POZ domain-containing protein                  311   3e-99    Morus notabilis
ref|XP_011093066.1|  PREDICTED: BTB/POZ domain-containing protein...    311   3e-99    Sesamum indicum [beniseed]
ref|XP_010925790.1|  PREDICTED: BTB/POZ domain-containing protein...    311   4e-99    Elaeis guineensis
ref|XP_002299499.2|  hypothetical protein POPTR_0001s10190g             311   6e-99    
ref|XP_011093065.1|  PREDICTED: BTB/POZ domain-containing protein...    311   6e-99    Sesamum indicum [beniseed]
ref|XP_010508047.1|  PREDICTED: BTB/POZ domain-containing protein...    310   9e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011026946.1|  PREDICTED: BTB/POZ domain-containing protein...    308   2e-98    Populus euphratica
ref|XP_008798670.1|  PREDICTED: BTB/POZ domain-containing protein...    309   2e-98    Phoenix dactylifera
ref|XP_008238990.1|  PREDICTED: BTB/POZ domain-containing protein...    308   6e-98    Prunus mume [ume]
ref|XP_009142670.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    308   9e-98    Brassica rapa
ref|XP_011026945.1|  PREDICTED: BTB/POZ domain-containing protein...    307   2e-97    Populus euphratica
ref|XP_006343902.1|  PREDICTED: BTB/POZ domain-containing protein...    306   3e-97    Solanum tuberosum [potatoes]
ref|XP_009789894.1|  PREDICTED: BTB/POZ domain-containing protein...    306   7e-97    Nicotiana sylvestris
ref|XP_009380541.1|  PREDICTED: BTB/POZ domain-containing protein...    304   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380540.1|  PREDICTED: BTB/POZ domain-containing protein...    304   2e-96    
ref|XP_007209857.1|  hypothetical protein PRUPE_ppa003692mg             304   3e-96    Prunus persica
ref|XP_009380539.1|  PREDICTED: BTB/POZ domain-containing protein...    304   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793877.1|  PREDICTED: BTB/POZ domain-containing protein...    303   5e-96    Phoenix dactylifera
ref|XP_009380538.1|  PREDICTED: BTB/POZ domain-containing protein...    304   5e-96    
ref|XP_011463940.1|  PREDICTED: BTB/POZ domain-containing protein...    301   4e-95    Fragaria vesca subsp. vesca
ref|XP_004298859.1|  PREDICTED: BTB/POZ domain-containing protein...    300   5e-95    Fragaria vesca subsp. vesca
ref|XP_010915728.1|  PREDICTED: BTB/POZ domain-containing protein...    300   8e-95    Elaeis guineensis
ref|XP_009116827.1|  PREDICTED: BTB/POZ domain-containing protein...    299   1e-94    Brassica rapa
dbj|BAK01214.1|  predicted protein                                      293   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92080.1|  predicted protein                                      290   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001142262.1|  uncharacterized protein LOC100274431               298   5e-94    Zea mays [maize]
emb|CDY11366.1|  BnaA09g39320D                                          298   5e-94    Brassica napus [oilseed rape]
ref|XP_009419784.1|  PREDICTED: BTB/POZ domain-containing protein...    298   7e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419783.1|  PREDICTED: BTB/POZ domain-containing protein...    298   8e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794992.1|  PREDICTED: BTB/POZ domain-containing protein...    298   9e-94    Phoenix dactylifera
ref|XP_008794993.1|  PREDICTED: BTB/POZ domain-containing protein...    297   1e-93    
gb|EMS60606.1|  BTB/POZ domain-containing protein POB1                  293   2e-93    Triticum urartu
ref|XP_008677104.1|  PREDICTED: uncharacterized protein LOC100279...    295   2e-93    Zea mays [maize]
gb|EPS73437.1|  hypothetical protein M569_01319                         294   3e-93    Genlisea aurea
ref|XP_002451902.1|  hypothetical protein SORBIDRAFT_04g009720          295   3e-93    Sorghum bicolor [broomcorn]
gb|AFW65829.1|  hypothetical protein ZEAMMB73_711899                    295   5e-93    
ref|XP_003563816.1|  PREDICTED: BTB/POZ domain-containing protein...    295   8e-93    Brachypodium distachyon [annual false brome]
ref|NP_001057726.2|  Os06g0507400                                       294   1e-92    
ref|XP_004951268.1|  PREDICTED: BTB/POZ domain-containing protein...    294   1e-92    Setaria italica
ref|NP_001146028.1|  hypothetical protein                               294   1e-92    Zea mays [maize]
ref|XP_003572201.1|  PREDICTED: BTB/POZ domain-containing protein...    294   1e-92    Brachypodium distachyon [annual false brome]
ref|XP_004951269.1|  PREDICTED: BTB/POZ domain-containing protein...    294   1e-92    Setaria italica
dbj|BAJ95490.1|  predicted protein                                      293   2e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC72875.1|  hypothetical protein OsI_06647                          293   4e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_008392473.1|  PREDICTED: BTB/POZ domain-containing protein...    293   4e-92    Malus domestica [apple tree]
gb|EMT31790.1|  Kelch-like protein 26                                   292   7e-92    
dbj|BAJ93322.1|  predicted protein                                      292   9e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001046484.1|  Os02g0260700                                       292   1e-91    
gb|ABR16891.1|  unknown                                                 288   2e-91    Picea sitchensis
ref|XP_006656117.1|  PREDICTED: BTB/POZ domain-containing protein...    291   2e-91    
ref|XP_006648521.1|  PREDICTED: BTB/POZ domain-containing protein...    289   3e-91    Oryza brachyantha
gb|EMT31791.1|  hypothetical protein F775_32011                         294   3e-91    
ref|XP_004965490.1|  PREDICTED: BTB/POZ domain-containing protein...    290   3e-91    Setaria italica
ref|XP_004965489.1|  PREDICTED: BTB/POZ domain-containing protein...    290   4e-91    Setaria italica
gb|AAT40121.1|  GAMYB-binding protein                                   291   5e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002438463.1|  hypothetical protein SORBIDRAFT_10g020060          290   5e-91    Sorghum bicolor [broomcorn]
emb|CDP12109.1|  unnamed protein product                                296   1e-90    Coffea canephora [robusta coffee]
gb|ABK24446.1|  unknown                                                 288   6e-90    Picea sitchensis
gb|EPS68073.1|  hypothetical protein M569_06692                         288   8e-90    Genlisea aurea
gb|KHN35061.1|  BTB/POZ domain-containing protein POB1                  282   5e-89    Glycine soja [wild soybean]
ref|XP_006590500.1|  PREDICTED: BTB/POZ domain-containing protein...    282   2e-88    Glycine max [soybeans]
ref|NP_001148937.1|  GAMYB-binding protein                              283   2e-88    Zea mays [maize]
gb|ACN26008.1|  unknown                                                 283   3e-88    Zea mays [maize]
gb|AIB05667.1|  TRAF transcription factor                               283   3e-88    Zea mays [maize]
emb|CAD23158.1|  hypothetical protein                                   266   2e-86    Oryza sativa [red rice]
gb|EPS71516.1|  hypothetical protein M569_03239                         276   1e-85    Genlisea aurea
ref|XP_010314497.1|  PREDICTED: BTB/POZ domain-containing protein...    261   9e-80    Solanum lycopersicum
ref|XP_004252576.1|  PREDICTED: BTB/POZ domain-containing protein...    261   1e-79    Solanum lycopersicum
ref|XP_010314496.1|  PREDICTED: BTB/POZ domain-containing protein...    261   1e-79    Solanum lycopersicum
ref|XP_002983257.1|  ubiquitin-protein ligase, POB1                     258   1e-78    
ref|XP_002961299.1|  ubiquitin-protein ligase, POB1                     258   1e-78    
emb|CDY42028.1|  BnaC04g01060D                                          256   3e-78    Brassica napus [oilseed rape]
emb|CDX80003.1|  BnaA05g01530D                                          256   4e-78    
ref|XP_001771535.1|  predicted protein                                  255   1e-77    
ref|XP_001760430.1|  predicted protein                                  254   2e-77    
gb|AAO25541.1|  GAMYB-binding protein                                   245   3e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB52236.1|  hypothetical protein B456_008G251700                    240   4e-72    Gossypium raimondii
gb|ADG38648.1|  AT3G61600-like protein                                  226   1e-70    Capsella grandiflora
gb|AEN82266.1|  AT3G61600-like protein                                  226   1e-70    Capsella rubella
gb|ADG38647.1|  AT3G61600-like protein                                  225   2e-70    Capsella grandiflora
gb|ADG38652.1|  AT3G61600-like protein                                  224   6e-70    Neslia paniculata [ball mustard]
ref|NP_192025.2|  BTB/POZ/Kelch-associated protein                      229   3e-68    Arabidopsis thaliana [mouse-ear cress]
sp|O04615.1|Y4116_ARATH  RecName: Full=BTB/POZ domain-containing ...    230   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872906.1|  A_IG002N01.11 protein                              229   8e-68    
ref|XP_007158553.1|  hypothetical protein PHAVU_002G162000g             228   1e-67    Phaseolus vulgaris [French bean]
ref|XP_006343901.1|  PREDICTED: BTB/POZ domain-containing protein...    221   7e-65    
gb|AFK44513.1|  unknown                                                 211   1e-64    Lotus japonicus
ref|XP_006396293.1|  hypothetical protein EUTSA_v10028626mg             218   5e-64    
ref|XP_006344016.1|  PREDICTED: BTB/POZ domain-containing protein...    217   7e-64    Solanum tuberosum [potatoes]
gb|AFK40268.1|  unknown                                                 207   4e-63    Lotus japonicus
emb|CDX91882.1|  BnaC03g31840D                                          215   6e-63    
ref|XP_010456218.1|  PREDICTED: BTB/POZ domain-containing protein...    216   6e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010466718.1|  PREDICTED: BTB/POZ domain-containing protein...    214   4e-62    Camelina sativa [gold-of-pleasure]
gb|AFK33622.1|  unknown                                                 208   7e-61    Lotus japonicus
ref|XP_009134517.1|  PREDICTED: BTB/POZ domain-containing protein...    210   7e-61    Brassica rapa
emb|CDX74359.1|  BnaA03g26880D                                          209   7e-61    
ref|XP_006289543.1|  hypothetical protein CARUB_v10003087mg             209   4e-60    
ref|XP_011081133.1|  PREDICTED: BTB/POZ domain-containing protein...    203   1e-58    
ref|XP_006830391.1|  hypothetical protein AMTR_s00116p00144040          181   4e-52    
gb|KFK30702.1|  hypothetical protein AALP_AA6G016600                    179   6e-49    Arabis alpina [alpine rockcress]
gb|KFK30704.1|  hypothetical protein AALP_AA6G016900                    174   3e-47    Arabis alpina [alpine rockcress]
ref|XP_006657001.1|  PREDICTED: BTB/POZ domain-containing protein...    160   7e-45    Oryza brachyantha
gb|EMT11867.1|  Kelch-like protein 17                                   167   7e-45    
emb|CDM81892.1|  unnamed protein product                                159   2e-42    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001057725.1|  Os06g0507300                                       153   5e-42    
gb|AEW08883.1|  hypothetical protein CL2108Contig1_02                   149   6e-42    Pinus radiata
gb|EMT12351.1|  Kelch-like ECH-associated protein 1                     155   2e-40    
gb|EMT27655.1|  Kelch repeat and BTB domain-containing protein 8        155   2e-39    
gb|EMT15015.1|  Kelch-like protein 10                                   150   7e-39    
ref|XP_006830377.1|  hypothetical protein AMTR_s00116p00130490          143   1e-37    
emb|CBI34431.3|  unnamed protein product                                148   1e-37    Vitis vinifera
gb|EMS51786.1|  BTB/POZ domain-containing protein POB1                  148   1e-37    Triticum urartu
emb|CBI25638.3|  unnamed protein product                                139   4e-37    Vitis vinifera
ref|XP_010240164.1|  PREDICTED: BTB/POZ domain-containing protein...    145   4e-37    
gb|EMS63662.1|  hypothetical protein TRIUR3_11934                       142   4e-37    Triticum urartu
ref|XP_003559205.2|  PREDICTED: BTB/POZ domain-containing protein...    146   5e-37    Brachypodium distachyon [annual false brome]
gb|EMT00090.1|  Kelch-like protein 10                                   144   7e-37    
gb|AEW08881.1|  hypothetical protein CL2108Contig1_01                   135   1e-36    Pinus radiata
ref|XP_006830375.1|  hypothetical protein AMTR_s00116p00129050          141   1e-36    
gb|AEW08882.1|  hypothetical protein CL2108Contig1_01                   134   2e-36    
ref|XP_003576856.1|  PREDICTED: BTB/POZ domain-containing protein...    144   2e-36    
gb|KFK40746.1|  hypothetical protein AALP_AA2G035800                    141   4e-35    
ref|XP_006830379.1|  hypothetical protein AMTR_s00116p00131680          136   4e-35    
gb|KFK40747.1|  hypothetical protein AALP_AA2G035800                    141   4e-35    
dbj|BAK07029.1|  predicted protein                                      139   2e-34    
gb|KEH31004.1|  BTB/POZ domain protein                                  136   5e-34    
ref|XP_006830368.1|  hypothetical protein AMTR_s00116p00105540          132   5e-33    
gb|EMS63660.1|  hypothetical protein TRIUR3_11932                       134   7e-33    
gb|EMT24877.1|  Kelch repeat and BTB domain-containing protein 8        132   4e-32    
ref|XP_010239967.1|  PREDICTED: BTB/POZ domain-containing protein...    129   3e-31    
ref|XP_010239944.1|  PREDICTED: BTB/POZ domain-containing protein...    129   3e-31    
ref|XP_010239873.1|  PREDICTED: BTB/POZ domain-containing protein...    129   5e-31    
ref|XP_006854528.1|  hypothetical protein AMTR_s00030p00030100          119   2e-28    
ref|XP_006844531.1|  hypothetical protein AMTR_s00016p00163270          114   1e-27    
gb|EMT00482.1|  hypothetical protein F775_17303                         118   1e-27    
gb|EMT11871.1|  Kelch-like protein 17                                   116   2e-26    
gb|KFK30703.1|  hypothetical protein AALP_AA6G016700                    105   6e-25    
ref|XP_003559206.1|  PREDICTED: BTB/POZ domain-containing protein...    111   9e-25    
gb|EMS61484.1|  BTB/POZ domain-containing protein POB1                98.6    1e-20    
ref|XP_006830369.1|  hypothetical protein AMTR_s00116p00111830        95.9    3e-20    
gb|EMT13051.1|  Kelch-like protein 7                                  96.7    1e-19    
ref|XP_006830384.1|  hypothetical protein AMTR_s00116p00138800        94.4    2e-19    
gb|EMT13053.1|  Kelch-like protein 7                                  84.7    1e-15    
gb|EMT15016.1|  BTB and MATH domain-containing protein 43             81.6    6e-15    
ref|XP_002509901.1|  atpob1, putative                                 83.2    1e-14    
gb|EMT13052.1|  Kelch-like protein 7                                  80.9    3e-14    
gb|EMT07019.1|  Kelch-like protein 17                                 80.1    4e-14    
gb|EMT08009.1|  Kelch domain-containing protein 6                     78.2    3e-13    
gb|EMT15014.1|  hypothetical protein F775_21274                       74.3    2e-12    
gb|AEW08884.1|  hypothetical protein CL2108Contig1_03                 68.9    4e-12    
gb|ABQ65191.1|  putative protein                                      68.9    4e-12    
ref|XP_008798396.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    6e-12    
ref|XP_006854779.1|  hypothetical protein AMTR_s00063p00125100        71.2    7e-12    
ref|XP_008798400.1|  PREDICTED: BTB/POZ domain-containing protein...  73.2    2e-11    
gb|EMS45083.1|  BTB/POZ domain-containing protein POB1                72.8    2e-11    
ref|XP_008810439.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    9e-11    
ref|XP_006830366.1|  hypothetical protein AMTR_s00116p00102270        61.6    3e-08    
emb|CBI29690.3|  unnamed protein product                              62.0    8e-08    
ref|XP_010908519.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07    
gb|EMS49907.1|  BTB/POZ domain-containing protein POB1                59.3    6e-07    
gb|EMT11872.1|  hypothetical protein F775_22536                       53.5    7e-06    
ref|XP_003559201.2|  PREDICTED: BTB/POZ domain-containing protein...  51.2    3e-04    



>emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera]
Length=526

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+EA+ S+RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  350  FKAEAPYRQRSLAAEEASSSYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  409

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  410  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  469

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGI W AF+ DDSHYF+NGILHLRAELTIR
Sbjct  470  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIAWXAFMADDSHYFINGILHLRAELTIR  525



>ref|XP_010658715.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis 
vinifera]
Length=562

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+EA+ S+RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  386  FKAEAPYRQRSLAAEEASSSYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  446  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  505

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGI W AF+ DDSHYF+NGILHLRAELTIR
Sbjct  506  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIAWNAFMADDSHYFINGILHLRAELTIR  561



>gb|KDO76413.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=413

 Score =   342 bits (877),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  237  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  296

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  297  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  356

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  357  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  412



>ref|XP_010261456.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Nelumbo nucifera]
 ref|XP_010261457.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Nelumbo nucifera]
Length=433

 Score =   341 bits (874),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  257  FKAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  316

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  317  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  376

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLF IPWTAFV +DS YF+NGILHLRAELTI+
Sbjct  377  PTEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIK  432



>ref|XP_007040414.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
 gb|EOY24915.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
Length=461

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+ AA+EAN  +RRFVERAYKYRPVKVVEFE+PR QC+VYLDLKREEC++L
Sbjct  285  FKAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHL  344

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  345  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  404

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  405  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIR  460



>ref|XP_007040413.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
 gb|EOY24914.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
Length=460

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+ AA+EAN  +RRFVERAYKYRPVKVVEFE+PR QC+VYLDLKREEC++L
Sbjct  284  FKAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHL  343

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  344  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  403

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  404  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIR  459



>ref|XP_006439420.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|ESR52660.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|KDO76411.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=478

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  302  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  361

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  362  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  421

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  422  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  477



>gb|KDO76412.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=505

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  329  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  388

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  389  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  448

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  449  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  504



>ref|XP_007040415.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
 gb|EOY24916.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
Length=473

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+ AA+EAN  +RRFVERAYKYRPVKVVEFE+PR QC+VYLDLKREEC++L
Sbjct  297  FKAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHL  356

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  357  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  416

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  417  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIR  472



>ref|XP_009626291.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=561

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+E + S  RFVER YKYRP KVVEFELPR QCIVYLDLKREEC NL
Sbjct  385  FKAEAPYRQRSLAAEEGSASHHRFVERVYKYRPAKVVEFELPRQQCIVYLDLKREECNNL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  445  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFV +DS YF+NGILHLRAELTIR
Sbjct  505  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVAEDSVYFINGILHLRAELTIR  560



>gb|KDO76410.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=554

 Score =   342 bits (878),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  378  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  437

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  438  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  497

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  498  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  553



>ref|XP_006476450.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
Length=555

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  379  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  439  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  499  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  554



>ref|XP_006439421.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|ESR52661.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|KDO76408.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=555

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  379  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  439  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  499  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  554



>gb|KDP25348.1| hypothetical protein JCGZ_20504 [Jatropha curcas]
Length=563

 Score =   342 bits (877),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK E PYRQR LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  387  FKGETPYRQRILAAEEANSAYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  446

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  447  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  506

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  507  PSEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSLYFINGILHLRAELTIR  562



>ref|XP_010261454.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=539

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  363  FKAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  422

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  423  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  482

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLF IPWTAFV +DS YF+NGILHLRAELTI+
Sbjct  483  PTEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIK  538



>ref|XP_010261455.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=537

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  361  FKAEAPHRQRSLAAEESTAVSRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  420

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  421  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  480

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLF IPWTAFV +DS YF+NGILHLRAELTI+
Sbjct  481  PTEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTAFVAEDSLYFINGILHLRAELTIK  536



>gb|KDO76409.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=582

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  406  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  465

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  466  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  525

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  526  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  581



>ref|XP_007040412.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOY24913.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=564

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+ AA+EAN  +RRFVERAYKYRPVKVVEFE+PR QC+VYLDLKREEC++L
Sbjct  388  FKAETPYRQRAHAAEEANAPYRRFVERAYKYRPVKVVEFEMPRQQCVVYLDLKREECVHL  447

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  448  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  507

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  508  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGILHLRAELTIR  563



>gb|KDO76407.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=583

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  407  FKAETPYRQRALAAEEANSTYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECAHL  466

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  467  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARIK  526

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NG LHLRAELTIR
Sbjct  527  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMADDSIYFINGNLHLRAELTIR  582



>gb|KCW78131.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=492

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E   S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  316  FKAEAPHRQRTLAAEECTTSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNL  375

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  376  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  435

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT F+ +DSHYF+NGILHLRAELTIR
Sbjct  436  PTEEYISKYKGNYTFTGGKAVGYRNLFAIPWTNFMAEDSHYFINGILHLRAELTIR  491



>gb|KJB52233.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
 gb|KJB52234.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=562

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK+E P+RQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  386  FKSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQE+GSV+FAVDYEFAAR+K
Sbjct  446  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSK  505

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  506  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDSIYFINGILHLRAELTIR  561



>emb|CBI40464.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   338 bits (867),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+++ ++ RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  325  FKAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINL  384

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSS HCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  385  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSK  444

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NGILHLRAELTIR
Sbjct  445  PTEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIR  500



>gb|KJB52235.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=574

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK+E P+RQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  398  FKSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHL  457

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQE+GSV+FAVDYEFAAR+K
Sbjct  458  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSK  517

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DDS YF+NGILHLRAELTIR
Sbjct  518  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDSIYFINGILHLRAELTIR  573



>ref|XP_011073542.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Sesamum 
indicum]
Length=546

 Score =   339 bits (870),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSL A+EAN SFRRFVERAYKYRPVKVVEFE PR QCIVYLDL+REEC  L
Sbjct  370  FKAEAPYRQRSLVAEEANASFRRFVERAYKYRPVKVVEFESPRQQCIVYLDLRREECAQL  429

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLS HCNMDQQSSFHCFGLFLGMQEKGSV+F VDYEFA+RTK
Sbjct  430  FPAGRVYSQAFHLGGQGFFLSGHCNMDQQSSFHCFGLFLGMQEKGSVAFTVDYEFASRTK  489

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+E++VSKYKGNYTFTGGKAVGYRNLFG+PWTAF+ DDS YF+NGILHLRAELTI+
Sbjct  490  PSEDFVSKYKGNYTFTGGKAVGYRNLFGVPWTAFIADDSPYFINGILHLRAELTIK  545



>gb|KDO86374.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=380

 Score =   333 bits (854),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  204  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  263

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  264  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  323

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  324  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  379



>ref|XP_010053775.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW78130.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=547

 Score =   338 bits (868),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E   S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  371  FKAEAPHRQRTLAAEECTTSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNL  430

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  431  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  490

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT F+ +DSHYF+NGILHLRAELTIR
Sbjct  491  PTEEYISKYKGNYTFTGGKAVGYRNLFAIPWTNFMAEDSHYFINGILHLRAELTIR  546



>gb|KDO86375.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=359

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  183  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  242

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  243  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  302

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  303  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  358



>ref|XP_010661871.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Vitis vinifera]
Length=551

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+++ ++ RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  375  FKAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSS HCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSK  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NGILHLRAELTIR
Sbjct  495  PTEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIR  550



>ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Vitis vinifera]
Length=553

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+++ ++ RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  377  FKAEAPHRQRSLAAEDSALTNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECINL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSS HCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSIHCFGLFLGMQEKGSVTFAVDYEFAARSK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NGILHLRAELTIR
Sbjct  497  PTEEYISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIR  552



>ref|XP_010251562.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=553

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+  +  RF+ERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  377  FKAEAPHRQRSLAAEESAATNHRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NGILHLRAELTI+
Sbjct  497  PTEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIK  552



>ref|XP_010251563.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+  +  RF+ERAYKYRPVKVVEFELPR QC+VYLDLKREECLNL
Sbjct  375  FKAEAPHRQRSLAAEESAATNHRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECLNL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEYVSKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NGILHLRAELTI+
Sbjct  495  PTEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIK  550



>ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao]
 gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao]
Length=380

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  204  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  263

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  264  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  323

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  324  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  379



>gb|KDO86372.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
 gb|KDO86373.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=413

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  237  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  296

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  297  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  356

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  357  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  412



>ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
 gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
Length=413

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  237  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  296

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  297  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  356

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  357  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  412



>ref|XP_010053177.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW77441.1| hypothetical protein EUGRSUZ_D01781 [Eucalyptus grandis]
Length=572

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+EAN   RRFVER YKYRPVKVVEFELPR QCIVYLDLKREEC +L
Sbjct  392  FKAEAPYRQRSLAAEEANGIHRRFVERTYKYRPVKVVEFELPRQQCIVYLDLKREECTHL  451

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  452  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARSK  511

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ DD  YF++GILHLRAELTIR
Sbjct  512  PSEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMSDDGPYFIDGILHLRAELTIR  567



>gb|KDO86371.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=449

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  273  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  332

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  333  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  392

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  393  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  448



>ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
 gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao]
Length=460

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  284  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  343

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  344  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  403

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  404  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  459



>ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana]
Length=558

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC NL
Sbjct  377  FKAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECTNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  497  PTEDFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSPYFINGILHLRAELTIK  552



>ref|XP_009789895.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=563

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+E + S   FVERAYKYRPVKVVEFELPR QCIVYLD KREEC +L
Sbjct  387  FKAEAPYRQRSLAAEEGSASHHCFVERAYKYRPVKVVEFELPRQQCIVYLDTKREECNSL  446

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  447  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  506

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ +DS YF+NGILHLRAELTIR
Sbjct  507  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMAEDSVYFINGILHLRAELTIR  562



>gb|KJB49507.1| hypothetical protein B456_008G122900 [Gossypium raimondii]
Length=552

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  376  FKAEAPHRQRSLAAEESATLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  551



>ref|XP_002511951.1| atpob1, putative [Ricinus communis]
 gb|EEF50620.1| atpob1, putative [Ricinus communis]
Length=549

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  373  FKAEAPHRQRSLAAEESASLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSFAVDYEFAAR K
Sbjct  433  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGNVSFAVDYEFAARAK  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NG+LHLRAELTIR
Sbjct  493  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIR  548



>ref|XP_009625070.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=552

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  S RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  376  FKAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  496  PAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  551



>ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
 gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
Length=468

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  292  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  351

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  352  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  411

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  412  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  467



>gb|KHG17323.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   334 bits (856),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  376  FKAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  551



>gb|ADN34171.1| ATPOB protein binding [Cucumis melo subsp. melo]
Length=552

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRF-VERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR LAADEA+ S RRF +ERAYKYRPVKVVEF+ PR QC+VYLDLKREEC N
Sbjct  375  FKAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECAN  434

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+
Sbjct  435  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARS  494

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DSHYF+NG+LHLRAELTIR
Sbjct  495  KPTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIR  551



>ref|XP_008437944.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=553

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRF-VERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR LAADEA+ S RRF +ERAYKYRPVKVVEF+ PR QC+VYLDLKREEC N
Sbjct  376  FKAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECAN  435

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+
Sbjct  436  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARS  495

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DSHYF+NG+LHLRAELTIR
Sbjct  496  KPTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIR  552



>ref|XP_009789090.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=552

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  S RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  376  FKAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRHQCIVYLDLKRDECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  496  PAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  551



>gb|KJB41445.1| hypothetical protein B456_007G104800 [Gossypium raimondii]
Length=552

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  376  FKAEAPHRQRSLAAEESASLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  551



>gb|KJB22359.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=382

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+APYRQRSLAA+E+  S  RFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  204  YKADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  263

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHC GLFLGMQEKGS SF VDYEFAAR K
Sbjct  264  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLK  323

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR*C  185
            PTEE+V KYKGNYTFTGGKAVGYRNLF +PWT+FV +DS YF+NG LHLRAELTIR C
Sbjct  324  PTEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIRLC  381



>ref|XP_009625060.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=559

 Score =   334 bits (856),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  S RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  383  FKAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANL  442

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  443  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  502

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  503  PAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  558



>ref|XP_004133826.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 ref|XP_004155851.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 gb|KGN56452.1| hypothetical protein Csa_3G119820 [Cucumis sativus]
Length=553

 Score =   334 bits (856),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 168/177 (95%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRF-VERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR LAADEA+ S RRF +ERAYKYRPVKVVEF+ PR QC+VYLDLKREEC N
Sbjct  376  FKAEAPHRQRILAADEASTSNRRFFIERAYKYRPVKVVEFDRPRQQCVVYLDLKREECAN  435

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+
Sbjct  436  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARS  495

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DSHYF+NG+LHLRAELTIR
Sbjct  496  KPTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSHYFINGVLHLRAELTIR  552



>ref|XP_002320175.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE98490.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=548

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK E P+RQR+LAA+E+  S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  372  FKGEPPHRQRTLAAEESATSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  432  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  492  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  547



>ref|XP_009789089.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=559

 Score =   334 bits (856),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  S RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  383  FKAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRHQCIVYLDLKRDECANL  442

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  443  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  502

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  503  PAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  558



>gb|KHG04846.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  376  FKAEAPHRQRSLAAEESATLNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHL GQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  436  FPSGRVYSQAFHLSGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  551



>ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
 gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
Length=525

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  349  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  408

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  409  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  468

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  469  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  524



>ref|XP_011037494.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK E P+RQR+LAA+E+  S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  377  FKGEPPHRQRTLAAEESAASNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  552



>gb|KDO86370.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=517

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  341  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  400

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  401  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  460

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  461  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  516



>ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|ESR58146.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
Length=550

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  374  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  494  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  549



>ref|XP_006444905.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 ref|XP_006491218.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
 gb|ESR58145.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|KDO86369.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=549

 Score =   332 bits (852),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+E+    RRFVERAYKYRPVKVVEFE PR QC+VYLDLKREEC NL
Sbjct  373  FKAEAPHRQRTLAAEESVTLNRRFVERAYKYRPVKVVEFERPRQQCVVYLDLKREECENL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  433  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS YF+NGILHLRAELTIR
Sbjct  493  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR  548



>ref|XP_011093267.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011093272.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=555

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRS A +E+  + RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  379  FKAEAPHRQRSHATEESTSTSRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  499  PTEEYISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINGILHLRAELTIK  554



>gb|KHN27269.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=502

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA++   S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  326  FKAEAPHRQRSLAAEDTASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNL  385

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  386  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  445

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI+
Sbjct  446  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIK  501



>ref|XP_011093257.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093262.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093265.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=562

 Score =   332 bits (852),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRS A +E+  + RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  386  FKAEAPHRQRSHATEESTSTSRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  446  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  505

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  506  PTEEYISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINGILHLRAELTIK  561



>ref|XP_011468961.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  382  FKAEAPHRQRILAAEESGTLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  441

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  442  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  501

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT F+ DDS YF+NG+LHLRAELTIR
Sbjct  502  PTEEFLSKYKGNYTFTGGKAVGYRNLFAIPWTNFMADDSLYFINGVLHLRAELTIR  557



>ref|XP_008233229.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Prunus mume]
Length=557

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  381  FKAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  500

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  501  PTEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  556



>ref|XP_007218966.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
 gb|EMJ20165.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
Length=557

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  381  FKAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  500

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  501  PTEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  556



>gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana]
Length=552

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  S RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  376  FKAEAPHRQRTQAAEESASSSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVD EFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDSEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  496  PAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  551



>gb|EYU40044.1| hypothetical protein MIMGU_mgv1a004127mg [Erythranthe guttata]
Length=543

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSL A+E   SFRRFVERAYKYRPVKVVEF+ PR QC+VYLDLKREEC+ L
Sbjct  367  FKAEAPYRQRSLVAEETKASFRRFVERAYKYRPVKVVEFDSPRQQCVVYLDLKREECVQL  426

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLS HCNMDQQSSFHCFG+FLGMQEKGSV+F VDYEFA+RT 
Sbjct  427  FPAGRVYSQAFHLGGQGFFLSGHCNMDQQSSFHCFGMFLGMQEKGSVAFTVDYEFASRTS  486

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+E++VSKYKGNYTFTGGKAVGYRNLFG PWTAF+ DDS YF+NG+LHLRAELTI+
Sbjct  487  PSEDFVSKYKGNYTFTGGKAVGYRNLFGTPWTAFIADDSPYFINGVLHLRAELTIK  542



>ref|XP_002301391.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE80664.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=556

 Score =   332 bits (850),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK E P+RQR+LAA+E+    RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  380  FKGEPPHRQRTLAAEESATLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  500  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSPYFINGVLHLRAELTIR  555



>ref|XP_007135186.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
 gb|ESW07180.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
Length=550

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+++  S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  374  FKAEAPHRQRALAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  494  PTEEFVSKYKGNYMFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  549



>gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partial [Erythranthe 
guttata]
Length=275

 Score =   322 bits (824),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR+ A D+++ S  RRFVERAYKYRPVKV+EF+LPR QC+VYLDLKREEC N
Sbjct  94   FKAEAPHRQRTQAIDDSSTSTSRRFVERAYKYRPVKVIEFDLPRQQCVVYLDLKREECSN  153

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            L+P+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+
Sbjct  154  LYPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARS  213

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KP EEY+SKYKGNYTFTGGKAVGYRNLF IPWT+FV +DS YF+NG+LHLRAELTI+
Sbjct  214  KPLEEYISKYKGNYTFTGGKAVGYRNLFNIPWTSFVAEDSLYFINGVLHLRAELTIK  270



>gb|KJB22358.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=453

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+APYRQRSLAA+E+  S  RFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  275  YKADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  334

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHC GLFLGMQEKGS SF VDYEFAAR K
Sbjct  335  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLK  394

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR*C  185
            PTEE+V KYKGNYTFTGGKAVGYRNLF +PWT+FV +DS YF+NG LHLRAELTIR C
Sbjct  395  PTEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIRLC  452



>ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=552

 Score =   331 bits (848),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLK+EEC NL
Sbjct  376  FKAEAPHRQRSLAVEESATMNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKKEECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS+SFAVDYEFAAR+K
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSLSFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NGILHLRAELTIR
Sbjct  496  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIR  551



>ref|XP_003528818.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=550

 Score =   331 bits (848),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA++   S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  374  FKAEAPHRQRSLAAEDTASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI+
Sbjct  494  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIK  549



>ref|XP_009104326.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Brassica rapa]
Length=559

 Score =   331 bits (849),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  379  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  499  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  554



>gb|KHN15978.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   331 bits (848),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+++  S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  377  FKAEAPHRQRSLAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI+
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIK  552



>ref|XP_009104323.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Brassica rapa]
 emb|CDY53909.1| BnaA07g38170D [Brassica napus]
Length=562

 Score =   331 bits (849),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  379  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  499  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  554



>ref|XP_009104325.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Brassica rapa]
Length=561

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  378  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  437

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  438  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  497

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  498  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  553



>ref|XP_003548592.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+++  S RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  377  FKAEAPHRQRSLAAEDSASSNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECNNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI+
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIK  552



>ref|XP_009377240.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Pyrus 
x bretschneideri]
Length=556

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  380  FKAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS +F+NG+LHLRAELTI+
Sbjct  500  PTEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIK  555



>ref|XP_008348526.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  380  FKAEAPHRQRILAAEESGTLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS +F+NG+LHLRAELTI+
Sbjct  500  PTEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSPFFINGVLHLRAELTIK  555



>emb|CDY52008.1| BnaC06g42880D [Brassica napus]
Length=562

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  379  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  499  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  554



>ref|XP_009104327.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X4 
[Brassica rapa]
Length=551

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  368  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  427

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  428  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  487

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  488  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  543



>dbj|BAO57282.1| POZ/BTB containing protein [Ipomoea nil]
Length=549

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+ +  + RRFVERAYKYRP+KVVEFE+PR QCIVYLDLKREEC NL
Sbjct  373  FKAEAPHRQRTQAAEGSTSASRRFVERAYKYRPIKVVEFEVPRQQCIVYLDLKREECANL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  433  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSVSFAVDYEFAARSK  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLFG+ WT+F+ DDS YF+NGILHLRAELTIR
Sbjct  493  PTEEYISKYKGNYTFTGGKAVGYRNLFGVQWTSFMADDSPYFINGILHLRAELTIR  548



>ref|XP_007135185.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
 gb|ESW07179.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
Length=551

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+++  S  RFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  375  FKAEAPHRQRALAAEDSASSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  495  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  550



>ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=613

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  432  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  491

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  492  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  551

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  552  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  607



>ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=603

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  422  FKAEAPHRQRSLAAEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  481

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  482  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  541

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  542  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIK  597



>gb|KHG04418.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG04419.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG30490.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=555

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+APYRQRSLAA+E+  S RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  377  YKADAPYRQRSLAAEESATSNRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSF+C GLFLGMQEKGS SFAVDYEFAAR K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFYCLGLFLGMQEKGSASFAVDYEFAARLK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR*C  185
            PTEE+V KYKGNYTFTGGKAVGYRNLF +PWT+FV +DS YF+NGILHLRAELTIR C
Sbjct  497  PTEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGILHLRAELTIRLC  554



>ref|XP_008357345.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   328 bits (842),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+    RRFVERAYKYRPVKVVEF+LPR QC+VYLDLKREEC NL
Sbjct  380  FKAEAPHRQRILAAEESATLNRRFVERAYKYRPVKVVEFDLPRQQCVVYLDLKREECANL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE++SKYKGNYTFTGGKAVGYRNLF IPWT+F  +DS +F+NG+LHLRAELTI+
Sbjct  500  PTEEFISKYKGNYTFTGGKAVGYRNLFAIPWTSFTAEDSPFFINGVLHLRAELTIK  555



>ref|XP_003637208.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18740.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=551

 Score =   328 bits (842),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  375  FKAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR++
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSR  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +D  YF+NG+LHLRAELTIR
Sbjct  495  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIR  550



>dbj|BAD94357.1| hypothetical protein [Arabidopsis thaliana]
Length=318

 Score =   320 bits (821),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  136  FKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  195

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  196  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDK  255

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             T EEYVSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  256  STKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  312



>gb|KEH18742.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=559

 Score =   328 bits (842),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  383  FKAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNL  442

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR++
Sbjct  443  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSR  502

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +D  YF+NG+LHLRAELTIR
Sbjct  503  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIR  558



>gb|AGV54323.1| BTB/POZ domain-containing protein POB1-like protein [Phaseolus 
vulgaris]
Length=550

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+LAA+++  S  RFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  374  FKAEAPHRQRALAAEDSASSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  494  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR  549



>emb|CDP08731.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR  AA+++  S RR+VERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  378  FKAEAPHRQRIQAAEDSTSSNRRYVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTNL  437

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEF+AR K
Sbjct  438  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFSARLK  497

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEEY+SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS YF+NGILHLRAELT+R
Sbjct  498  PTEEYMSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLYFINGILHLRAELTMR  553



>ref|XP_006290834.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
 gb|EOA23732.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
Length=562

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E     RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREECL L
Sbjct  382  FKAEAPHRQRSLAAEETASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGL  441

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  442  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  501

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  502  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIK  557



>ref|XP_011023241.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK E P+RQR+LAA+E+    RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  377  FKGEPPHRQRTLAAEESATLNRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSF+CFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFYCFGLFLGMQEKGSVSFAVDYEFAARSK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSPYFINGVLHLRAELTIR  552



>ref|XP_010469102.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Camelina sativa]
Length=516

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  336  FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  395

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  396  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  455

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  456  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIK  511



>ref|XP_003637209.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18741.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=591

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  415  FKAEVPHRQRSLAAEEPACSSRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECSNL  474

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR++
Sbjct  475  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSR  534

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +D  YF+NG+LHLRAELTIR
Sbjct  535  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIR  590



>gb|KDP28535.1| hypothetical protein JCGZ_14306 [Jatropha curcas]
Length=551

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LA +E+    RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  375  FKADAPHRQRTLATEESASLTRRFIERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG VSFAVDYEFAARTK
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVSFAVDYEFAARTK  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             TEE+VSKYKGNYTFTGGKAVGYRNLF +PWT+F+ DDS YF+NG+LHLRAELTIR
Sbjct  495  QTEEFVSKYKGNYTFTGGKAVGYRNLFALPWTSFMADDSLYFINGVLHLRAELTIR  550



>gb|KJB22357.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=555

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+APYRQRSLAA+E+  S  RFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC+NL
Sbjct  377  YKADAPYRQRSLAAEESATSNHRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECVNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHC GLFLGMQEKGS SF VDYEFAAR K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCLGLFLGMQEKGSTSFTVDYEFAARLK  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR*C  185
            PTEE+V KYKGNYTFTGGKAVGYRNLF +PWT+FV +DS YF+NG LHLRAELTIR C
Sbjct  497  PTEEFVCKYKGNYTFTGGKAVGYRNLFAVPWTSFVAEDSIYFINGTLHLRAELTIRLC  554



>ref|XP_004510713.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKREEC  L
Sbjct  375  FKAEVPHRQRSLAAEEPASSNRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKREECNTL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR++
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARSR  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +D  YF+NG+LHLRAELTIR
Sbjct  495  PTEEFVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDCLYFINGVLHLRAELTIR  550



>ref|XP_010512512.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Camelina 
sativa]
Length=568

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  388  FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  447

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  448  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  507

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  508  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIK  563



>emb|CAB71090.1| putative protein [Arabidopsis thaliana]
Length=545

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  365  FKAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGL  424

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  425  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  484

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  485  PAEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIK  540



>ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  382  FKAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGL  441

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  442  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  501

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  502  PAEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIK  557



>ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: 
Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 [Arabidopsis 
thaliana]
 gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  381  FKAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  500

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  501  PAEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIK  556



>ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 gb|AAG44951.1|AF292397_1 POZ/BTB containing-protein AtPOB1 [Arabidopsis thaliana]
 gb|ABO38760.1| At3g61600 [Arabidopsis thaliana]
 gb|AEE80230.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   327 bits (837),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  381  FKAEAPHRQRSLASEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECGGL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  500

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS YF+NGILHLRAELTI+
Sbjct  501  PAEDFISKYKGNYTFTGGKAVGYRNLFGVPWTSFIAEDSQYFINGILHLRAELTIK  556



>ref|XP_010413379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Camelina sativa]
Length=570

 Score =   327 bits (837),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  390  FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  449

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  450  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  509

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  510  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIAEDSQYFINGILHLRAELTIK  565



>gb|KFK35342.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=564

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC+ L
Sbjct  383  FKAEAPHRQRSLASEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECVGL  442

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  443  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  502

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE++ SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS  F+NGILHLRAELTI+
Sbjct  503  PTEDFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLCFINGILHLRAELTIK  558



>ref|XP_009772583.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=545

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQRS AA+E++   RRFVERAYKYRPVKVV+FE PR QC+VYLDLK+EEC NL
Sbjct  369  YKAEAPHRQRSQAAEESSSPSRRFVERAYKYRPVKVVDFEFPRQQCVVYLDLKQEECANL  428

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  429  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTK  488

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPW +F+ +DS YF+NG+LHLRAELTIR
Sbjct  489  PVEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIR  544



>gb|KFK35343.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=560

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA++E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC+ L
Sbjct  379  FKAEAPHRQRSLASEESASVNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECVGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE++ SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS  F+NGILHLRAELTI+
Sbjct  499  PTEDFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLCFINGILHLRAELTIK  554



>ref|XP_010469101.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Camelina sativa]
Length=565

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  385  FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  445  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  505  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIK  560



>ref|XP_010469099.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Camelina sativa]
Length=569

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  389  FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  448

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  449  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  508

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+++SKYKGNYTFTGGKAVGYRNLFGI WT+F+ +DS YF+NGILHLRAELTI+
Sbjct  509  PAEDFISKYKGNYTFTGGKAVGYRNLFGIAWTSFIVEDSQYFINGILHLRAELTIK  564



>ref|XP_010669540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=556

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E+  + RRF+ERAYKYRPVKVVEFELPR QC+VYLDLKR+EC NL
Sbjct  380  FKAEAPHRQRILAAEESASTNRRFLERAYKYRPVKVVEFELPRQQCVVYLDLKRDECANL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE++ SKYKGNYTF GGKAVGYRNLFGIPWT+F+ +DS YF++GILHLRAELTIR
Sbjct  500  PTEDFQSKYKGNYTFMGGKAVGYRNLFGIPWTSFMAEDSLYFIDGILHLRAELTIR  555



>ref|XP_009614366.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=539

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQR+ AA+E++   RRFVER+YKYRPVKVV+FELPR QC+VYLDLKREEC NL
Sbjct  363  YKAEAPHRQRNQAAEESSSPSRRFVERSYKYRPVKVVDFELPRQQCVVYLDLKREECANL  422

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  423  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARTK  482

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPW +F+ +DS YF+NG+LHLRAELTIR
Sbjct  483  PGEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIR  538



>ref|XP_009614365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=548

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQR+ AA+E++   RRFVER+YKYRPVKVV+FELPR QC+VYLDLKREEC NL
Sbjct  372  YKAEAPHRQRNQAAEESSSPSRRFVERSYKYRPVKVVDFELPRQQCVVYLDLKREECANL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  432  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVAFAVDYEFAARTK  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPW +F+ +DS YF+NG+LHLRAELTIR
Sbjct  492  PGEEYVSKYKGNYTFTGGKAVGYRNLFAIPWPSFIAEDSPYFINGMLHLRAELTIR  547



>gb|AFK39130.1| unknown [Lotus japonicus]
Length=556

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 165/176 (94%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA EA+ S R FVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  381  FKAEAPHRQRVLAA-EASSSNRLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  499

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNYTFTGGKAVG RNLF IPWT+F+ +DS YF+NG+LHLRAELTIR
Sbjct  500  PTEEFVSKYKGNYTFTGGKAVGCRNLFAIPWTSFLAEDSLYFINGVLHLRAELTIR  555



>ref|XP_004248069.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum lycopersicum]
Length=551

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  + RRFVERAYKYRPVKVVEFELPR QCIVYLDLKREEC NL
Sbjct  375  FKAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAART 
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTT  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+ G+LHLRAELTIR
Sbjct  495  LAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR  550



>ref|XP_010326992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum lycopersicum]
Length=558

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  + RRFVERAYKYRPVKVVEFELPR QCIVYLDLKREEC NL
Sbjct  382  FKAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANL  441

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAART 
Sbjct  442  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTT  501

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+ G+LHLRAELTIR
Sbjct  502  LAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR  557



>ref|XP_003554745.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
 gb|KHN43127.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ A+ + R FVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  378  FKAEAPHRQRILAAESASFN-RLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT F+ +DS YF+NG+LHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGVLHLRAELTIR  552



>ref|XP_010326766.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Solanum lycopersicum]
Length=552

 Score =   323 bits (829),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQRS AA++++ +  RFVERAYKYRPVKVV+F LPR QC+VYLDLKREEC NL
Sbjct  376  YKAEAPHRQRSQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF NG+LHLRAELTI+
Sbjct  496  PGEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  551



>emb|CDX95684.1| BnaC03g25650D [Brassica napus]
Length=539

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L+A+ ++ + RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  362  FKAEAPHRQRILSAEGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  421

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  422  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQK  481

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P+++Y SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI
Sbjct  482  PSQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYFINGVLHLRAELTI  536



>ref|XP_010326760.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=557

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQRS AA++++ +  RFVERAYKYRPVKVV+F LPR QC+VYLDLKREEC NL
Sbjct  381  YKAEAPHRQRSQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTK  500

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF NG+LHLRAELTI+
Sbjct  501  PGEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  556



>gb|AAM61110.1| unknown [Arabidopsis thaliana]
Length=546

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  364  FKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  423

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  424  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDK  483

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             T EEYVSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  484  STKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  540



>ref|XP_006339663.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=552

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAP+RQR+ AA++++ +  RFVERAYKYRPVKVV+F LPR QC+VYLDLKREEC NL
Sbjct  376  YKAEAPHRQRTQAAEDSSSTSHRFVERAYKYRPVKVVDFGLPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSV+FAVDYEFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVTFAVDYEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF NG+LHLRAELTI+
Sbjct  496  PGEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSPYFTNGMLHLRAELTIK  551



>ref|NP_566069.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
 sp|O82343.2|Y2626_ARATH RecName: Full=BTB/POZ domain-containing protein At2g46260 [Arabidopsis 
thaliana]
 gb|AAK76685.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85129.1| unknown protein [Arabidopsis thaliana]
 gb|AAC62880.2| expressed protein [Arabidopsis thaliana]
 gb|AEC10666.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
Length=561

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  379  FKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDK  498

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             T EEYVSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  499  STKEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQHFINGILHLRAELTIK  555



>ref|XP_009133768.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Brassica 
rapa]
Length=550

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L+AD ++ + RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  373  FKAEAPHRQRILSADGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  433  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQK  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P+++Y SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS Y +NG+LHLRAELTI
Sbjct  493  PSQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYLINGVLHLRAELTI  547



>ref|XP_006358650.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=551

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+ AA+E+  + RRFVERAYKYRPVKVVEFELPR QCIVYLDLKR+EC NL
Sbjct  375  FKAEAPHRQRTQAAEESASTSRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKRDECANL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAART 
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARTT  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              EEYVSKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+ G+LHLRAELTIR
Sbjct  495  LAEEYVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR  550



>emb|CDX83375.1| BnaA03g21310D [Brassica napus]
Length=553

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L+A+ ++ + RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  376  FKAEAPHRQRILSAEGSDSTNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARQK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P+++Y SKYKGNYTFTGGKAVGYRNLF IPWT+F+ +DS YF+NG+LHLRAELTI
Sbjct  496  PSQDYSSKYKGNYTFTGGKAVGYRNLFAIPWTSFIAEDSQYFINGVLHLRAELTI  550



>ref|XP_003521793.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 163/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ A+ + R FVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  378  FKAEAPHRQRILAAESASFN-RLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR++
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT F+ +DS YF+NG LHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGALHLRAELTIR  552



>ref|XP_007147261.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
 gb|ESW19255.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
Length=553

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ A+ S R FVERAYKYRPVKVV+FELPR QC+VYLDLKREEC NL
Sbjct  378  FKAEAPHRQRILAAESASYS-RLFVERAYKYRPVKVVDFELPRQQCVVYLDLKREECANL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS SFA+DYEFAAR++
Sbjct  437  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSTSFAIDYEFAARSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT F+ +DS YF+NGILHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGILHLRAELTIR  552



>ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
 gb|EOA26831.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
Length=453

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  271  FKAEAPHRQRILAGEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  330

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR-T  362
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSFAVDYEFAAR  
Sbjct  331  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFAVDYEFAAREN  390

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KP EE+VSKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  391  KPGEEFVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIK  447



>ref|XP_004138466.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
2 [Cucumis sativus]
 ref|XP_004159779.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
sativus]
 gb|KGN45706.1| hypothetical protein Csa_6G007400 [Cucumis sativus]
Length=550

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+ P+RQR+L  DE+  S  RF+ER YKYRPVK++E ELPR QC+VYLDLKREEC NL
Sbjct  374  FKADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEF+AR+K
Sbjct  434  FPSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  494  PSEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLRAELTIK  549



>gb|KJB39679.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
 gb|KJB39680.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
Length=562

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P++QR+LA++EAN  +R F+ERAYKYRPVKVVEFE PR QC+VYLDLKREEC +L
Sbjct  386  FKAETPHKQRALASEEANAPYRHFLERAYKYRPVKVVEFEKPRQQCVVYLDLKREECAHL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP G+VYSQAFHLGGQGFF SAHC+MDQQSSFHCFGLFLGMQEKG V+FAVDYEFAAR+K
Sbjct  446  FPGGKVYSQAFHLGGQGFFFSAHCHMDQQSSFHCFGLFLGMQEKGPVTFAVDYEFAARSK  505

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+Y+SKYKGNYTFTGGKAVGYRNLFGIPWT F+ DDS+YF+NG+LHLRAELT+R
Sbjct  506  PTEDYISKYKGNYTFTGGKAVGYRNLFGIPWTTFMADDSNYFINGVLHLRAELTVR  561



>ref|XP_004138465.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
1 [Cucumis sativus]
Length=552

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+ P+RQR+L  DE+  S  RF+ER YKYRPVK++E ELPR QC+VYLDLKREEC NL
Sbjct  376  FKADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEF+AR+K
Sbjct  436  FPSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  496  PSEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLRAELTIK  551



>ref|XP_008458155.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=550

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+ P+RQR+L  DE+  S  RF+ER YKYRPVK++E ELPR QC+VYLDLKREEC NL
Sbjct  374  FKADVPHRQRALITDESTSSNHRFIERTYKYRPVKIIELELPRQQCVVYLDLKREECTNL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEF+AR+K
Sbjct  434  FPSGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARSK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS +F+NGILHL+AELTI+
Sbjct  494  PSEEFLSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSVHFINGILHLKAELTIK  549



>gb|KHN35353.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ A+ + R FVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  378  FKAEAPHRQRILAAESASFN-RLFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAA+++
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAKSR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWT F+ +DS YF+NG LHLRAELTIR
Sbjct  497  PTEEFVSKYKGNYVFTGGKAVGYRNLFAIPWTTFMAEDSLYFINGALHLRAELTIR  552



>ref|XP_009617879.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=550

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAPYRQRS+AAD  N    R++ERAYKYRPVKV+EFE PR QC++YLDLK+EEC +L
Sbjct  374  YKAEAPYRQRSIAADAGNALCHRYMERAYKYRPVKVLEFEAPRQQCVIYLDLKKEECASL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQS+FHCFGLFLGMQEKG+VSFAVDYEFAAR K
Sbjct  434  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGAVSFAVDYEFAARIK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+YVSKYKGNYTFTGGKAVGYRNLFGI W AF+ DDS YF+NG+LHLRAELTIR
Sbjct  494  PNEQYVSKYKGNYTFTGGKAVGYRNLFGIGWNAFMADDSTYFINGLLHLRAELTIR  549



>ref|XP_010676365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE PYRQR+L  DE N    R++ERAYKYRPVKV+EFELPRPQCIVYLDLK+EEC NL
Sbjct  378  FKAEPPYRQRALLGDETNTMGHRYMERAYKYRPVKVIEFELPRPQCIVYLDLKKEECQNL  437

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEF+AR  
Sbjct  438  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFSARQS  497

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P +E+++KY+GNYTF GGKAVGYRNLFG PWT+F+ DDS +F+NG+LHL+AELTI+
Sbjct  498  PADEFITKYRGNYTFMGGKAVGYRNLFGTPWTSFMADDSLFFINGVLHLKAELTIK  553



>ref|XP_010522934.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Tarenaya hassleriana]
Length=545

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E      RFVERAY+YRPVKV+EFE PRPQC+VYLDLKREEC NL
Sbjct  369  FKAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNL  428

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +PAGR+YSQAFHLGGQGFFLSAHCNMDQQ+SFHCFGLFLGMQEKGSVSF VDYEFAAR+K
Sbjct  429  YPAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSK  488

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWTAF+ ++  YF+NG+LHLRAELTIR
Sbjct  489  PTEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  544



>ref|XP_010522935.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Tarenaya hassleriana]
Length=543

 Score =   318 bits (816),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E      RFVERAY+YRPVKV+EFE PRPQC+VYLDLKREEC NL
Sbjct  367  FKAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNL  426

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +PAGR+YSQAFHLGGQGFFLSAHCNMDQQ+SFHCFGLFLGMQEKGSVSF VDYEFAAR+K
Sbjct  427  YPAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSK  486

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWTAF+ ++  YF+NG+LHLRAELTIR
Sbjct  487  PTEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  542



>ref|XP_010522933.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Tarenaya hassleriana]
Length=549

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+E      RFVERAY+YRPVKV+EFE PRPQC+VYLDLKREEC NL
Sbjct  373  FKAEAPHRQRILAAEEPASLNHRFVERAYRYRPVKVLEFEAPRPQCVVYLDLKREECSNL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +PAGR+YSQAFHLGGQGFFLSAHCNMDQQ+SFHCFGLFLGMQEKGSVSF VDYEFAAR+K
Sbjct  433  YPAGRIYSQAFHLGGQGFFLSAHCNMDQQNSFHCFGLFLGMQEKGSVSFTVDYEFAARSK  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTEE+VSKYKGNY FTGGKAVGYRNLF IPWTAF+ ++  YF+NG+LHLRAELTIR
Sbjct  493  PTEEFVSKYKGNYKFTGGKAVGYRNLFAIPWTAFMSEECLYFINGVLHLRAELTIR  548



>ref|XP_011022567.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=561

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE  +RQR++AADE N   RRFVERAYKYRPVKVVE ELP  QC+VYLDLKREEC  L
Sbjct  385  FKAETSHRQRAIAADEPNAVNRRFVERAYKYRPVKVVELELPHQQCVVYLDLKREECAQL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQ ++HCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  445  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSVSFAVDYEFAARSK  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             TEEYVSKYKGNYTFTGGKAVGYRNLFG+ W AF+ DDS+ F+NGILHLRAELTIR
Sbjct  505  QTEEYVSKYKGNYTFTGGKAVGYRNLFGVHWQAFIEDDSNNFINGILHLRAELTIR  560



>ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
 gb|EOA26832.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
Length=560

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  378  FKAEAPHRQRILAGEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  437

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR-T  362
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSFAVDYEFAAR  
Sbjct  438  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFAVDYEFAAREN  497

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KP EE+VSKYKGNYTFTGGKAVGYRNLFG+PWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  498  KPGEEFVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIK  554



>ref|XP_010914379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Elaeis guineensis]
Length=537

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP RQR+LAADE+  + RRF+ERAYKYRPVKVVEFELP PQCIVYLDLKR EC NL
Sbjct  356  FKAEAPRRQRALAADES--TNRRFIERAYKYRPVKVVEFELPHPQCIVYLDLKRRECGNL  413

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+ RVYSQAFHLGGQGFFLSAHCNMD QSS HCFGLFLGMQEKGSVSF VDYEFAART+
Sbjct  414  FPSARVYSQAFHLGGQGFFLSAHCNMDHQSSCHCFGLFLGMQEKGSVSFTVDYEFAARTR  473

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ DDS YF+N +LHLRAELTI+
Sbjct  474  PSGEFVSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSLYFINDVLHLRAELTIK  529



>ref|XP_002880228.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56487.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ +    RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  379  FKAEAPHRQRILAAEGSGSLNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART-  362
            F +GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR  
Sbjct  439  FLSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDK  498

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            K +EEYVSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ DDS +F+NGILHLRAELTI+
Sbjct  499  KSSEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTSFIADDSQHFINGILHLRAELTIK  555



>ref|XP_002303620.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
 gb|EEE78599.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
Length=561

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE  +RQR++AADE N   RRFVERAYKYRPVKVVE ELP  QC+VYLDLKREEC  L
Sbjct  385  FKAETSHRQRAIAADEPNAVNRRFVERAYKYRPVKVVELELPHQQCVVYLDLKREECAQL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQ ++HCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  445  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSVSFAVDYEFAARSK  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             TEEYVSKYKGNYTFTGGKAVGYRNLFG+ W AF+ DDS+ F+NGILHLRAELTIR
Sbjct  505  QTEEYVSKYKGNYTFTGGKAVGYRNLFGVHWQAFIEDDSNNFINGILHLRAELTIR  560



>ref|XP_006360698.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=546

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E N S   FVERAYKYRP+KVVEFELPR QC+VYLDLKREEC NL
Sbjct  369  FKAEAPHRQRSLAAEEGNASRSSFVERAYKYRPIKVVEFELPRQQCMVYLDLKREECNNL  428

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQ++FHCFGLFLGMQEKGSVSF VDYEFA  TK
Sbjct  429  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQNAFHCFGLFLGMQEKGSVSFTVDYEFAVWTK  488

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
             TE YVSKYKGNYTFTGGKAVGYRNL GIPWT+F+ +DS YF+NGILHLRA LTI
Sbjct  489  LTEGYVSKYKGNYTFTGGKAVGYRNLAGIPWTSFMAEDSVYFINGILHLRAVLTI  543



>gb|KHG30067.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=562

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P++QR+LA++EAN  FR F+ERAYKYRPVKV+EFE P+ QC+VYLDLKREEC +L
Sbjct  386  FKAETPHKQRALASEEANAPFRHFLERAYKYRPVKVLEFEKPKQQCVVYLDLKREECAHL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP G+VYSQAFHLGGQGFF SAHC+MDQQSSFHCFGLFLGMQEKG+V+FAVDYEFAAR+K
Sbjct  446  FPGGKVYSQAFHLGGQGFFFSAHCHMDQQSSFHCFGLFLGMQEKGAVTFAVDYEFAARSK  505

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+YVSKYKGNYTFTG KA+GYRNLFGIPWT F+ DDS++F+NG+LHLRAELT+R
Sbjct  506  PTEDYVSKYKGNYTFTGRKAIGYRNLFGIPWTTFMADDSNFFINGVLHLRAELTVR  561



>gb|EYU32197.1| hypothetical protein MIMGU_mgv1a003926mg [Erythranthe guttata]
Length=555

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE+P+RQR+ A +++  + RRFVERAYKYRPV+VVEFE PR QC+VYLDLKR+EC NL
Sbjct  379  FKAESPHRQRTYATEDSTSTSRRFVERAYKYRPVRVVEFEQPRKQCVVYLDLKRDECANL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR+K
Sbjct  439  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFVVDYEFAARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE+Y+SKYKGNYTFTGGKAVGYRNLF + WT F+ +DS YF+NG+LHLRAELTI+
Sbjct  499  PTEDYISKYKGNYTFTGGKAVGYRNLFSLQWTNFMAEDSLYFINGVLHLRAELTIK  554



>ref|XP_004494778.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ A+ S   FVERAYKYRPVKVVEFELPR QCIVYLDLKREEC +L
Sbjct  370  FKAEAPHRQRILAAESAS-SRHLFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECGSL  428

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGS SFAVDYEFA R+K
Sbjct  429  YPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSASFAVDYEFAVRSK  488

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE++VSKYKGNYTFTGGKAVGYRNLF  PW +F+ DDS YF+NG+LHLRAELTIR
Sbjct  489  PTEDFVSKYKGNYTFTGGKAVGYRNLFATPWMSFMADDSLYFINGVLHLRAELTIR  544



>ref|XP_010518296.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 [Camelina 
sativa]
Length=562

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  380  FKAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  439

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  440  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAARDK  499

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
               EE+VSKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  500  KAGEEFVSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  556



>ref|XP_009772687.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=550

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAPYRQRS+AAD  N    R++ERAYKYRPVKV+EFE PR QC++YLDLK+EEC +L
Sbjct  374  YKAEAPYRQRSIAADAGNALCHRYMERAYKYRPVKVLEFEAPRQQCVIYLDLKKEECASL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQS+FHCFGLFLGMQEKG+VSFAVDYEFA RTK
Sbjct  434  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGAVSFAVDYEFAVRTK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P E+Y+SKYKGNYTFTGGKAVGYRNL G+ W+AF+ DDS YF+NG+LHLRAELTI
Sbjct  494  PNEQYMSKYKGNYTFTGGKAVGYRNLLGVGWSAFLADDSAYFINGLLHLRAELTI  548



>emb|CDX71727.1| BnaC08g31470D [Brassica napus]
Length=554

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P++QRSLAA+E+    R  +ERAYKYRPVKV+EFELP PQC+VYLDLKREEC+ L
Sbjct  374  FKAETPHKQRSLAAEESASVHRHLIERAYKYRPVKVLEFELPMPQCVVYLDLKREECIGL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFH+GGQGFFLSAHCN+DQQSSF+CFGLFLGMQEKGSVSF VDYEF+AR+ 
Sbjct  434  FPSGRVYSQAFHIGGQGFFLSAHCNLDQQSSFYCFGLFLGMQEKGSVSFGVDYEFSARSN  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+EE++SKYKGNYTFTGGKAVGYRNLFGIPWT+FV +D+ YF+NGILHL+AELTIR
Sbjct  494  PSEEFISKYKGNYTFTGGKAVGYRNLFGIPWTSFVEEDNLYFINGILHLKAELTIR  549



>ref|XP_006842894.1| hypothetical protein AMTR_s00075p00054260 [Amborella trichopoda]
 gb|ERN04569.1| hypothetical protein AMTR_s00075p00054260 [Amborella trichopoda]
Length=280

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 3/177 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQR+L A+E+  + RRF ERAYKYRPVKVVEF+ P  QCIV+LDLKREEC  L
Sbjct  101  FKAETPHRQRALMAEES--ANRRFAERAYKYRPVKVVEFDSPHTQCIVFLDLKREECAAL  158

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAAR+K
Sbjct  159  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARSK  218

Query  358  PTE-EYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PT  E+VSKYKGNYTFTGGKAVGYRNLF +PWT+F+ +DSHYF+NG+LHLRAELTI+
Sbjct  219  PTAWEFVSKYKGNYTFTGGKAVGYRNLFQMPWTSFMAEDSHYFVNGVLHLRAELTIK  275



>ref|XP_009410864.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=514

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQR+LA++++  S RR+ ERAYKYRPVK +EFELP PQCIVYLDLK+EEC++L
Sbjct  332  FKAETPHRQRALASEQS--SNRRYAERAYKYRPVKAIEFELPHPQCIVYLDLKQEECVHL  389

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR K
Sbjct  390  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARAK  449

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E++SKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS YF+NG+LHLRAELTI+
Sbjct  450  PSGEFISKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIK  505



>ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=530

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  351  FKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  410

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  411  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  470

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              + +VSKY+GNYTFTGGKAVGYRNLFG PWT+F+ DDS YF+NGILHLRAELTI+
Sbjct  471  -EKGFVSKYRGNYTFTGGKAVGYRNLFGCPWTSFIADDSQYFINGILHLRAELTIK  525



>ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=554

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  375  FKAEAPHRQRILAAEGSDSMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              + +VSKY+GNYTFTGGKAVGYRNLFG PWT+F+ DDS YF+NGILHLRAELTI+
Sbjct  495  -EKGFVSKYRGNYTFTGGKAVGYRNLFGCPWTSFIADDSQYFINGILHLRAELTIK  549



>ref|XP_009410863.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=536

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQR+LA++++  S RR+ ERAYKYRPVK +EFELP PQCIVYLDLK+EEC++L
Sbjct  354  FKAETPHRQRALASEQS--SNRRYAERAYKYRPVKAIEFELPHPQCIVYLDLKQEECVHL  411

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEFAAR K
Sbjct  412  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFAARAK  471

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E++SKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS YF+NG+LHLRAELTI+
Sbjct  472  PSGEFISKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGVLHLRAELTIK  527



>ref|XP_011093067.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=476

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR  A +E   S  RRF+ER YKYRPVKVVEFE PR QC+V+LDLKREEC N
Sbjct  297  FKAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECAN  356

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG V+FAVDYEFAAR+
Sbjct  357  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARS  416

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTE+++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS+YF+  +LHLRAEL+I+
Sbjct  417  KPTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  473



>ref|XP_010925791.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Elaeis guineensis]
Length=507

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LAADE+  + RRFVERAYKYRP+KVVEF+ P PQCIVYLDLKREEC  L
Sbjct  329  FKADAPHRQRALAADES--TSRRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKL  386

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQ+SFHCFGLFLGMQEKGS+SF VDYEFAAR +
Sbjct  387  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARAR  446

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS +F+NG+LHLRAELTI+
Sbjct  447  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIK  502



>ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Camelina sativa]
Length=563

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  381  FKAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  500

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
               +E+ SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  501  KAGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  557



>ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Camelina sativa]
Length=559

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  377  FKAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  496

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
               +E+ SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NGILHLRAELTI+
Sbjct  497  KAGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWTSFMAEDSPHFINGILHLRAELTIK  553



>ref|XP_010092900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB52718.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=552

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQR+LA++++    R FVERAYKYRPVKVVEFELPR QC+VYLDLKREEC NL
Sbjct  376  FKAEVPHRQRALASEDSATMNRHFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECANL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P+GRVYSQAFHLGGQGFFLSAHCNMDQQ SFHCFGLFLGMQEKGSV+FAVDYEFAAR+K
Sbjct  436  YPSGRVYSQAFHLGGQGFFLSAHCNMDQQGSFHCFGLFLGMQEKGSVTFAVDYEFAARSK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EE+VSKYKGNYTFTGGKAVGYRNLF + WT F+ ++S YF+NG+LHLRAELTI+
Sbjct  496  PAEEFVSKYKGNYTFTGGKAVGYRNLFQLLWTNFMAEESPYFINGVLHLRAELTIK  551



>ref|XP_011093066.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
Length=557

 Score =   311 bits (798),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR  A +E   S  RRF+ER YKYRPVKVVEFE PR QC+V+LDLKREEC N
Sbjct  378  FKAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECAN  437

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG V+FAVDYEFAAR+
Sbjct  438  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARS  497

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTE+++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS+YF+  +LHLRAEL+I+
Sbjct  498  KPTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  554



>ref|XP_010925790.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Elaeis guineensis]
Length=557

 Score =   311 bits (797),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 162/176 (92%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LAADE+  + RRFVERAYKYRP+KVVEF+ P PQCIVYLDLKREEC  L
Sbjct  379  FKADAPHRQRALAADES--TSRRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQ+SFHCFGLFLGMQEKGS+SF VDYEFAAR +
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARAR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS +F+NG+LHLRAELTI+
Sbjct  497  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIK  552



>ref|XP_002299499.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
 gb|EEE84304.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
Length=561

 Score =   311 bits (797),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQ +LA D  N   RRFVERAYKYRPVKVV+FELP  QC+VYLDLKREEC  L
Sbjct  385  FKAETPHRQHALAVDVPNAVNRRFVERAYKYRPVKVVDFELPYQQCVVYLDLKREECAQL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQ ++HCFGLFLGMQEKGS SFAVDYEFAAR+K
Sbjct  445  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSK  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE YV+KYKGNYTFTGGKAVGYRNLF + W AF+ DDS+YF+NGILHLRAELTIR
Sbjct  505  PTEGYVNKYKGNYTFTGGKAVGYRNLFSVHWEAFMEDDSNYFINGILHLRAELTIR  560



>ref|XP_011093065.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=564

 Score =   311 bits (797),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FKAEAP+RQR  A +E   S  RRF+ER YKYRPVKVVEFE PR QC+V+LDLKREEC N
Sbjct  385  FKAEAPHRQRVHAVEEETTSASRRFIERVYKYRPVKVVEFEFPRHQCVVFLDLKREECAN  444

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
            LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG V+FAVDYEFAAR+
Sbjct  445  LFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGCVTFAVDYEFAARS  504

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            KPTE+++SKYKGNYTFTGGKAVGYRNLF IPWT+F+ DDS+YF+  +LHLRAEL+I+
Sbjct  505  KPTEDFISKYKGNYTFTGGKAVGYRNLFSIPWTSFMADDSNYFIKDMLHLRAELSIK  561



>ref|XP_010508047.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Camelina 
sativa]
Length=563

 Score =   310 bits (795),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LA + ++   RRF+ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  381  FKAEAPHRQRILAGEGSDTMNRRFIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  440

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  441  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  500

Query  358  PT-EEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
               +E+ SKYKGNYTFTGGKAVGYRNLFGIPW +F+ +DS +F+NGILHLRAELTI+
Sbjct  501  KAGDEFTSKYKGNYTFTGGKAVGYRNLFGIPWISFMAEDSPHFINGILHLRAELTIK  557



>ref|XP_011026946.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Populus euphratica]
Length=501

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P RQR+LA D  N   RRFVERAYKYRPVKVV+FE P  QC+VYLDLKREEC  L
Sbjct  325  FKAETPLRQRALAVDVPNAVNRRFVERAYKYRPVKVVDFESPHQQCVVYLDLKREECAQL  384

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQ ++HCFGLFLGMQEKGS SFAVDYEFAAR+K
Sbjct  385  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSK  444

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE YV+K KGNYTFTGGKAVGYRNLFG+ W AF+ DDS+YF+NG LHLRAELTIR
Sbjct  445  PTEGYVNKNKGNYTFTGGKAVGYRNLFGVLWEAFMEDDSNYFINGTLHLRAELTIR  500



>ref|XP_008798670.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Phoenix 
dactylifera]
Length=537

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP RQR+LAADE+  + RRF+ERAYKYRPVKVVEFELP PQCIV+LDLKR EC NL
Sbjct  356  FKAEAPRRQRALAADES--TNRRFLERAYKYRPVKVVEFELPHPQCIVFLDLKRGECRNL  413

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+ RVYSQAFHLGGQGFFLSAHCN+D Q+S HCFGLFLGMQEKGSVSF VDYEFAART+
Sbjct  414  FPSARVYSQAFHLGGQGFFLSAHCNIDHQNSCHCFGLFLGMQEKGSVSFTVDYEFAARTR  473

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+ SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ DDS YF+N +LHLRAELTI+
Sbjct  474  PSGEFASKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSLYFINDVLHLRAELTIK  529



>ref|XP_008238990.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Prunus 
mume]
Length=555

 Score =   308 bits (789),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 5/176 (3%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA     +  RRF ER+YKYRP+K+VEFE PR QCIV+LDLKREEC  L
Sbjct  384  FKAEAPFRQRSLA-----LGDRRFGERSYKYRPIKLVEFEQPRDQCIVFLDLKREECARL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+Y+SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ DDS YF++ +LHL+AELTIR
Sbjct  499  PGEDYLSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSIYFIDSVLHLKAELTIR  554



>ref|XP_009142670.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g46260 [Brassica rapa]
Length=564

 Score =   308 bits (789),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR LAA+ ++ + RRF+ERAYKYRPVKVV  ELPRPQC+VYLDLKREEC  L
Sbjct  384  FKAEAPHRQRILAAEGSDSTNRRFIERAYKYRPVKVVXCELPRPQCVVYLDLKREECTGL  443

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
             P+GRVYS+AFHLGGQG FLSAHCN+D QSSFHCFGLFLGMQEKG+VSF VDYEFAAR K
Sbjct  444  CPSGRVYSKAFHLGGQGLFLSAHCNIDLQSSFHCFGLFLGMQEKGAVSFGVDYEFAAREK  503

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+++Y  KYKGNYTFTGGKAVGYRNLFGIPWT+F+ +DS YF++GILHLRAELTI+
Sbjct  504  PSQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSQYFIDGILHLRAELTIK  559



>ref|XP_011026945.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Populus euphratica]
Length=551

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P RQR+LA D  N   RRFVERAYKYRPVKVV+FE P  QC+VYLDLKREEC  L
Sbjct  375  FKAETPLRQRALAVDVPNAVNRRFVERAYKYRPVKVVDFESPHQQCVVYLDLKREECAQL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQ ++HCFGLFLGMQEKGS SFAVDYEFAAR+K
Sbjct  435  FPTGRVYSQAFHLGGQGFFLSAHCNMDQQGTYHCFGLFLGMQEKGSASFAVDYEFAARSK  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE YV+K KGNYTFTGGKAVGYRNLFG+ W AF+ DDS+YF+NG LHLRAELTIR
Sbjct  495  PTEGYVNKNKGNYTFTGGKAVGYRNLFGVLWEAFMEDDSNYFINGTLHLRAELTIR  550



>ref|XP_006343902.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343903.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum tuberosum]
Length=552

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAEAPYRQRS+AA+E N  + R+VERAYKYRP+K +EFE P  QC++YLDLKR+EC +L
Sbjct  376  YKAEAPYRQRSIAAEEGNALYHRYVERAYKYRPIKALEFETPHQQCVIYLDLKRDECASL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMD QS+FHCFGLFLGMQEKGSVSFAVDYEFAAR  
Sbjct  436  FPAGRVYSQAFHLGGQGFFLSAHCNMDHQSAFHCFGLFLGMQEKGSVSFAVDYEFAARIS  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EEYVSKYKG+YTFT GKAVGYRNLFG+ WT F+ +DS +F+NGILHLRAEL +R
Sbjct  496  PGEEYVSKYKGDYTFTSGKAVGYRNLFGVAWTPFLSEDSLFFINGILHLRAELRVR  551



>ref|XP_009789894.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=576

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSLAA+E + S   FVERAYKYRPVKVVEFELPR QCIVYLD KREEC +L
Sbjct  387  FKAEAPYRQRSLAAEEGSASHHCFVERAYKYRPVKVVEFELPRQQCIVYLDTKREECNSL  446

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK
Sbjct  447  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  506

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYF  233
            PTE+YVSKYKGNYTFTGGKAVGYRNLFGIPWTAF+ +DS Y+
Sbjct  507  PTEDYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFMAEDSPYW  548



>ref|XP_009380541.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=555

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+L+ADE+  S +RF ERAYKYRP+KVVEFE P PQCIVYLDL R+EC  L
Sbjct  374  FKAEAPHRQRALSADES--SHKRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQ S FHCFGLFLGMQEKGS+SF V+YEFAARTK
Sbjct  432  FPSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTK  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NG LHLRAELTI+
Sbjct  492  PSGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIK  547



>ref|XP_009380540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+L+ADE+  S +RF ERAYKYRP+KVVEFE P PQCIVYLDL R+EC  L
Sbjct  376  FKAEAPHRQRALSADES--SHKRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQ S FHCFGLFLGMQEKGS+SF V+YEFAARTK
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NG LHLRAELTI+
Sbjct  494  PSGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIK  549



>ref|XP_007209857.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
 gb|EMJ11056.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
Length=555

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLA     +  RRF ER+YKYRP+K+VEFE P  QCIV+LDLKREEC  L
Sbjct  384  FKAEAPFRQRSLA-----LGDRRFGERSYKYRPIKLVEFEQPHDQCIVFLDLKREECARL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  439  FPGGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFTVDYEFSARSK  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P E+Y+SKYKGNYTFTGGKAVGYRNLFGIPWT+F+ DDS YF++ +LHL+AELTIR
Sbjct  499  PGEDYLSKYKGNYTFTGGKAVGYRNLFGIPWTSFMADDSIYFIDSVLHLKAELTIR  554



>ref|XP_009380539.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=572

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+L+ADE+  S +RF ERAYKYRP+KVVEFE P PQCIVYLDL R+EC  L
Sbjct  391  FKAEAPHRQRALSADES--SHKRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKL  448

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQ S FHCFGLFLGMQEKGS+SF V+YEFAARTK
Sbjct  449  FPSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTK  508

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NG LHLRAELTI+
Sbjct  509  PSGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIK  564



>ref|XP_008793877.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Phoenix dactylifera]
Length=557

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+ P+RQR+LA+DE+  + +RFVERAYKYRP+KVVEF+ P PQCIVYLDLKREEC  L
Sbjct  379  FKADTPHRQRALASDES--TSQRFVERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQ+SFHCFGLFLGMQEKGS+SF VDYEFAART+
Sbjct  437  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQNSFHCFGLFLGMQEKGSISFTVDYEFAARTR  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             + E+ SKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS +F+NG+LHLRAELTI+
Sbjct  497  LSGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLFFINGVLHLRAELTIK  552



>ref|XP_009380538.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=574

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR+L+ADE+  S +RF ERAYKYRP+KVVEFE P PQCIVYLDL R+EC  L
Sbjct  393  FKAEAPHRQRALSADES--SHKRFTERAYKYRPLKVVEFERPHPQCIVYLDLTRDECAKL  450

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQ S FHCFGLFLGMQEKGS+SF V+YEFAARTK
Sbjct  451  FPSGRVYSQAFHLGGQGFFLSAHCNLDQHSLFHCFGLFLGMQEKGSISFTVEYEFAARTK  510

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLFGIPWT+F+ +DS +F+NG LHLRAELTI+
Sbjct  511  PSGEFVSKYKGFYTFTGGKAVGYRNLFGIPWTSFIAEDSLFFINGTLHLRAELTIK  566



>ref|XP_011463940.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=548

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +K+E PYRQR LA + AN ++R FV+R+YKYRPVK+VEFELP PQCIVYLDLKREEC  L
Sbjct  372  YKSETPYRQRLLAVENANATYRGFVDRSYKYRPVKIVEFELPHPQCIVYLDLKREECARL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAF+LGGQGFFLSAHCNMDQQ+SF C GLFLGMQEKGSVSF VDYEF+ R K
Sbjct  432  FPAGRVYSQAFNLGGQGFFLSAHCNMDQQNSFQCLGLFLGMQEKGSVSFVVDYEFSVRVK  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EE+ SK+KG YTFTGGKAVGYRNL  IPWT F+ DDS YF+N +LHL+AEL IR
Sbjct  492  PEEEFQSKHKGTYTFTGGKAVGYRNLLAIPWTTFMADDSIYFINSVLHLQAELIIR  547



>ref|XP_004298859.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=543

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +K+E PYRQR LA + AN ++R FV+R+YKYRPVK+VEFELP PQCIVYLDLKREEC  L
Sbjct  367  YKSETPYRQRLLAVENANATYRGFVDRSYKYRPVKIVEFELPHPQCIVYLDLKREECARL  426

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAF+LGGQGFFLSAHCNMDQQ+SF C GLFLGMQEKGSVSF VDYEF+ R K
Sbjct  427  FPAGRVYSQAFNLGGQGFFLSAHCNMDQQNSFQCLGLFLGMQEKGSVSFVVDYEFSVRVK  486

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EE+ SK+KG YTFTGGKAVGYRNL  IPWT F+ DDS YF+N +LHL+AEL IR
Sbjct  487  PEEEFQSKHKGTYTFTGGKAVGYRNLLAIPWTTFMADDSIYFINSVLHLQAELIIR  542



>ref|XP_010915728.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Elaeis 
guineensis]
Length=552

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK +A +RQ +L  DE     R+FVERAYKYRP+KVVEFE P PQCIVYLDLKREEC  L
Sbjct  374  FKVDAMHRQHALPTDEPTC--RQFVERAYKYRPLKVVEFERPHPQCIVYLDLKREECAKL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQSSFHCFGLFLGMQEKGS+SF VDYEFAART+
Sbjct  432  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTR  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPWT+F+ D+S +F+NGILHLRAELTI+
Sbjct  492  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWTSFMADNSLFFINGILHLRAELTIK  547



>ref|XP_009116827.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Brassica 
rapa]
Length=549

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK EAP++QRSLAA+E+    RR VERAYKYRPVKV+EFE P P C+VYLDLKREEC+ L
Sbjct  368  FKTEAPHKQRSLAAEESASEHRRLVERAYKYRPVKVLEFEFPTPHCVVYLDLKREECIGL  427

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR++SQAFHLGGQGFFLSAHCNMDQQSS HCFGLFLGMQEKGS+ F VDYEF+AR+ 
Sbjct  428  FPSGRIFSQAFHLGGQGFFLSAHCNMDQQSSDHCFGLFLGMQEKGSMGFGVDYEFSARSS  487

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFV-GDDSHYFMNGILHLRAELTIR  191
            P+EE+ SKYKGNYTFTGGKA+GYRNLFGIPWT+FV  +D+  F+NGILHL+AELT+R
Sbjct  488  PSEEFESKYKGNYTFTGGKAIGYRNLFGIPWTSFVEEEDNVNFINGILHLKAELTVR  544



>dbj|BAK01214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LA D   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  183  YKADAPHRQRALATDV--LTSRKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRL  240

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  241  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  300

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F+NG+LHLRAELTI+
Sbjct  301  PSGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIK  356



>dbj|BAJ92080.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LA D   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  106  YKADAPHRQRALATDV--LTSRKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRL  163

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  164  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  223

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F+NG+LHLRAELTI+
Sbjct  224  PSGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIK  279



>ref|NP_001142262.1| uncharacterized protein LOC100274431 [Zea mays]
 gb|ACF81694.1| unknown [Zea mays]
 gb|ACF88032.1| unknown [Zea mays]
 gb|ACR36259.1| unknown [Zea mays]
 gb|ACR38764.1| unknown [Zea mays]
 gb|AFW71009.1| hypothetical protein ZEAMMB73_641376 [Zea mays]
 gb|AIB05715.1| orphans transcription factor, partial [Zea mays]
Length=539

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD    + R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  363  YKADAPHRQRALAAD--TTTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  420

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  421  FPAGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSTSVTVDYEFAARTR  480

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLFGIPW AF+ DDS +F++G+LHLRAELTI+
Sbjct  481  PSGEFVSKYKGNYTFTGGKAVGYRNLFGIPWQAFMADDSLFFIDGMLHLRAELTIK  536



>emb|CDY11366.1| BnaA09g39320D [Brassica napus]
Length=550

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK EAP++QRSLAA+E+    RR VERAYKYRPVKV+EFE P P C+VYLDLKREEC+ L
Sbjct  369  FKTEAPHKQRSLAAEESASEHRRLVERAYKYRPVKVLEFEFPTPHCVVYLDLKREECIGL  428

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR++SQAFHLGGQGFFLSAHCN+DQQSS HCFGLFLGMQEKGS+ F VDYEF+AR+ 
Sbjct  429  FPSGRIFSQAFHLGGQGFFLSAHCNLDQQSSDHCFGLFLGMQEKGSMGFGVDYEFSARSS  488

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFV-GDDSHYFMNGILHLRAELTIR  191
            P+EE+ SKYKGNYTFTGGKA+GYRNLFGIPWT+FV  +D+  F+NGILHL+AELT+R
Sbjct  489  PSEEFESKYKGNYTFTGGKAIGYRNLFGIPWTSFVEEEDNVNFINGILHLKAELTVR  545



>ref|XP_009419784.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEA +RQR+ +ADE+  S +RF ERAYKYRP+KVVEF+ P PQCIVYLDLKREEC  L
Sbjct  376  FKAEALHRQRAFSADES--SHKRFTERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKL  433

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQS FHCFGLFLGMQEKGS+SF VDYEFAARTK
Sbjct  434  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSISFTVDYEFAARTK  493

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF  PWT+F+ +DS +F+N  LHLRAELTI+
Sbjct  494  PSGEFVSKYKGYYTFTGGKAVGYRNLFATPWTSFMAEDSLFFINDTLHLRAELTIK  549



>ref|XP_009419783.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=559

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEA +RQR+ +ADE+  S +RF ERAYKYRP+KVVEF+ P PQCIVYLDLKREEC  L
Sbjct  378  FKAEALHRQRAFSADES--SHKRFTERAYKYRPLKVVEFDRPHPQCIVYLDLKREECAKL  435

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQS FHCFGLFLGMQEKGS+SF VDYEFAARTK
Sbjct  436  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSISFTVDYEFAARTK  495

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF  PWT+F+ +DS +F+N  LHLRAELTI+
Sbjct  496  PSGEFVSKYKGYYTFTGGKAVGYRNLFATPWTSFMAEDSLFFINDTLHLRAELTIK  551



>ref|XP_008794992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Phoenix dactylifera]
Length=569

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK +A  RQR+L  DE+    R+FVERAYKYRP+KVVE + P PQCIVYLDLKREEC  L
Sbjct  377  FKVDAVRRQRALPTDESTC--RQFVERAYKYRPLKVVELDRPYPQCIVYLDLKREECAKL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQSSFHCFGLFLGMQEKGS+SF VDYEFAART+
Sbjct  435  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTR  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+ SKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS  F+NGILHLRAELTI+
Sbjct  495  PSGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLLFINGILHLRAELTIK  550



>ref|XP_008794993.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Phoenix dactylifera]
Length=567

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK +A  RQR+L  DE+    R+FVERAYKYRP+KVVE + P PQCIVYLDLKREEC  L
Sbjct  375  FKVDAVRRQRALPTDESTC--RQFVERAYKYRPLKVVELDRPYPQCIVYLDLKREECAKL  432

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCN+DQQSSFHCFGLFLGMQEKGS+SF VDYEFAART+
Sbjct  433  FPSGRVYSQAFHLGGQGFFLSAHCNLDQQSSFHCFGLFLGMQEKGSISFTVDYEFAARTR  492

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+ SKYKG YTFTGGKAVGYRNLF IPWT+F+ DDS  F+NGILHLRAELTI+
Sbjct  493  PSGEFASKYKGYYTFTGGKAVGYRNLFAIPWTSFMADDSLLFINGILHLRAELTIK  548



>gb|EMS60606.1| BTB/POZ domain-containing protein POB1 [Triticum urartu]
Length=434

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  259  YKADAPHRQRALAADV--LTCRKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRL  316

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  317  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  376

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ ++VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  377  PSGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  432



>ref|XP_008677104.1| PREDICTED: uncharacterized protein LOC100279559 isoform X1 [Zea 
mays]
 gb|ACN28605.1| unknown [Zea mays]
 gb|AFW65828.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=493

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LAAD   I+ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKR+EC  L
Sbjct  318  FKADAPHRQRALAAD--AITCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRL  375

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  376  FPAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  435

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  436  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIK  491



>gb|EPS73437.1| hypothetical protein M569_01319, partial [Genlisea aurea]
Length=475

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 155/184 (84%), Gaps = 8/184 (4%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-------RRFVERAYKYRPVKVVEFELPRPQCIVYLDLK  560
            +KAEAPYRQRS+ A+E   +         RFVERAYKYRPVKVVEFE PR QCIVYLDLK
Sbjct  291  YKAEAPYRQRSIVAEEDASNASSSSSLHHRFVERAYKYRPVKVVEFEHPRQQCIVYLDLK  350

Query  559  REECLNLFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEK-GSVSFAVD  383
            R EC  LFP+GR+YSQAF LGGQGFFLS HCNMDQQSSFHCFGLFLGMQEK GSV+  VD
Sbjct  351  RGECDQLFPSGRIYSQAFQLGGQGFFLSGHCNMDQQSSFHCFGLFLGMQEKGGSVNLTVD  410

Query  382  YEFAARTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAE  203
            YEFA+RTKP+EE+V KY+GNYTFTGGKAVGYRNLFG+PWT F+  DS YF+NG LHLRAE
Sbjct  411  YEFASRTKPSEEFVCKYRGNYTFTGGKAVGYRNLFGLPWTEFIAADSSYFINGFLHLRAE  470

Query  202  LTIR  191
            LTI+
Sbjct  471  LTIK  474



>ref|XP_002451902.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
 gb|EES04878.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
Length=538

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  363  YKADAPHRQRALAAD--TVTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  420

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  421  FPAGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  480

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  481  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIK  536



>gb|AFW65829.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=537

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LAAD   I+ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKR+EC  L
Sbjct  362  FKADAPHRQRALAAD--AITCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRL  419

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  420  FPAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  479

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  480  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIK  535



>ref|XP_003563816.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Brachypodium 
distachyon]
Length=562

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  387  YKADAPHRQRTLAADV--LTCRKYCERAYKYRPLKVVEFDRPYPQCIAYLDLKREECTRL  444

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  445  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  504

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F+NG+LHLRAELTI+
Sbjct  505  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIK  560



>ref|NP_001057726.2| Os06g0507400 [Oryza sativa Japonica Group]
 dbj|BAD61652.1| putative GAMYB-binding protein [Oryza sativa Japonica Group]
 dbj|BAG89960.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80707.1| hypothetical protein OsI_23149 [Oryza sativa Indica Group]
 gb|EEE65789.1| hypothetical protein OsJ_21492 [Oryza sativa Japonica Group]
 dbj|BAF19640.2| Os06g0507400 [Oryza sativa Japonica Group]
Length=536

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRTLAAD--VLTCRKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW++F+ DDS +F+ G+LHLRAELTI+
Sbjct  479  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWSSFMADDSLFFIEGVLHLRAELTIK  534



>ref|XP_004951268.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  364  YKADAPHRQRALAAD--AVTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  421

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  422  FPSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  481

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  482  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIK  537



>ref|NP_001146028.1| hypothetical protein [Zea mays]
 gb|ACL53061.1| unknown [Zea mays]
Length=537

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKA+AP+RQR+LAAD   I+ R+F ERAY+YRP+KVVEF+ P PQCI YLDLKR+EC  L
Sbjct  362  FKADAPHRQRALAAD--AITCRKFAERAYRYRPLKVVEFDRPYPQCIAYLDLKRDECSRL  419

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  420  FPAGRIYSQAFHLAGQGFFLSAHCNMEQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  479

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  480  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQKFLADDSLFFVDGMLHLRAELTIK  535



>ref|XP_003572201.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Brachypodium 
distachyon]
Length=552

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 158/176 (90%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKR+EC  L
Sbjct  377  YKADAPHRQRALAAD--TMTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKRDECSRL  434

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  435  FPSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  494

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW+ F+ DDS +F++G+LHLRAELTI+
Sbjct  495  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFIDGMLHLRAELTIK  550



>ref|XP_004951269.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Setaria italica]
Length=538

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 157/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  363  YKADAPHRQRALAADA--VTCRKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  420

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  421  FPSGRIYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  480

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  481  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWQTFMADDSLFFIDGMLHLRAELTIK  536



>dbj|BAJ95490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LA D   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  362  YKADAPHRQRALATDV--LTSRKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRL  419

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  420  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  479

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F+NG+LHLRAELTI+
Sbjct  480  PSGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIK  535



>gb|EEC72875.1| hypothetical protein OsI_06647 [Oryza sativa Indica Group]
Length=558

 Score =   293 bits (751),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD      R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  381  YKADAPHRQRALAADVTTC--RKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  439  FPSGRMYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW+ F+ DDS +F++G+LHLRAELTI+
Sbjct  499  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIK  554



>ref|XP_008392473.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=558

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +K+E P+RQR+LAA ++N ++RRFV+R+YKYRPVK+VEF  PR QC V+LDLK EEC  L
Sbjct  382  YKSETPHRQRTLAAADSNAAYRRFVDRSYKYRPVKLVEFVEPRLQCSVFLDLKWEECARL  441

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQ F LGGQGFFLSAHCN+DQQS FHCFGLFLGMQEKGS SF VDYEF+AR+K
Sbjct  442  FPAGRVYSQPFFLGGQGFFLSAHCNLDQQSLFHCFGLFLGMQEKGSASFTVDYEFSARSK  501

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P EE+++K+KGNYTFTGGKAVGYRNL GIPWTAF+ DDS YF+N +LHL+AELTI+
Sbjct  502  PGEEFLTKFKGNYTFTGGKAVGYRNLLGIPWTAFMADDSIYFLNSVLHLKAELTIK  557



>gb|EMT31790.1| Kelch-like protein 26 [Aegilops tauschii]
Length=549

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LA D   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  374  YKADAPHRQRALATDV--LTSRKYTERAYKYRPLKVVEFDRPYPQCIAYLDLKREECGRL  431

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  432  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  491

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F+NG+LHLRAELTI+
Sbjct  492  PSGEFVSKYKGCYTFTGGKAVGYRNLFAIPWPSFMADDSLFFINGVLHLRAELTIK  547



>dbj|BAJ93322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score =   292 bits (747),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  365  YKADAPHRQRALAAD--VLTCRKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRL  422

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  423  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  482

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ ++VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  483  PSGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  538



>ref|NP_001046484.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAD20083.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD20129.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08398.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAG94789.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56691.1| hypothetical protein OsJ_06150 [Oryza sativa Japonica Group]
Length=558

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD      ++F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  381  YKADAPHRQRALAADVTTC--QKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART+
Sbjct  439  FPSGRMYSQAFHLAGQGFFLSAHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTR  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKGNYTFTGGKAVGYRNLF IPW+ F+ DDS +F++G+LHLRAELTI+
Sbjct  499  PSGEFVSKYKGNYTFTGGKAVGYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIK  554



>gb|ABR16891.1| unknown [Picea sitchensis]
Length=430

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S +RF ERAYKYRPVKVVEF +P  QCIV+LDLKR EC  L
Sbjct  255  FKAETPHRQRSLAAEET--SHKRFSERAYKYRPVKVVEFNMPHQQCIVFLDLKRGECAGL  312

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQ S+FHCFGLFLGMQEKGSVSFAV+YEFA R+K
Sbjct  313  FPSGRVYSQAFHLGGQGFFLSAHCNMDQHSAFHCFGLFLGMQEKGSVSFAVEYEFATRSK  372

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P  ++  KYKGNYTFTGGKAVGYRNLF  PW++F+ +DS YF+   LHLRAELTI+
Sbjct  373  PLCDFAVKYKGNYTFTGGKAVGYRNLFQTPWSSFMAEDSPYFIRDTLHLRAELTIK  428



>ref|XP_006656117.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Oryza 
brachyantha]
Length=537

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRALAAD--VLTCRKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  V+YEFAARTK
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVEYEFAARTK  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW++F+ DDS +F++G+LHLRA LTI
Sbjct  479  PSSEFVSKYKGYYTFTGGKAVGYRNLFAIPWSSFMADDSLFFIDGVLHLRAVLTI  533



>ref|XP_006648521.1| PREDICTED: BTB/POZ domain-containing protein POB1-like, partial 
[Oryza brachyantha]
Length=491

 Score =   289 bits (739),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD      R+F ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  314  YKADAPHRQRALAADPTTC--RKFAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  371

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCN++QQS+F+CFGLFLGMQEKGS+S  VDYEFAART 
Sbjct  372  FPSGRMYSQAFHLAGQGFFLSAHCNVEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTI  431

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ ++VSKYKGNYTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  432  PSGDFVSKYKGNYTFTGGKAVGYRNLFAIPWATFMADDSLFFIDGVLHLRAELTIK  487



>gb|EMT31791.1| hypothetical protein F775_32011 [Aegilops tauschii]
Length=662

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  487  YKADAPHRQRALAAD--VLTCRKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRL  544

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  545  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  604

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ ++VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  605  PSGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  660



>ref|XP_004965490.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Setaria italica]
Length=531

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  356  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  413

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  414  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  473

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  474  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  529



>ref|XP_004965489.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Setaria italica]
Length=541

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  366  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  423

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  424  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  483

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  484  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  539



>gb|AAT40121.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  406  YKADAPHRQRALAAD--VLTCRKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRL  463

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  464  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  523

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ ++VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  524  PSGDFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  579



>ref|XP_002438463.1| hypothetical protein SORBIDRAFT_10g020060 [Sorghum bicolor]
 gb|EER89830.1| hypothetical protein SORBIDRAFT_10g020060 [Sorghum bicolor]
Length=536

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYPQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW +F+ DDS +F++G+LHLRAELTI+
Sbjct  479  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPSFMADDSLFFIDGVLHLRAELTIK  534



>emb|CDP12109.1| unnamed protein product [Coffea canephora]
Length=832

 Score =   296 bits (758),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 152/169 (90%), Gaps = 4/169 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAPYRQRSL A+E+N S+RRFVERAYKYRPVKVVEFELPR QCIVYLDLKREEC NL
Sbjct  393  FKAEAPYRQRSLVAEESNTSYRRFVERAYKYRPVKVVEFELPRQQCIVYLDLKREECANL  452

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFA+R+K
Sbjct  453  FPAGRIYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFASRSK  512

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHL  212
            PTEEY SKYKGNYTFTGGKAVGYRNLFG+  T      S++ +   LHL
Sbjct  513  PTEEYTSKYKGNYTFTGGKAVGYRNLFGMGLTG----RSYHLIWLFLHL  557



>gb|ABK24446.1| unknown [Picea sitchensis]
Length=572

 Score =   288 bits (737),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQRSLAA+E   S +RF ERAYKYRPVKVVEF +P  QCIV+LDLKR EC  L
Sbjct  397  FKAETPHRQRSLAAEE--TSHKRFSERAYKYRPVKVVEFNMPHQQCIVFLDLKRGECAGL  454

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQ S+FHCFGLFLGMQEKGSVSFAV+YEFA R+K
Sbjct  455  FPSGRVYSQAFHLGGQGFFLSAHCNMDQHSAFHCFGLFLGMQEKGSVSFAVEYEFATRSK  514

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P  ++  KYKGNYTFTGGKAVGYRNLF  PW++F+ +DS YF+   LHLRAELTI+
Sbjct  515  PLCDFAVKYKGNYTFTGGKAVGYRNLFQTPWSSFMAEDSPYFIRDTLHLRAELTIK  570



>gb|EPS68073.1| hypothetical protein M569_06692, partial [Genlisea aurea]
Length=577

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 13/189 (7%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEAN------------ISFRRFVERAYKYRPVKVVEFELPRPQCIV  575
            FKAEAPYRQR+ ++  A              +  R+ ER YKYR VK+VEF+LPRPQC+V
Sbjct  386  FKAEAPYRQRTQSSTAAEAPSSSSSSSSSSSTGHRYTERDYKYRSVKLVEFKLPRPQCVV  445

Query  574  YLDLKREECLNLFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEK-GSV  398
            YLDLKREEC NLFP+GRVYSQAFHL GQGFFLSAHCN+DQQ+SF CFGLFLGMQEK GS+
Sbjct  446  YLDLKREECGNLFPSGRVYSQAFHLCGQGFFLSAHCNLDQQNSFQCFGLFLGMQEKGGSL  505

Query  397  SFAVDYEFAARTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGIL  218
            SFAV+YEF+ARTK TEE+VSKYKGNYTFTGGKAVGYRNLF +PW +F+ +DS+YF+NGIL
Sbjct  506  SFAVEYEFSARTKATEEFVSKYKGNYTFTGGKAVGYRNLFSMPWNSFMAEDSNYFINGIL  565

Query  217  HLRAELTIR  191
            HLRAELTI+
Sbjct  566  HLRAELTIK  574



>gb|KHN35061.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=459

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAE PYRQRSLAA +A  ++ R VERAYK R VKVVEF LPRP+C+VYLDLK+EEC   
Sbjct  283  YKAETPYRQRSLAAQDAGTTYSRLVERAYKLRHVKVVEFALPRPRCVVYLDLKKEECAQF  342

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP  R+YSQAF LG Q FFLSA CNMDQQ++ HCFGLFL +Q KGSVS  VDYEFAAR+K
Sbjct  343  FPNARIYSQAFPLGEQWFFLSARCNMDQQNASHCFGLFLAVQFKGSVSLHVDYEFAARSK  402

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             TEEY+S+ KG+YTFT GKAVGYRNLFGIPWTAF+ DDSH+F+ G+LHLRAELTIR
Sbjct  403  STEEYISRCKGDYTFTAGKAVGYRNLFGIPWTAFIADDSHFFIKGLLHLRAELTIR  458



>ref|XP_006590500.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=520

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAE PYRQRSLAA +A  ++ R VERAYK R VKVVEF LPRP+C+VYLDLK+EEC   
Sbjct  344  YKAETPYRQRSLAAQDAGTTYSRLVERAYKLRHVKVVEFALPRPRCVVYLDLKKEECAQF  403

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP  R+YSQAF LG Q FFLSA CNMDQQ++ HCFGLFL +Q KGSVS  VDYEFAAR+K
Sbjct  404  FPNARIYSQAFPLGEQWFFLSARCNMDQQNASHCFGLFLAVQFKGSVSLHVDYEFAARSK  463

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             TEEY+S+ KG+YTFT GKAVGYRNLFGIPWTAF+ DDSH+F+ G+LHLRAELTIR
Sbjct  464  STEEYISRCKGDYTFTAGKAVGYRNLFGIPWTAFIADDSHFFIKGLLHLRAELTIR  519



>ref|NP_001148937.1| GAMYB-binding protein [Zea mays]
 gb|ACG33542.1| GAMYB-binding protein [Zea mays]
Length=536

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P  QCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCN+DQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  479  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIK  534



>gb|ACN26008.1| unknown [Zea mays]
 gb|AFW76705.1| GAMYB-binding protein [Zea mays]
Length=536

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P  QCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCN+DQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  479  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIK  534



>gb|AIB05667.1| TRAF transcription factor, partial [Zea mays]
Length=536

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 154/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P  QCI YLDLKREEC  L
Sbjct  361  YKADAPHRQRALAAD--VMTCRKYAERAYKYRPLKVVEFDRPYRQCIAYLDLKREECSRL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCN+DQQS+F+CFGLFLGMQEKGS S  VDYEFAART+
Sbjct  419  FPSGRIYSQAFHLAGQGFFLSAHCNVDQQSAFYCFGLFLGMQEKGSTSVTVDYEFAARTR  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            P+ E+VSKYKG YTFTGGKAVGYRNLF IPW  F+ DDS +F++G+LHLRAELTI+
Sbjct  479  PSGEFVSKYKGYYTFTGGKAVGYRNLFAIPWPLFMADDSLFFIDGVLHLRAELTIK  534



>emb|CAD23158.1| hypothetical protein [Oryza sativa]
Length=163

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  655  RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNLFPAGRVYSQAFHLGGQGFFLS  476
            ++F ERAYKYRP+KVVEF+ P PQCI YL LKREEC  LFP+GR+YSQAFHL GQGFFLS
Sbjct  5    QKFAERAYKYRPLKVVEFDRPYPQCIAYLGLKREECSRLFPSGRMYSQAFHLAGQGFFLS  64

Query  475  AHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKPTEEYVSKYKGNYTFTGGKAV  296
            AHCNM+QQS+F+CFGLFLGMQEKGS+S  VDYEFAART P+ E+VSKYKGNYTFTGGKAV
Sbjct  65   AHCNMEQQSTFYCFGLFLGMQEKGSMSVTVDYEFAARTSPSGEFVSKYKGNYTFTGGKAV  124

Query  295  GYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            GYRNLF IPW+ F+ DDS +F++G+LHLRAELTI+
Sbjct  125  GYRNLFAIPWSTFMADDSLFFLDGVLHLRAELTIK  159



>gb|EPS71516.1| hypothetical protein M569_03239, partial [Genlisea aurea]
Length=559

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  649  FVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNLFPAGRVYSQAFHLGGQGFFLSAH  470
            FVERAY+YRPVKVV F+LPRPQC+VYLDLKREEC  L+P+GRVYSQAFHLGGQGFFLSAH
Sbjct  407  FVERAYRYRPVKVVVFDLPRPQCVVYLDLKREECERLYPSGRVYSQAFHLGGQGFFLSAH  466

Query  469  CNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKPTEEYVSKYKGNYTFTGGKAVGY  290
            CNMDQQSS  CFGLFLGMQEKGSV+F VDYEFAART+ +EE+VSKYKGNYTFTGGKAVGY
Sbjct  467  CNMDQQSSTPCFGLFLGMQEKGSVTFTVDYEFAARTRSSEEFVSKYKGNYTFTGGKAVGY  526

Query  289  RNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            RNLF I W+ F+ +DS YF+NG+LHLRAELT++
Sbjct  527  RNLFSISWSTFMAEDSVYFINGMLHLRAELTVK  559



>ref|XP_010314497.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Solanum lycopersicum]
Length=537

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L A+E N S   FVERAYK+RP+KV+ FELP  QCIVYLDL R+EC NL
Sbjct  361  FKAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNL  420

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YS+AFHLGGQGF+LSA CNMDQQ+SFH FG+FL MQE+G  +F VD++FAA T 
Sbjct  421  FPAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTT  480

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             +E+YVS++KG++TFT GK VG+RNL GIPWT F+   S YF+NG+L LRA LT R
Sbjct  481  LSEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTAR  536



>ref|XP_004252576.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=555

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L A+E N S   FVERAYK+RP+KV+ FELP  QCIVYLDL R+EC NL
Sbjct  379  FKAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNL  438

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YS+AFHLGGQGF+LSA CNMDQQ+SFH FG+FL MQE+G  +F VD++FAA T 
Sbjct  439  FPAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTT  498

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             +E+YVS++KG++TFT GK VG+RNL GIPWT F+   S YF+NG+L LRA LT R
Sbjct  499  LSEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTAR  554



>ref|XP_010314496.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Solanum lycopersicum]
Length=553

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQR L A+E N S   FVERAYK+RP+KV+ FELP  QCIVYLDL R+EC NL
Sbjct  377  FKAEAPHRQRLLVAEEGNASCSSFVERAYKFRPIKVLNFELPFQQCIVYLDLNRQECNNL  436

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGR+YS+AFHLGGQGF+LSA CNMDQQ+SFH FG+FL MQE+G  +F VD++FAA T 
Sbjct  437  FPAGRIYSEAFHLGGQGFYLSARCNMDQQNSFHWFGMFLSMQEQGLETFTVDFDFAALTT  496

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
             +E+YVS++KG++TFT GK VG+RNL GIPWT F+   S YF+NG+L LRA LT R
Sbjct  497  LSEDYVSRFKGSHTFTRGKGVGFRNLVGIPWTTFIAQGSVYFINGVLRLRAVLTAR  552



>ref|XP_002983257.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ15599.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQ+ +  +E  I  +RF ERAYKYRPVKVVEF+ P  QC+V+LDL++EECL L
Sbjct  362  FKAEPPHRQKHIMVEE--IVHKRFSERAYKYRPVKVVEFDAPYQQCLVFLDLRKEECLTL  419

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P GRVYSQAFHLGGQ FFLSAHC++DQQ++ HCFGLFLGMQEKGSVSFAV+YEFAAR+K
Sbjct  420  WPQGRVYSQAFHLGGQCFFLSAHCSVDQQTAAHCFGLFLGMQEKGSVSFAVEYEFAARSK  479

Query  358  PTE-EYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              E ++  + KGNY FTGGKAVGYRNLF  PW   + DDS YF   +LHLRAELTI+
Sbjct  480  QEEWKFAPRVKGNYVFTGGKAVGYRNLFSCPWQELMKDDSDYFHQNVLHLRAELTIK  536



>ref|XP_002961299.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ38838.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE P+RQ+ +  +E  I  +RF ERAYKYRPVKVVEF+ P  QC+V+LDL++EECL L
Sbjct  362  FKAEPPHRQKHIMVEE--IVHKRFSERAYKYRPVKVVEFDAPYQQCLVFLDLRKEECLTL  419

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P GRVYSQAFHLGGQ FFLSAHC++DQQ++ HCFGLFLGMQEKGSVSFAV+YEFAAR+K
Sbjct  420  WPQGRVYSQAFHLGGQCFFLSAHCSVDQQTAAHCFGLFLGMQEKGSVSFAVEYEFAARSK  479

Query  358  PTE-EYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
              E ++  + KGNY FTGGKAVGYRNLF  PW   + DDS YF   +LHLRAELTI+
Sbjct  480  QEEWKFAPRVKGNYVFTGGKAVGYRNLFSCPWQELMKDDSDYFHQNVLHLRAELTIK  536



>emb|CDY42028.1| BnaC04g01060D [Brassica napus]
Length=507

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  607  EFELPRPQCIVYLDLKREECLNLFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL  428
            + E+   QC+VYLDLKREEC  LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL
Sbjct  364  DHEVASKQCVVYLDLKREECTGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL  423

Query  427  FLGMQEKGSVSFAVDYEFAARTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGD  248
            FLGMQEKG+VSF VDYEFAAR KP+++Y  KYKGNYTFTGGKAVGYRNLFGIPWT+F+ +
Sbjct  424  FLGMQEKGAVSFGVDYEFAAREKPSQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFIAE  483

Query  247  DSHYFMNGILHLRAELTIR  191
            DS YF++GILHLRAELTI+
Sbjct  484  DSQYFIDGILHLRAELTIK  502



>emb|CDX80003.1| BnaA05g01530D [Brassica napus]
Length=513

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -1

Query  607  EFELPRPQCIVYLDLKREECLNLFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL  428
            + E+   QC+VYLDLKREEC  LFP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL
Sbjct  370  DHEVASKQCVVYLDLKREECTGLFPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGL  429

Query  427  FLGMQEKGSVSFAVDYEFAARTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGD  248
            FLGMQEKG+VSF VDYEFAAR KP+++Y  KYKGNYTFTGGKAVGYRNLFGIPWT+F+ +
Sbjct  430  FLGMQEKGAVSFGVDYEFAAREKPSQDYACKYKGNYTFTGGKAVGYRNLFGIPWTSFIAE  489

Query  247  DSHYFMNGILHLRAELTIR  191
            DS YF++GILHLRAELTI+
Sbjct  490  DSQYFIDGILHLRAELTIK  508



>ref|XP_001771535.1| predicted protein [Physcomitrella patens]
 gb|EDQ63735.1| predicted protein [Physcomitrella patens]
Length=539

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 141/176 (80%), Gaps = 3/176 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE  +RQR LA +E     +R+ ERAYKYRPVKVV+F+    QC+VYLDLK +EC  L
Sbjct  362  FKAEPSHRQRQLAMEET--MHKRYCERAYKYRPVKVVDFDTS-SQCLVYLDLKLDECRAL  418

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P GRVY+QAFHLGGQGFFLSAHCN+DQQ  + CFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  419  YPQGRVYTQAFHLGGQGFFLSAHCNLDQQGQYKCFGLFLGMQEKGSVSFAVDYEFAARMK  478

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PT E+  K KG+Y FTGGKAVGYRNLFG+ W  F+ + S YF N I+HLRAELTI+
Sbjct  479  PTWEFTPKSKGSYVFTGGKAVGYRNLFGMQWQDFIAEGSPYFRNNIVHLRAELTIK  534



>ref|XP_001760430.1| predicted protein [Physcomitrella patens]
 gb|EDQ74821.1| predicted protein [Physcomitrella patens]
Length=542

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 142/176 (81%), Gaps = 3/176 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE  +RQR LA +E     +R+ ERAYKYRPVKVV+F+    QC+VYLDLK +EC  L
Sbjct  366  FKAEPSHRQRQLAMEET--MHKRYCERAYKYRPVKVVDFDTS-SQCLVYLDLKIDECRAL  422

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P GRVYSQAFHLGGQGFFLSAHCN+DQQ    CFGLFLGMQEKGSVSFAVDYEFAAR K
Sbjct  423  YPQGRVYSQAFHLGGQGFFLSAHCNLDQQGQCKCFGLFLGMQEKGSVSFAVDYEFAARMK  482

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PT E++ K KG+Y FTGGKAVGYRNLFG+ W  F+ ++S YF + I+HLRAELTI+
Sbjct  483  PTWEFMPKSKGSYVFTGGKAVGYRNLFGMQWQDFIAEESPYFRDSIVHLRAELTIK  538



>gb|AAO25541.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   245 bits (625),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 2/147 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KA+AP+RQR+LAAD   ++ R++ ERAYKYRP+KVVEF+ P PQCI YLDLKREEC  L
Sbjct  99   YKADAPHRQRALAAD--VLTCRKYTERAYKYRPLKVVEFDQPYPQCIAYLDLKREECSRL  156

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GR+YSQAFHL GQGFFLSAHCNMDQQS+FHCFGLFLGMQEKGS S  VDYEFAART+
Sbjct  157  FPSGRIYSQAFHLAGQGFFLSAHCNMDQQSAFHCFGLFLGMQEKGSTSVTVDYEFAARTR  216

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLF  278
            P+ ++VSKYKG YTFTGGKAVGYRNLF
Sbjct  217  PSGDFVSKYKGYYTFTGGKAVGYRNLF  243



>gb|KJB52236.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=514

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FK+E P+RQR+LAA+EAN ++RRFVERAYKYRPVKVVEFELPR QC+VYLDLKREEC +L
Sbjct  386  FKSEMPHRQRALAAEEANATYRRFVERAYKYRPVKVVEFELPRQQCVVYLDLKREECTHL  445

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQE+GSV+FAVDYEFAAR+K
Sbjct  446  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQERGSVTFAVDYEFAARSK  505

Query  358  PTEEY  344
            PTE+Y
Sbjct  506  PTEDY  510



>gb|ADG38648.1| AT3G61600-like protein, partial [Capsella grandiflora]
 gb|AEN82262.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82263.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82264.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82265.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82267.1| AT3G61600-like protein, partial [Capsella rubella]
Length=174

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E     RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREECL L
Sbjct  53   FKAEAPHRQRSLAAEETASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGL  112

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  113  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  172

Query  358  PT  353
            P 
Sbjct  173  PA  174



>gb|AEN82266.1| AT3G61600-like protein, partial [Capsella rubella]
 gb|AEN82268.1| AT3G61600-like protein, partial [Capsella rubella]
Length=174

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E     RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREECL L
Sbjct  53   FKAEAPHRQRSLAAEETASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGL  112

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  113  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  172

Query  358  PT  353
            P 
Sbjct  173  PA  174



>gb|ADG38647.1| AT3G61600-like protein, partial [Capsella grandiflora]
 gb|ADG38649.1| AT3G61600-like protein, partial [Capsella grandiflora]
 gb|ADG38650.1| AT3G61600-like protein, partial [Capsella grandiflora]
 gb|ADG38651.1| AT3G61600-like protein, partial [Capsella grandiflora]
Length=174

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E     RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREECL L
Sbjct  53   FKAEAPHRQRSLAAEEXASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECLGL  112

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  113  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  172

Query  358  PT  353
            P 
Sbjct  173  PA  174



>gb|ADG38652.1| AT3G61600-like protein, partial [Neslia paniculata]
Length=174

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAEAP+RQRSLAA+E+    RR +ERAYKYRPVKVVEFELPRPQC+VYLDLKREEC  L
Sbjct  53   FKAEAPHRQRSLAAEESASLNRRLIERAYKYRPVKVVEFELPRPQCVVYLDLKREECAGL  112

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP+GRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSF VDYEF+AR+K
Sbjct  113  FPSGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFGVDYEFSARSK  172

Query  358  PT  353
            P 
Sbjct  173  PA  174



>ref|NP_192025.2| BTB/POZ/Kelch-associated protein [Arabidopsis thaliana]
 gb|AEE81989.1| BTB/POZ/Kelch-associated protein [Arabidopsis thaliana]
Length=505

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 3/179 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FK E+   Q  L A E   S  RRF +RAY +RP+K+VEF +PRPQCI+YLDLKR+EC +
Sbjct  326  FKTESLAHQHVLLAHEQPASTSRRFAKRAYVHRPIKIVEFAVPRPQCIIYLDLKRKECES  385

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG--SVSFAVDYEFAA  368
            ++P+ R+ SQ F LGGQGFFLSA CNMD     HCFGLF+GMQE G  S S  VDY+F+ 
Sbjct  386  IYPSSRISSQQFTLGGQGFFLSAQCNMDHLCLIHCFGLFIGMQENGSASASVTVDYDFSV  445

Query  367  RTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            R+KPT E+V K+KG YTFT GKAVG RNL GIPW  F   +  YF+N +LHLRA+L+IR
Sbjct  446  RSKPTMEFVGKFKGIYTFTRGKAVGCRNLLGIPWDIFTAKNCPYFINDVLHLRADLSIR  504



>sp|O04615.1|Y4116_ARATH RecName: Full=BTB/POZ domain-containing protein At4g01160 [Arabidopsis 
thaliana]
 gb|AAB61041.1| A_IG002N01.11 gene product [Arabidopsis thaliana]
 emb|CAB80925.1| predicted protein [Arabidopsis thaliana]
Length=527

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 3/179 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISF-RRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FK E+   Q  L A E   S  RRF +RAY +RP+K+VEF +PRPQCI+YLDLKR+EC +
Sbjct  348  FKTESLAHQHVLLAHEQPASTSRRFAKRAYVHRPIKIVEFAVPRPQCIIYLDLKRKECES  407

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKG--SVSFAVDYEFAA  368
            ++P+ R+ SQ F LGGQGFFLSA CNMD     HCFGLF+GMQE G  S S  VDY+F+ 
Sbjct  408  IYPSSRISSQQFTLGGQGFFLSAQCNMDHLCLIHCFGLFIGMQENGSASASVTVDYDFSV  467

Query  367  RTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            R+KPT E+V K+KG YTFT GKAVG RNL GIPW  F   +  YF+N +LHLRA+L+IR
Sbjct  468  RSKPTMEFVGKFKGIYTFTRGKAVGCRNLLGIPWDIFTAKNCPYFINDVLHLRADLSIR  526



>ref|XP_002872906.1| A_IG002N01.11 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49165.1| A_IG002N01.11 protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRR-FVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLN  542
            FK E+   QR L A E   S  R F +RAY  RP+K+VEF  PRPQCI+YLDLKR+EC +
Sbjct  325  FKTESLAHQRFLLAHEQPASTSRWFAKRAYVQRPIKIVEFAAPRPQCIIYLDLKRKECES  384

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVS--FAVDYEFAA  368
            ++PA R+ SQ F LGGQGFFLSA CNMD     HCFGLF+GMQE GS S    VDYEF+ 
Sbjct  385  IYPASRISSQPFTLGGQGFFLSAQCNMDHLCIIHCFGLFIGMQENGSASATVTVDYEFSV  444

Query  367  RTKPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            R+KPT E+V K+KGNYTF+ GKAVG RNL  IPW  F   +  YF+N +LHLRA+L+IR
Sbjct  445  RSKPTMEFVGKFKGNYTFSRGKAVGCRNLLAIPWDIFTAKNCPYFINDVLHLRADLSIR  503



>ref|XP_007158553.1| hypothetical protein PHAVU_002G162000g, partial [Phaseolus vulgaris]
 gb|ESW30547.1| hypothetical protein PHAVU_002G162000g, partial [Phaseolus vulgaris]
Length=517

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 1/177 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRP-VKVVEFELPRPQCIVYLDLKREECLN  542
            FKAE P R+RSLAA +A  +  R+VERAY +R  VK+VEF LPRP  ++YLDLK+EEC  
Sbjct  340  FKAETPCRKRSLAAQDAGTTCSRYVERAYMHRQRVKLVEFALPRPGGVIYLDLKKEECAQ  399

Query  541  LFPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAART  362
             FP GR++S+AFHLG + FFLS  C++D  + F+CFGLFL ++ K S S  V+ EFAAR+
Sbjct  400  CFPNGRIHSKAFHLGKELFFLSVGCDVDHHNPFYCFGLFLAVKLKESDSLGVECEFAARS  459

Query  361  KPTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            K TEEY++  KG YTFTGGK VG+RNLF IPWT F+ +DS YF+ G+LHLRAELTIR
Sbjct  460  KFTEEYITIRKGIYTFTGGKVVGHRNLFAIPWTTFIAEDSQYFIKGLLHLRAELTIR  516



>ref|XP_006343901.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=494

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAE PY+Q  +AA   N   +R+VERAYK RPVK +EFE P  Q +VYLDLK +EC NL
Sbjct  317  YKAEPPYQQGEIAARVENTFNKRYVERAYKLRPVKALEFEAPHQQSVVYLDLKNDECTNL  376

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FP G+++SQ FHLGGQ  FLSAHCN++QQ  +HC GLFLGMQ + S   AVDYEF+ R +
Sbjct  377  FPEGKIFSQGFHLGGQELFLSAHCNIEQQGVYHCLGLFLGMQGEESEPLAVDYEFSVRVR  436

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P  E+VS YKG++T + G  VG  NL G+ W  F+ +DS YF++ ILH+RA++T+
Sbjct  437  PDNEFVSMYKGSHTLSSGIVVGCHNLCGVTWIPFLSEDSLYFIDEILHIRADITV  491



>gb|AFK44513.1| unknown [Lotus japonicus]
Length=199

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -1

Query  694  QRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNLFPAGRVYS  515
            Q+SL A  +  S  RFVERAYKYRPVKVVEFE+PR QC+VYLDLKREEC  LFP+GRV S
Sbjct  33   QQSLTASASLNS--RFVERAYKYRPVKVVEFEVPRQQCVVYLDLKREECAALFPSGRVKS  90

Query  514  QAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTKPTEEYVSK  335
            Q FHL G+ F L   C+++++ +  CF L +GM++K S SF VD EFAAR++P +E+V+K
Sbjct  91   QTFHLCGRKFLLLGACSLNKRGTSRCFELAVGMKKKSSGSFVVDCEFAARSRPAKEFVTK  150

Query  334  YKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            YK +YTFTGG  VG  NLF + W+ F+ +DS +F+NG+LHL+AE T+R
Sbjct  151  YKSHYTFTGGTFVGTGNLFKVTWSKFMAEDSPFFINGVLHLKAEFTVR  198



>ref|XP_006396293.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum]
 gb|ESQ37746.1| hypothetical protein EUTSA_v10028626mg [Eutrema salsugineum]
Length=476

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            FKAE+   +R  A  + +   R F ERAY++RP+KVVEFE+PR QCIV+LDLK+ EC +L
Sbjct  300  FKAESVTLRRQFATAQPSPYKRWFFERAYRFRPIKVVEFEVPRRQCIVFLDLKQNECADL  359

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            +P+ R+ SQ F LGGQ F LSA CNMDQ +  H FGL++ M   GS+S  VDYEF+AR+K
Sbjct  360  YPSSRILSQRFPLGGQEFHLSADCNMDQLNLSHRFGLYIWMH--GSMSLTVDYEFSARSK  417

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTIR  191
            PTE++  K +G YTFTGGKA+G+R++F  PW +F+ +DS YF+N +LHLRAEL+IR
Sbjct  418  PTEDFAVKCRGKYTFTGGKAIGFRDMFATPWDSFIAEDSPYFINDVLHLRAELSIR  473



>ref|XP_006344016.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=459

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 4/175 (2%)
 Frame = -1

Query  718  FKAEAPYRQRSLAADEANISFRRFVERAYKYRPVKVVEFELPRPQCIVYLDLKREECLNL  539
            +KAE PY+QR++AA   N    R+VERAYK RPVK +EFE P    +VYLDLKR+EC  L
Sbjct  286  YKAEEPYQQRAIAAKLGN----RYVERAYKLRPVKALEFEAPHQHSVVYLDLKRDECAIL  341

Query  538  FPAGRVYSQAFHLGGQGFFLSAHCNMDQQSSFHCFGLFLGMQEKGSVSFAVDYEFAARTK  359
            FPAG++YSQ FH GGQ  FLSAHCN+DQQ   HC GLFLGMQ + S   AVDYEF+ R +
Sbjct  342  FPAGKLYSQGFHFGGQELFLSAHCNIDQQGFQHCLGLFLGMQGEESDPLAVDYEFSVRLR  401

Query  358  PTEEYVSKYKGNYTFTGGKAVGYRNLFGIPWTAFVGDDSHYFMNGILHLRAELTI  194
            P  E+V+ YKG++T   G  VG RNL  I WT F+  D  YF+NG+LH+RAE+T+
Sbjct  402  PDNEFVNMYKGSHTLNSGIVVGCRNLCDIGWTPFLNADGLYFINGVLHIRAEITV  456



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410