BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF001L13

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            335   2e-109   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            330   2e-107   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       329   4e-107   Solanum tuberosum [potatoes]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            328   1e-106   Solanum lycopersicum
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                318   1e-102   Erythranthe guttata [common monkey flower]
emb|CDP02851.1|  unnamed protein product                                316   9e-102   Coffea canephora [robusta coffee]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            309   3e-99    Sesamum indicum [beniseed]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            296   4e-94    Vitis vinifera
emb|CAN75200.1|  hypothetical protein VITISV_014887                     296   2e-93    Vitis vinifera
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    293   4e-93    Theobroma cacao [chocolate]
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            293   4e-93    Fragaria vesca subsp. vesca
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             293   5e-93    Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            293   6e-93    Prunus mume [ume]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            291   3e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    289   3e-91    
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       284   8e-91    Populus euphratica
gb|EPS71160.1|  hypothetical protein M569_03591                         284   8e-90    Genlisea aurea
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    285   2e-89    Populus euphratica
emb|CBI36578.3|  unnamed protein product                                283   5e-89    Vitis vinifera
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    283   5e-89    Citrus sinensis [apfelsine]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         283   7e-89    Jatropha curcas
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             283   8e-89    Citrus clementina [clementine]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            283   9e-89    Pyrus x bretschneideri [bai li]
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            283   1e-88    Vitis vinifera
ref|XP_002528403.1|  serine carboxypeptidase, putative                  282   1e-88    Ricinus communis
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            281   2e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            281   4e-88    
gb|AFK34001.1|  unknown                                                 273   4e-88    Medicago truncatula
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       278   3e-87    Eucalyptus grandis [rose gum]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            278   3e-87    Eucalyptus grandis [rose gum]
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    278   4e-87    Phoenix dactylifera
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             277   1e-86    Phaseolus vulgaris [French bean]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         276   3e-86    Gossypium arboreum [tree cotton]
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       276   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       275   9e-86    Setaria italica
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       275   9e-86    Medicago truncatula
gb|KEH38195.1|  serine carboxypeptidase-like protein                    273   2e-85    Medicago truncatula
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       273   3e-85    Medicago truncatula
gb|ACF84647.1|  unknown                                                 266   5e-85    Zea mays [maize]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            272   7e-85    Elaeis guineensis
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               272   7e-85    Medicago truncatula
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             272   2e-84    Citrus clementina [clementine]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             271   2e-84    
gb|KHN02055.1|  Serine carboxypeptidase II-2                            271   2e-84    Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       271   4e-84    Glycine max [soybeans]
ref|NP_001057009.1|  Os06g0186400                                       271   4e-84    
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   265   5e-83    
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       267   7e-83    Musa acuminata subsp. malaccensis [pisang utan]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    265   1e-82    Hordeum vulgare [barley]
dbj|BAJ99024.1|  predicted protein                                      266   2e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          265   3e-82    Zea mays [maize]
gb|KJB76659.1|  hypothetical protein B456_012G098600                    265   8e-82    Gossypium raimondii
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    264   9e-82    Cucumis sativus [cucumbers]
dbj|BAK02147.1|  predicted protein                                      264   1e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24285.1|  unknown                                                 263   1e-81    Picea sitchensis
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            263   2e-81    Brachypodium distachyon [annual false brome]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            263   3e-81    Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       265   3e-81    Cucumis sativus [cucumbers]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       263   4e-81    Cicer arietinum [garbanzo]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       262   7e-81    Oryza brachyantha
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    260   3e-80    
ref|XP_003596536.1|  Serine carboxypeptidase                            262   6e-80    
gb|AES66787.2|  serine carboxypeptidase-like protein                    259   6e-80    Medicago truncatula
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          258   3e-79    Amborella trichopoda
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         255   3e-78    
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         256   3e-78    Tarenaya hassleriana [spider flower]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         254   8e-78    Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          253   1e-77    Brassica napus [oilseed rape]
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       248   2e-77    
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         253   3e-77    Brassica rapa
emb|CDX68696.1|  BnaC01g07570D                                          253   5e-77    
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         245   1e-76    Tarenaya hassleriana [spider flower]
emb|CDX72270.1|  BnaC07g42920D                                          255   2e-76    
emb|CDY28217.1|  BnaA01g06320D                                          249   4e-76    Brassica napus [oilseed rape]
emb|CDY23258.1|  BnaA08g12880D                                          248   1e-75    Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          248   2e-75    Brassica napus [oilseed rape]
dbj|BAH20278.1|  AT4G30810                                              244   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         247   3e-75    Nelumbo nucifera [Indian lotus]
gb|ACF79757.1|  unknown                                                 247   4e-75    Zea mays [maize]
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               247   4e-75    Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    247   4e-75    
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         245   2e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         244   3e-74    Sesamum indicum [beniseed]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       245   3e-74    Arabidopsis thaliana [mouse-ear cress]
emb|CDY28216.1|  BnaA01g06330D                                          245   3e-74    Brassica napus [oilseed rape]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    244   4e-74    Arabis alpina [alpine rockcress]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         244   4e-74    Brassica rapa
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         244   5e-74    
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             244   7e-74    Eutrema salsugineum [saltwater cress]
gb|AIN39846.1|  hypothetical protein                                    234   7e-74    Zoysia matrella [Japanese carpet grass]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             243   1e-73    
emb|CDX68695.1|  BnaC01g07580D                                          243   1e-73    
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         239   2e-73    
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          242   2e-73    Sorghum bicolor [broomcorn]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          242   2e-73    Amborella trichopoda
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          243   3e-73    Setaria italica
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         241   3e-73    Nelumbo nucifera [Indian lotus]
dbj|BAK06862.1|  predicted protein                                      234   6e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    241   7e-73    Glycine max [soybeans]
emb|CDO99730.1|  unnamed protein product                                241   7e-73    Coffea canephora [robusta coffee]
dbj|BAO04184.1|  hypothetical protein                                   240   9e-73    Delphinium grandiflorum
gb|KJB78938.1|  hypothetical protein B456_013G026200                    240   2e-72    Gossypium raimondii
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         239   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         239   3e-72    Malus domestica [apple tree]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         239   4e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             239   6e-72    Capsella rubella
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         238   6e-72    Populus trichocarpa [western balsam poplar]
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       237   7e-72    Oryza brachyantha
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          238   8e-72    Sorghum bicolor [broomcorn]
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    238   8e-72    Setaria italica
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         238   9e-72    Gossypium arboreum [tree cotton]
gb|AFK43035.1|  unknown                                                 238   1e-71    Medicago truncatula
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         238   1e-71    Jatropha curcas
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          238   1e-71    Brachypodium distachyon [annual false brome]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         239   1e-71    Camelina sativa [gold-of-pleasure]
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               238   1e-71    Medicago truncatula
gb|ABK21145.1|  unknown                                                 234   2e-71    Picea sitchensis
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         237   2e-71    Populus euphratica
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         236   3e-71    Nicotiana sylvestris
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         236   3e-71    Nicotiana tomentosiformis
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         236   4e-71    Brachypodium distachyon [annual false brome]
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         236   4e-71    Phoenix dactylifera
ref|NP_001044713.1|  Os01g0833500                                       236   5e-71    
gb|EAY76388.1|  hypothetical protein OsI_04319                          236   5e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    236   5e-71    Glycine max [soybeans]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         236   5e-71    Glycine soja [wild soybean]
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         236   5e-71    Populus euphratica
ref|NP_001042076.1|  Os01g0158200                                       236   6e-71    
emb|CAN74854.1|  hypothetical protein VITISV_028701                     236   6e-71    Vitis vinifera
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             235   7e-71    Eutrema salsugineum [saltwater cress]
gb|KJB76568.1|  hypothetical protein B456_012G094900                    231   8e-71    Gossypium raimondii
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    236   9e-71    Cicer arietinum [garbanzo]
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             233   9e-71    
dbj|BAJ99174.1|  predicted protein                                      235   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB08188.1|  unnamed protein product                                236   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    235   1e-70    
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             235   2e-70    Phaseolus vulgaris [French bean]
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              231   2e-70    
gb|AAV43957.1|  putative serine carboxypeptidase II                     235   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         234   2e-70    Vitis vinifera
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         234   2e-70    Elaeis guineensis
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         226   2e-70    Tarenaya hassleriana [spider flower]
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         234   3e-70    Triticum urartu
gb|EEC69980.1|  hypothetical protein OsI_00486                          234   3e-70    Oryza sativa Indica Group [Indian rice]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   233   6e-70    Citrus sinensis [apfelsine]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    233   7e-70    Solanum tuberosum [potatoes]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         233   8e-70    Prunus mume [ume]
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    233   8e-70    Oryza brachyantha
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         233   8e-70    Populus trichocarpa [western balsam poplar]
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          234   9e-70    Setaria italica
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         233   9e-70    Camelina sativa [gold-of-pleasure]
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    233   1e-69    Zea mays [maize]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         232   1e-69    Brassica rapa
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               233   1e-69    
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         232   1e-69    Fragaria vesca subsp. vesca
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    233   1e-69    
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               232   2e-69    Medicago truncatula
emb|CDY32091.1|  BnaC04g44750D                                          231   2e-69    Brassica napus [oilseed rape]
emb|CDY40438.1|  BnaA04g20790D                                          231   2e-69    Brassica napus [oilseed rape]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             231   3e-69    Citrus clementina [clementine]
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          232   3e-69    Sorghum bicolor [broomcorn]
gb|KJB76569.1|  hypothetical protein B456_012G094900                    231   3e-69    Gossypium raimondii
gb|KJB76563.1|  hypothetical protein B456_012G094900                    231   4e-69    Gossypium raimondii
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   231   4e-69    
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         231   4e-69    
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         231   5e-69    Gossypium arboreum [tree cotton]
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          231   5e-69    Zea mays [maize]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         231   6e-69    Tarenaya hassleriana [spider flower]
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    231   7e-69    Zea mays [maize]
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         230   7e-69    Solanum lycopersicum
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         230   1e-68    Pyrus x bretschneideri [bai li]
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          230   1e-68    Sorghum bicolor [broomcorn]
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    230   1e-68    Arabis alpina [alpine rockcress]
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          230   1e-68    Brachypodium distachyon [annual false brome]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         230   2e-68    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU19747.1|  unknown                                                 224   2e-68    Glycine max [soybeans]
emb|CDY35977.1|  BnaA05g29730D                                          229   2e-68    Brassica napus [oilseed rape]
ref|NP_001151874.1|  LOC100285510 precursor                             229   2e-68    
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 229   2e-68    
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             229   2e-68    Eutrema salsugineum [saltwater cress]
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    229   3e-68    
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    229   3e-68    Setaria italica
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         229   3e-68    Camelina sativa [gold-of-pleasure]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    229   3e-68    Brassica rapa
emb|CDY28004.1|  BnaC05g44060D                                          229   3e-68    Brassica napus [oilseed rape]
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            229   4e-68    
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         228   4e-68    Cucumis melo [Oriental melon]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         229   5e-68    Elaeis guineensis
ref|NP_187456.1|  serine carboxypeptidase-like 27                       228   5e-68    Arabidopsis thaliana [mouse-ear cress]
gb|EMS66624.1|  Serine carboxypeptidase II-1                            225   5e-68    Triticum urartu
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         228   6e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         228   7e-68    Elaeis guineensis
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   227   7e-68    
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    224   7e-68    Hordeum vulgare [barley]
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    228   8e-68    
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     228   8e-68    Eucalyptus grandis [rose gum]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         227   1e-67    Camelina sativa [gold-of-pleasure]
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             227   1e-67    
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    227   1e-67    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM82001.1|  unnamed protein product                                227   2e-67    Triticum aestivum [Canadian hard winter wheat]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                225   3e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         228   3e-67    Eucalyptus grandis [rose gum]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             226   3e-67    Arabidopsis lyrata subsp. lyrata
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    226   3e-67    Cucumis sativus [cucumbers]
emb|CDP11023.1|  unnamed protein product                                227   3e-67    Coffea canephora [robusta coffee]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         226   5e-67    Camelina sativa [gold-of-pleasure]
gb|EMT12249.1|  Serine carboxypeptidase 2                               225   7e-67    
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          227   1e-66    
dbj|BAK02399.1|  predicted protein                                      224   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    224   4e-66    Glycine max [soybeans]
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         224   4e-66    Glycine soja [wild soybean]
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          223   5e-66    Arabidopsis lyrata subsp. petraea
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             221   2e-65    
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             221   2e-65    Capsella rubella
emb|CAI64396.1|  serine carboxypeptidase II                             214   7e-65    Triticum aestivum [Canadian hard winter wheat]
gb|AES62200.2|  serine carboxypeptidase-like protein                    221   9e-65    Medicago truncatula
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    219   1e-64    Phoenix dactylifera
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         219   2e-64    Camelina sativa [gold-of-pleasure]
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             216   2e-64    Phaseolus vulgaris [French bean]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         218   2e-64    Camelina sativa [gold-of-pleasure]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    218   3e-64    Glycine max [soybeans]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         218   4e-64    Camelina sativa [gold-of-pleasure]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         217   1e-63    Glycine max [soybeans]
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  214   1e-63    Citrus sinensis [apfelsine]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   1e-63    Fragaria vesca subsp. vesca
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    216   2e-63    Arabis alpina [alpine rockcress]
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    216   2e-63    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          216   2e-63    
gb|KHN42831.1|  Serine carboxypeptidase 24                              216   3e-63    Glycine soja [wild soybean]
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         212   4e-63    
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   4e-63    Fragaria vesca subsp. vesca
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             216   5e-63    Citrus clementina [clementine]
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         215   6e-63    Citrus sinensis [apfelsine]
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         208   9e-63    Jatropha curcas
ref|NP_181121.1|  serine carboxypeptidase-like 26                       214   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KJB76567.1|  hypothetical protein B456_012G094900                    214   1e-62    Gossypium raimondii
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    211   3e-62    
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          214   3e-62    
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    203   6e-62    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              213   7e-62    Fragaria vesca subsp. vesca
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    202   7e-62    Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    202   8e-62    unidentified
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    202   9e-62    Triticum aestivum [Canadian hard winter wheat]
emb|CAN79972.1|  hypothetical protein VITISV_010072                     211   1e-61    Vitis vinifera
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    212   1e-61    
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              212   1e-61    Pyrus x bretschneideri [bai li]
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    211   1e-61    Arabis alpina [alpine rockcress]
emb|CDY39224.1|  BnaA03g50360D                                          211   2e-61    Brassica napus [oilseed rape]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    211   2e-61    Vitis vinifera
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    210   2e-61    Nelumbo nucifera [Indian lotus]
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              211   2e-61    Brassica rapa
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    210   3e-61    Nelumbo nucifera [Indian lotus]
ref|XP_010108549.1|  Serine carboxypeptidase 24                         211   3e-61    
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    207   4e-61    Elaeis guineensis
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             211   4e-61    Capsella rubella
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           209   7e-61    Arabidopsis thaliana [mouse-ear cress]
ref|NP_194790.1|  serine carboxypeptidase 24                            209   8e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             209   1e-60    Eutrema salsugineum [saltwater cress]
gb|KJB75608.1|  hypothetical protein B456_012G048700                    209   1e-60    Gossypium raimondii
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         203   1e-60    
emb|CDP02317.1|  unnamed protein product                                209   1e-60    Coffea canephora [robusta coffee]
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     209   1e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB07561.1|  hypothetical protein B456_001G032600                    207   1e-60    Gossypium raimondii
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         209   1e-60    Gossypium arboreum [tree cotton]
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             209   2e-60    Arabidopsis lyrata subsp. lyrata
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             208   2e-60    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         209   2e-60    Solanum lycopersicum
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          206   2e-60    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         208   2e-60    Nelumbo nucifera [Indian lotus]
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              208   2e-60    Tarenaya hassleriana [spider flower]
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   3e-60    Populus euphratica
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                207   5e-60    Gossypium arboreum [tree cotton]
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   207   5e-60    Populus trichocarpa [western balsam poplar]
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   5e-60    Cucumis melo [Oriental melon]
ref|XP_002529402.1|  serine carboxypeptidase, putative                  207   5e-60    Ricinus communis
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         207   5e-60    Vitis vinifera
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              207   5e-60    Prunus mume [ume]
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    207   5e-60    Hordeum vulgare [barley]
gb|KJB07564.1|  hypothetical protein B456_001G032600                    208   6e-60    Gossypium raimondii
gb|KJB07559.1|  hypothetical protein B456_001G032600                    208   6e-60    
emb|CBI21207.3|  unnamed protein product                                207   6e-60    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    208   6e-60    
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         207   6e-60    
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    206   7e-60    
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    207   7e-60    
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     205   8e-60    
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         207   8e-60    
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         207   9e-60    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    207   9e-60    
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             202   1e-59    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    207   1e-59    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         206   1e-59    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    206   2e-59    
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              204   2e-59    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             206   2e-59    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             206   2e-59    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    206   2e-59    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    206   2e-59    
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             201   2e-59    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         206   2e-59    
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         206   3e-59    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         205   3e-59    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          207   3e-59    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    205   4e-59    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         205   4e-59    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         205   5e-59    
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    204   7e-59    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         204   7e-59    
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    204   1e-58    
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         207   1e-58    
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          204   1e-58    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              204   1e-58    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    204   1e-58    
gb|EPS67928.1|  hypothetical protein M569_06845                         204   1e-58    
gb|AFK37459.1|  unknown                                                 204   1e-58    
emb|CDX76845.1|  BnaC08g34310D                                          202   1e-58    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         204   1e-58    
emb|CDP10248.1|  unnamed protein product                                203   2e-58    
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    204   2e-58    
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    204   2e-58    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         205   2e-58    
prf||1408163B  CPase II B                                               194   2e-58 
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             203   2e-58    
gb|ACF87497.1|  unknown                                                 199   2e-58    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         203   2e-58    
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    203   2e-58    
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         203   2e-58    
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    203   2e-58    
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    203   2e-58    
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         203   2e-58    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             203   3e-58    
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   202   3e-58    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    203   3e-58    
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             202   3e-58    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       203   3e-58    
gb|AAM65698.1|  putative serine carboxypeptidase II                     203   3e-58    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             203   4e-58    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             202   4e-58    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         202   5e-58    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         202   5e-58    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         202   6e-58    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         202   6e-58    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    202   7e-58    
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         202   7e-58    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          202   7e-58    
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          202   7e-58    
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         202   8e-58    
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    200   8e-58    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         202   9e-58    
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             201   1e-57    
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             201   1e-57    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    201   1e-57    
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    199   1e-57    
emb|CDY34805.1|  BnaA09g41720D                                          202   1e-57    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    201   2e-57    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         201   2e-57    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         201   3e-57    
ref|XP_002527614.1|  serine carboxypeptidase, putative                  199   3e-57    
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    201   3e-57    
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    200   3e-57    
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    200   3e-57    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       200   3e-57    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    200   3e-57    
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             200   3e-57    
gb|EMT08964.1|  Serine carboxypeptidase 2                               198   3e-57    
gb|AAC63669.1|  putative serine carboxypeptidase II                     199   4e-57    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    200   4e-57    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         199   5e-57    
ref|NP_179979.4|  serine carboxypeptidase-like 23                       199   5e-57    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         199   5e-57    
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    199   5e-57    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    199   5e-57    
gb|AAC63668.1|  putative serine carboxypeptidase II                     200   5e-57    
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    199   6e-57    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    199   7e-57    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    199   8e-57    
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         199   9e-57    
dbj|BAD19262.1|  putative carboxypeptidase D                            197   1e-56    
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    199   1e-56    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         198   1e-56    
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         198   2e-56    
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          196   2e-56    
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          198   2e-56    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          198   2e-56    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         197   3e-56    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              198   3e-56    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         197   3e-56    
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    197   4e-56    
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         197   5e-56    
gb|EAY87844.1|  hypothetical protein OsI_09265                          197   5e-56    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    197   5e-56    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                197   6e-56    
ref|NP_001048377.1|  Os02g0794500                                       197   7e-56    
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         194   7e-56    
emb|CDY43258.1|  BnaC05g48510D                                          197   8e-56    
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                196   1e-55    
ref|NP_001150705.1|  LOC100284338 precursor                             196   2e-55    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                195   2e-55    
gb|EPS59460.1|  hypothetical protein M569_15347                         189   3e-55    
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               195   4e-55    
ref|NP_001145702.1|  hypothetical protein                               191   6e-55    
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         194   6e-55    
dbj|BAD25095.1|  putative carboxypeptidase D                            191   9e-55    
dbj|BAJ85578.1|  predicted protein                                      194   9e-55    
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         184   1e-54    
ref|XP_001785856.1|  predicted protein                                  193   1e-54    
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    193   2e-54    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         193   2e-54    
dbj|BAJ92218.1|  predicted protein                                      194   2e-54    
ref|XP_001772135.1|  predicted protein                                  192   2e-54    
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             192   3e-54    
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    192   4e-54    
ref|XP_001755195.1|  predicted protein                                  190   6e-54    
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         192   7e-54    
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         191   9e-54    
ref|NP_001047514.1|  Os02g0634700                                       191   1e-53    
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         191   1e-53    
gb|EEC73659.1|  hypothetical protein OsI_08191                          191   1e-53    
ref|NP_001152245.1|  lysosomal protective protein precursor             191   1e-53    
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         191   2e-53    
ref|XP_004158226.1|  PREDICTED: serine carboxypeptidase-like 34-like    188   2e-53    
emb|CDY65614.1|  BnaCnng47980D                                          186   2e-53    
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         190   2e-53    
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          190   2e-53    
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  185   3e-53    
ref|XP_001765233.1|  predicted protein                                  189   3e-53    
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         190   3e-53    
emb|CDO99728.1|  unnamed protein product                                189   5e-53    
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     183   5e-53    
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         189   6e-53    
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    189   7e-53    
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         189   9e-53    
gb|ABR16596.1|  unknown                                                 189   1e-52    
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    188   1e-52    
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    186   1e-52    
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    188   1e-52    
gb|EMT14017.1|  Serine carboxypeptidase-like 34                         185   2e-52    
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         187   3e-52    
gb|ACU21427.1|  unknown                                                 181   3e-52    
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         183   3e-52    
emb|CAN70886.1|  hypothetical protein VITISV_009829                     184   5e-52    
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    185   6e-52    
gb|ABR16997.1|  unknown                                                 187   8e-52    
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    186   9e-52    
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    183   1e-51    
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         186   1e-51    
gb|AFK36150.1|  unknown                                                 179   1e-51    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    186   1e-51    
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             185   2e-51    
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    186   2e-51    
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             186   2e-51    
emb|CDX72256.1|  BnaC07g42780D                                          188   2e-51    
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         183   3e-51    
gb|EMS64875.1|  Serine carboxypeptidase 24                              184   3e-51    
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         184   4e-51    
ref|XP_011460258.1|  PREDICTED: serine carboxypeptidase-like 31         184   4e-51    
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             181   4e-51    
emb|CBI31484.3|  unnamed protein product                                184   4e-51    
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             184   4e-51    
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         184   4e-51    
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         184   5e-51    
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         182   7e-51    
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    183   1e-50    
ref|XP_002307165.1|  hypothetical protein POPTR_0005s09440g             182   2e-50    
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    182   2e-50    
ref|XP_006847851.1|  hypothetical protein AMTR_s00029p00066410          179   2e-50    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          182   2e-50    
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    182   2e-50    
ref|XP_007043282.1|  Serine carboxypeptidase-like 34 isoform 2          179   2e-50    
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         182   2e-50    
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    182   3e-50    
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    182   3e-50    
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                182   3e-50    
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                182   3e-50    
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    182   3e-50    
ref|XP_007131612.1|  hypothetical protein PHAVU_011G027900g             182   3e-50    
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             181   4e-50    
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         181   4e-50    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    181   5e-50    
gb|AFK45951.1|  unknown                                                 175   6e-50    
ref|XP_002962533.1|  serine carboxypeptidase-like enzyme                181   6e-50    
gb|EPS66906.1|  hypothetical protein M569_07869                         179   7e-50    
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    181   7e-50    
ref|XP_010686577.1|  PREDICTED: serine carboxypeptidase-like 31         181   8e-50    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    181   8e-50    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    181   9e-50    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    181   1e-49    
gb|KDP20921.1|  hypothetical protein JCGZ_21392                         180   1e-49    
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    180   1e-49    
ref|XP_002521402.1|  serine carboxypeptidase, putative                  180   2e-49    
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    180   2e-49    
ref|XP_010112533.1|  Serine carboxypeptidase-like 34                    179   2e-49    
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         180   2e-49    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               179   2e-49    
ref|XP_009401001.1|  PREDICTED: serine carboxypeptidase-like 34         179   2e-49    
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         179   3e-49    
ref|XP_010068957.1|  PREDICTED: serine carboxypeptidase-like 40         181   3e-49    
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    178   3e-49    
gb|KJB78939.1|  hypothetical protein B456_013G026200                    178   3e-49    
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         179   4e-49    



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A++E+G+ID+YSIFTPTCT  FS+++ +LKR +R VG LRR YDPCTE+HS IYFNL
Sbjct  270  LDQANEEVGNIDSYSIFTPTCTAKFSMLNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHVH  NSSF+WV CS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAV
Sbjct  329  PEVQEALHVHKRNSSFKWVACSEEVSSGWKDSPKTVLDVYRELIQSGLRIWVFSGDTDAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPT+SPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALHRPK A
Sbjct  389  IPVTSTRYSIDALKLPTISPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQA  448

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV+SFLAG SMP LQ+ISDS
Sbjct  449  LTLVKSFLAGASMPSLQQISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A++E+G+ID YSIFT TCT  FSI++ +LKR +R VG LRR YDPCTE+HS IYFNL
Sbjct  270  LDQANEEVGNIDFYSIFTQTCTAKFSILNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHVH  NSSF+WV CSDEV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAV
Sbjct  329  PEVQEALHVHKRNSSFKWVACSDEVSSGWKDSPKTVLDVYRELIRSGLRIWVFSGDTDAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALHRPK A
Sbjct  389  IPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQA  448

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV+SFLAG+SMP L+ ISDS
Sbjct  449  LTLVKSFLAGSSMPSLELISDS  470



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A++E+G+ID+YSIFTP CT  FSI++ +L R+   +G LRR YDPCTE+HS IYFNL
Sbjct  265  LDQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSIGHLRRSYDPCTEQHSKIYFNL  323

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALHVH  NSSF+WVTCS+EV   WKD P +VLDVY+ELI +GLRIWVFSGDTDAV
Sbjct  324  PEVQNALHVHKRNSSFKWVTCSEEVSSGWKDSPMSVLDVYRELIKSGLRIWVFSGDTDAV  383

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALHRPK A
Sbjct  384  IPVTSTRYSIDALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQA  443

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV+SFLAGTSMP L+ ISDS
Sbjct  444  LTLVKSFLAGTSMPSLELISDS  465



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A++E+G+ID+YSIFTP CT  FSI++ +L R+   VG LRR YDPCTE+HS IYFNL
Sbjct  265  LEQANEEIGNIDSYSIFTPACTAKFSILNHLL-RKSNSVGHLRRSYDPCTEQHSKIYFNL  323

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALHVH  NSSF+WVTCS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAV
Sbjct  324  PEVQSALHVHMRNSSFKWVTCSEEVSSGWKDSPNTVLDVYRELIKSGLRIWVFSGDTDAV  383

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSI+ALKLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGHEVALHRPK A
Sbjct  384  IPVTSTRYSINALKLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQA  443

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV+SFLAGTSMP L+ ISDS
Sbjct  444  LTLVKSFLAGTSMPSLELISDS  465



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 173/203 (85%), Gaps = 1/203 (0%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD A +E+GDID YSIFTP CT + + +SR L R+  KVGLLRR YDPCTE HST+YFN
Sbjct  275  ALDLAYEEVGDIDMYSIFTPACTANSTSLSR-LSRKKSKVGLLRRAYDPCTEEHSTVYFN  333

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQKALHVHT NSS +W TCS+ V + W+D P +VL+VY+ELI +GLR+W+FSGDTDA
Sbjct  334  LPEVQKALHVHTRNSSLKWETCSNTVNENWQDSPKSVLNVYRELIHSGLRVWIFSGDTDA  393

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            VIPVTSTRY+IDALKLPTVSPWR WYD+GQVGGWTQEY+GLTFV VRGAGHEV LHRPK 
Sbjct  394  VIPVTSTRYNIDALKLPTVSPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVPLHRPKQ  453

Query  183  ALTLVESFLAGTSMPGLQRISDS  115
            ALTLV+SFL+G SMP L+ +SDS
Sbjct  454  ALTLVKSFLSGISMPKLELVSDS  476



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   316 bits (809),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 174/202 (86%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A  E+G+ID YS+FTP CT +FS+M++ LKRR+ KVG LRR YDPCTE+HST+YFNL
Sbjct  272  LDIADKEIGNIDQYSVFTPACTANFSVMNQFLKRRN-KVGHLRRAYDPCTEQHSTVYFNL  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            P+VQ ALHV+  ++SF+W TCSD+VY+ WKD P +VL++Y EL+ AG+RIWVFSGDTDAV
Sbjct  331  PKVQHALHVYNRSNSFKWATCSDDVYNNWKDSPRSVLNIYHELLNAGIRIWVFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYS+DALKL TV PWRPWYD+GQVGGWTQ+YEGL FV VRGAGHEV LHRPK A
Sbjct  391  LPVTSTRYSLDALKLRTVGPWRPWYDDGQVGGWTQQYEGLNFVTVRGAGHEVPLHRPKQA  450

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL +SF++G S+P L++ISDS
Sbjct  451  LTLFKSFISGNSLPQLEQISDS  472



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A +E+GDID YSIFTP CT +FS +S   KR +RKVGLLRR YDPCTERHST+YFN
Sbjct  272  ALGNADEEIGDIDMYSIFTPPCTANFSRLSHPWKR-NRKVGLLRRAYDPCTERHSTVYFN  330

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ A+HVH+ NS  +W TCSD V + WKD P +VL+VY+EL+ +G+RIW+FSGDTDA
Sbjct  331  LPEVQNAIHVHSKNSPLKWETCSDAVNENWKDSPRSVLNVYRELLHSGIRIWIFSGDTDA  390

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            VIPVTSTRYSIDALKLPTVSPWR WY D+GQVGGWTQEYEGLTFV VRGAGHEV LH+PK
Sbjct  391  VIPVTSTRYSIDALKLPTVSPWRAWYDDDGQVGGWTQEYEGLTFVTVRGAGHEVPLHKPK  450

Query  186  LALTLVESFLAGTSMPGLQRISD  118
             ALTL++S+L+G SMP L+ +SD
Sbjct  451  QALTLIKSYLSGNSMPKLELVSD  473



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS+E+G++D YSIFTP C+      ++++KR  R VG +   YDPCTE+HS +Y+NL
Sbjct  269  MDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNL  327

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+
Sbjct  328  PEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAI  387

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH+PK A
Sbjct  388  IPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQA  447

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL+ +FL GTSMP L++++DS
Sbjct  448  LTLINAFLKGTSMPSLEQLADS  469



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS+E+G++D YSIFTP C+      ++++KR  R VG +   YDPCTE+HS +Y+NL
Sbjct  324  MDIASEEMGNVDPYSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNL  382

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+T N+  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+
Sbjct  383  PEVQQALHVYTDNAPSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAI  442

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYS+DALKLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGHEV LH+PK A
Sbjct  443  IPVTSTRYSVDALKLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQA  502

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL+ +FL GTSMP L++++DS
Sbjct  503  LTLINAFLKGTSMPSLEQLADS  524



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            ++ AS+ELG+ID YSIFTP C+ + S    +LKRR R VG +   YDPCTE+HS +YFNL
Sbjct  276  MEVASEELGNIDPYSIFTPPCSANVSQSKWLLKRRLR-VGQVSDKYDPCTEKHSEVYFNL  334

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGD DAV
Sbjct  335  PEVQKALHVLPEVAPSKWETCSDIVSTNWKDSPRTMLDVYRELIHVGLRIWIFSGDADAV  394

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GL FV+VRGAGHEV LHRPKLA
Sbjct  395  IPVTSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLNFVSVRGAGHEVPLHRPKLA  454

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV++FL+GTSMPGL+++SDS
Sbjct  455  LTLVKAFLSGTSMPGLEQVSDS  476



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS ELG+ID YSI+TP+C  + S  +R+LKR     G +   YDPCTE+H+ +YFNL
Sbjct  270  LDIASAELGNIDPYSIYTPSCPANVSQSNRLLKRM-HVAGRINEKYDPCTEKHTVVYFNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV   ++  +W TCSD VY  WKD P TVLDVY+ELI +GLRIW+FSGDTDAV
Sbjct  329  PEVQKALHVDRHHAPSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGDTDAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSID+LKLPTV PWR WYD GQVGGWTQEY GLTFV+VRGAGHEV LH+PKLA
Sbjct  389  IPVTSTRYSIDSLKLPTVKPWRAWYDEGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKLA  448

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L+++FL+G+SMP LQ +SDS
Sbjct  449  LALIKNFLSGSSMPSLQLVSDS  470



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 165/202 (82%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS ELG+ID YSI+T  C  + S  +R+LKR   KVG +   YDPCTE HS +YFNL
Sbjct  273  LDIASAELGNIDPYSIYTLACPANVSQSNRLLKRM-HKVGRISEKYDPCTEAHSVVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+V
Sbjct  332  PEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTV PWRPWYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+PK A
Sbjct  392  IPVTSTRYSIDALKLPTVKPWRPWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL+++FL+G+SMP  + +SDS
Sbjct  452  LTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   293 bits (750),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS ELG+ID YSI+TP C  + S  +R L+++  KVG +   YDPCTE HS +YFNL
Sbjct  273  LDIASAELGNIDPYSIYTPACPANVSQSNR-LQKQMHKVGRISEKYDPCTEAHSVVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+  ++  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+V
Sbjct  332  PEVQKALHVNPNHAPSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTV PWRPWY++GQVGGWTQEY GLTFV+VRGAGHEV LH+PK A
Sbjct  392  IPVTSTRYSIDALKLPTVKPWRPWYEDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL+++FL+G+SMP  + +SDS
Sbjct  452  LTLIKAFLSGSSMPSSELVSDS  473



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 163/202 (81%), Gaps = 2/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A++E+G+ID YSIFTPTCT + S+  R++KR   + G +   YDPCTE+HST+YFNL
Sbjct  286  LEIANNEIGNIDLYSIFTPTCTSNSSLSHRLMKRL--RAGRISEKYDPCTEKHSTVYFNL  343

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHVH   +  +W TCSD V + WKD P TVLD+Y ELI AGLRIW+FSGDTDAV
Sbjct  344  PEVQKALHVHPEVAPTKWETCSDVVNENWKDSPKTVLDIYHELIGAGLRIWIFSGDTDAV  403

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPT+ PWR WYD GQVGGWTQ+Y GL FV+VRGAGHEV LH+PKLA
Sbjct  404  IPVTSTRYSIDALKLPTIGPWRAWYDEGQVGGWTQQYVGLNFVSVRGAGHEVPLHKPKLA  463

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L+L+++FL+G  MP L   SDS
Sbjct  464  LSLIKAFLSGRQMPTLTEYSDS  485



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSI+TP C  + S  +++LKR    VG + + YDPCTE+HST+YFN 
Sbjct  295  LDIASEELGNIDPYSIYTPPCHANDSQSNQLLKRM-HMVGRISQKYDPCTEKHSTVYFNQ  353

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV   ++  +W TCSD VY  WKD PTTVLD+Y ELI + LRIWVFSGDTDAV
Sbjct  354  PEVQRALHVDPDHAPSKWDTCSDLVYSTWKDSPTTVLDIYHELIHSSLRIWVFSGDTDAV  413

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+TSTRYSIDALKLPTV PWR WYD+G+VGGWTQEYEGLTFV+VRGAGHEV LH+PK A
Sbjct  414  IPITSTRYSIDALKLPTVCPWRAWYDDGEVGGWTQEYEGLTFVSVRGAGHEVPLHKPKQA  473

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL++SFL+G  MP L  +SDS
Sbjct  474  LTLIKSFLSGLPMPNLNLVSDS  495



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 159/201 (79%), Gaps = 1/201 (0%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A+ ELG+ID YSIFTP+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLP
Sbjct  172  DIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLP  230

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVI
Sbjct  231  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVI  290

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+PK AL
Sbjct  291  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  350

Query  177  TLVESFLAGTSMPGLQRISDS  115
            TLV++FL+GT MP LQ +SDS
Sbjct  351  TLVKAFLSGTPMPTLQLVSDS  371



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 161/199 (81%), Gaps = 2/199 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD A DE+GDID YSIFTP C  +FS  +R+ +++  + G+LRR YDPCTE HST YFN
Sbjct  245  ALDDAYDEIGDIDMYSIFTPPCRTNFSRPNRLDRKKVCRFGILRRQYDPCTEEHSTAYFN  304

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ ALH+ + NS  +W TCSD V + WKD P++VL+VY++L  AGLRIW FSGDTD+
Sbjct  305  LPEVQDALHIRSKNS--QWETCSDLVNENWKDSPSSVLNVYRKLFPAGLRIWFFSGDTDS  362

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            VIPV STRYSI+AL+LPTVSPWR WY++GQVGGWT+EYEGLT V VRGAGHEVALH+PKL
Sbjct  363  VIPVASTRYSINALRLPTVSPWRAWYNDGQVGGWTEEYEGLTLVTVRGAGHEVALHKPKL  422

Query  183  ALTLVESFLAGTSMPGLQR  127
            +LTLV+SFL G  MP L+ 
Sbjct  423  SLTLVDSFLRGNPMPKLEE  441



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 159/201 (79%), Gaps = 1/201 (0%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A+ ELG+ID YSIFTP+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLP
Sbjct  279  DIAAKELGNIDPYSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLP  337

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVI
Sbjct  338  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVI  397

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+PK AL
Sbjct  398  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  457

Query  177  TLVESFLAGTSMPGLQRISDS  115
            TLV++FL+GT MP LQ +SDS
Sbjct  458  TLVKAFLSGTPMPTLQLVSDS  478



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D A +E+G+ID YSIFTP C+      ++++K+     G+ R+ YDPCTE+HS +Y+NL
Sbjct  270  MDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAV
Sbjct  329  PEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH+PK A
Sbjct  389  IPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQA  448

Query  180  LTLVESFLAGTSMPGLQRISDS  115
             TL ++FL+G  MP ++++S S
Sbjct  449  FTLFKAFLSGAPMPYMEQVSYS  470



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 158/202 (78%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A +ELG+ID YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN 
Sbjct  272  LDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHPSEKYDPCTEKHSVVYFNQ  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAV
Sbjct  331  PEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDAL LPTV PWR WYD GQVGGWTQEY GLTFV VRGAGHEV LHRPK A
Sbjct  391  IPVTSTRYSIDALNLPTVKPWRAWYDEGQVGGWTQEYSGLTFVTVRGAGHEVPLHRPKPA  450

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL++SFL+G SMP L+R+S S
Sbjct  451  LTLIKSFLSGRSMPCLKRVSHS  472



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 158/202 (78%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  ELGDID YSIFTP CT + S  +R+LK+R R VG + + YDPCTE HST+YFNL
Sbjct  278  LEVADKELGDIDHYSIFTPPCTTNSSGSNRLLKKRHR-VGHVSKKYDPCTEAHSTVYFNL  336

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV       +W TCSD V + WKD P TVL++Y ELI +GLRIW+FSGDTDAV
Sbjct  337  PEVQKALHVSPEFLPSKWETCSDLVNENWKDSPRTVLNIYHELIHSGLRIWMFSGDTDAV  396

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPT  PW  WYD+GQVGGWTQEY GL FV VRGAGHEV LHRPKLA
Sbjct  397  IPVTSTRYSIDALKLPTTKPWHAWYDDGQVGGWTQEYAGLNFVVVRGAGHEVPLHRPKLA  456

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L+++FL+G SMP  + +S S
Sbjct  457  LALIKTFLSGVSMPTHELVSAS  478



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A +ELG+ID YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN 
Sbjct  272  LEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQ  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAV
Sbjct  331  PEVQKALHVIPAVAPAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLTFV VRGAGHEV LHRPK A
Sbjct  391  IPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPA  450

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL++SFL+G SMP L+R+S S
Sbjct  451  LTLIKSFLSGRSMPCLERVSHS  472



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A+ ELG+ID YSI+TP+C  + S  S  L++R   VG + + YDPCTE HS +YFNL
Sbjct  273  LDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV   ++  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAV
Sbjct  332  PEVQKALHVDPDHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+PK A
Sbjct  392  IPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQA  451

Query  180  LTLVESFLAGTSMPGLQRI  124
            LTL++SFL+G+SMP  +++
Sbjct  452  LTLIKSFLSGSSMPASEQL  470



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 163/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D A +E+G+ID YSIFTP C+      ++++K+     G+ R+ YDPCTE+HS +Y+NL
Sbjct  310  MDIAREEIGNIDLYSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNL  368

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+  N++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAV
Sbjct  369  PEVQQALHVYVDNATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAV  428

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGHEV LH+PK A
Sbjct  429  IPVTSTRYSIDALKLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQA  488

Query  180  LTLVESFLAGTSMPGLQRISDS  115
             TL ++FL+G  MP ++++S S
Sbjct  489  FTLFKAFLSGAPMPYMEQVSYS  510



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSI+TP CT + S  +R+LK    KVG +   YDPCTE HST+YFNL
Sbjct  280  LDIASEELGNIDPYSIYTPPCTANVSGSNRLLKTM-HKVGRVYEKYDPCTEAHSTVYFNL  338

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCSD V + WKD P TVLD+Y ELI +G+RIWVFSGDTDAV
Sbjct  339  PEVQKALHVSKEFAPSKWETCSDLVNNNWKDSPRTVLDIYHELIHSGIRIWVFSGDTDAV  398

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSIDALKL T  PW  WYD+ QVGGWTQEY GL FV VRGAGHEV LHRPKLA
Sbjct  399  IPVTSTRYSIDALKLRTTKPWHAWYDDRQVGGWTQEYAGLAFVVVRGAGHEVPLHRPKLA  458

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL+++FL+GTSMP L+ +S S
Sbjct  459  LTLIKAFLSGTSMPTLEPVSSS  480



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 163/202 (81%), Gaps = 3/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSI+TP+CT + S+ +++LKR    +G L   YDPC+E+HS +YFN 
Sbjct  277  LDIASNELGNIDPYSIYTPSCTTNSSLPNKLLKRL---IGHLNEAYDPCSEKHSVVYFNQ  333

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+   +  +W TCS  V   W+D   +VLD+Y EL+ AGLRIW+FSGDTDAV
Sbjct  334  PEVQQALHVNPQFAPVKWETCSGLVNSNWQDSSRSVLDIYHELMDAGLRIWMFSGDTDAV  393

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+IDALKLPT+ PW  WYD+GQVGGWTQEY+GLTFV VRGAGHEV LHR KL+
Sbjct  394  IPVTSTRYNIDALKLPTIKPWHAWYDDGQVGGWTQEYKGLTFVVVRGAGHEVPLHRAKLS  453

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTLV+SFLAG SMP L+++SDS
Sbjct  454  LTLVKSFLAGESMPTLEQVSDS  475



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A+ ELG+ID YSI+TP+C  + S  S  L++R   VG + + YDPCTE HS +YFNL
Sbjct  273  LDIANAELGNIDPYSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH    ++  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAV
Sbjct  332  PEVQKALHXDPGHAPSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+TSTRYSIDALKLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGHEV LH+PK A
Sbjct  392  IPITSTRYSIDALKLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQA  451

Query  180  LTLVESFLAGTSMPGLQRI  124
            LTL++SFL+G+SMP  +++
Sbjct  452  LTLIKSFLSGSSMPASEQL  470



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A +E+GDID YSIFTP C     +    L +R    G LR +YDPCTE+HS IYFN P
Sbjct  40   DIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSIIYFNRP  95

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+TDAVI
Sbjct  96   EVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVI  155

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHRPKLAL
Sbjct  156  PVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  215

Query  177  TLVESFLAGTSMPGLQ  130
            TL+++FL GTSMP L+
Sbjct  216  TLIKAFLEGTSMPTLE  231



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 160/202 (79%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD ASDELGDID YSI+TP C  + S  +R L++R + +G +   YDPCTE HS  YFN 
Sbjct  273  LDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNR  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAV
Sbjct  332  AEVQTALHVNKAFAPAKWDTCSDLVNENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LHRPKLA
Sbjct  392  IPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L+++FLAGTSMP LQ +SDS
Sbjct  452  LALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 160/202 (79%), Gaps = 1/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD ASDELGDID YSI+TP C  + S  +R L++R + +G +   YDPCTE HS  YFN 
Sbjct  273  LDIASDELGDIDPYSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNR  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQ ALHV+   +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAV
Sbjct  332  AEVQTALHVNKAFAPAKWDTCSDLVSENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+ID+LKLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGHEV LHRPKLA
Sbjct  392  IPVTSTRYTIDSLKLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L+++FLAGTSMP LQ +SDS
Sbjct  452  LALIKAFLAGTSMPSLQLVSDS  473



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSIFTP+C  S +     L +R    G     YDPCTE+HST+YFNL
Sbjct  272  LDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHSTVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+   +  +W TCSD V + WKDCP +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  332  PEVQKALHVNPAVAPSKWETCSDIVNENWKDCPRSVLHIYHELIQYGLRIWMFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LHRPK A
Sbjct  392  IPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L +SFL+G+ MP L    DS
Sbjct  452  LVLFKSFLSGSPMPTLSEFDDS  473



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 159/203 (78%), Gaps = 3/203 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR--KVGLLRRIYDPCTERHSTIYFN  544
            + A  ELG+ID YS+FTP C  + S +SR+++R++R  ++GL    YDPCTERHS +YFN
Sbjct  271  EIADKELGNIDPYSLFTPPCHANVSQLSRLVRRKNRIGRLGLSTE-YDPCTERHSIVYFN  329

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQ ALHV   +    W TCSD VY  WKD P +VLD+Y ELI  GL+IWVFSG+TD 
Sbjct  330  RPEVQTALHVDLDHKPATWETCSDVVYTNWKDSPRSVLDIYHELIGMGLKIWVFSGNTDV  389

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            VIPVTSTRYSI ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH+PKL
Sbjct  390  VIPVTSTRYSISALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVIVRGAGHEVPLHKPKL  449

Query  183  ALTLVESFLAGTSMPGLQRISDS  115
            ALTLV++FLAGTSMP L  +S S
Sbjct  450  ALTLVQTFLAGTSMPNLDLLSTS  472



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS+E+G+ID YSIFTP+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNL
Sbjct  276  MDLASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-LMVSQLSEKYDPCTEKHSEVYFNL  334

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGDTDAV
Sbjct  335  PEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELIHEGLRIWIFSGDTDAV  394

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+TSTRYSIDALKL T+ PWR WYD+GQVGGWTQEYEGL FV+VRGAGHEV LHRPK A
Sbjct  395  IPITSTRYSIDALKLATMKPWRAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQA  454

Query  180  LTLVESFLAGTSMPG  136
            LTL ++FL+GTSMP 
Sbjct  455  LTLFKAFLSGTSMPA  469



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A  ELG+ID YSIFTP+C  S +     L +R   VG +   YDPCTE+HST+YFNL
Sbjct  272  LDIADKELGNIDPYSIFTPSCPGSVTFSKNKLLKRRHSVGSIGEKYDPCTEQHSTVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH++   +  +W TCSD V + WKD   +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  332  PEVQKALHINPAFAPSKWETCSDVVNENWKDSARSVLHIYHELIGYGLRIWMFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+ID+LKLPTV+PW PWYD+GQVGGWTQ Y+GLTFV VRGAGHEV LH+PKLA
Sbjct  392  IPVTSTRYNIDSLKLPTVTPWHPWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHQPKLA  451

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L +SFL+G+SMP    + DS
Sbjct  452  LVLFKSFLSGSSMPTFTGLDDS  473



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 151/195 (77%), Gaps = 1/195 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  +F+     + +R R VG +   YDPCTE+HST+YFNL
Sbjct  271  LDIASKEAGNIDSYSIFTPTCHATFASSKNKVMKRLRSVGKMGEQYDPCTEKHSTVYFNL  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS  V + W DC  +VL +Y ELI  GLRIWVFSGDTDAV
Sbjct  331  AEVQKALHVNPVIGKSKWETCSGVVNNHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPTV+PW  WY DNG+VGGW+Q YEGLTFV VRGAGHEV LHRPK 
Sbjct  391  IPVTSTRYSIDALKLPTVTPWHAWYDDNGEVGGWSQGYEGLTFVTVRGAGHEVPLHRPKQ  450

Query  183  ALTLVESFLAGTSMP  139
            ALTL++SFLAGT MP
Sbjct  451  ALTLIKSFLAGTPMP  465



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A +E+GDID YSIFTP C     +    L +R    G LR +YDPCTE+HS IYFN P
Sbjct  274  DIAYEEMGDIDPYSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSIIYFNRP  329

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV   +   +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+TDAVI
Sbjct  330  EVQRALHVDPDHKPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVI  389

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PV STRYSI+ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHRPKLAL
Sbjct  390  PVASTRYSINALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  449

Query  177  TLVESFLAGTSMPGLQ  130
            TL+++FL GTSMP L+
Sbjct  450  TLIKAFLEGTSMPTLE  465



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C  +    ++ +KR++  VG LR +YDPCTE+HSTIYFN 
Sbjct  243  LEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTIYFNR  298

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+TDAV
Sbjct  299  PEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAV  358

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHRPKLA
Sbjct  359  IPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLA  418

Query  180  LTLVESFLAGTSMPGLQRIS  121
            LTL+++FLAGTSMP L+ ++
Sbjct  419  LTLIKAFLAGTSMPTLEPLT  438



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C  +    ++ +KR++  VG LR +YDPCTE+HSTIYFN 
Sbjct  274  LEIADKEMGNIDPYSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTIYFNR  329

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ LHV       +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+TDAV
Sbjct  330  PEVQRILHVDPDYKPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAV  389

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+I+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHRPKLA
Sbjct  390  IPVTSTRYTINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLA  449

Query  180  LTLVESFLAGTSMPGLQRIS  121
            LTL+++FLAGTSMP L+ ++
Sbjct  450  LTLIKAFLAGTSMPTLEPLT  469



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS E G+ID+YSIFTPTC  SF+     + +R    G +   YDPCTE+HST+YFNL
Sbjct  54   MDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNL  113

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+T     +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAV
Sbjct  114  AEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAV  173

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV LHRPK 
Sbjct  174  IPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQ  233

Query  183  ALTLVESFLAGTSMP  139
            ALTL++SFL G+ MP
Sbjct  234  ALTLIKSFLTGSPMP  248



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG ID YSI TP+C  + +     L +R    G +   YDPCTE+HSTIYFNL
Sbjct  270  LDVASNELGTIDPYSILTPSCPGTVTFSKNKLLKRLHSFGRVGEKYDPCTEKHSTIYFNL  329

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+   +  EW TCSD V + WKD P +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  330  PEVQKALHVNPVVAPSEWETCSDVVNENWKDSPRSVLHIYHELIHYGLRIWMFSGDTDAV  389

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY++D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LHRPK A
Sbjct  390  IPVTSTRYNVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQA  449

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L +SFL+G+ MP L    DS
Sbjct  450  LVLFKSFLSGSPMPTLSEFVDS  471



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 153/197 (78%), Gaps = 4/197 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID +SIFTP C E+         RR    G LR +YDPCTE HS IYFN 
Sbjct  273  LEIADKEMGNIDPFSIFTPPCHEN----DNQPDRRKHSFGRLRGVYDPCTENHSNIYFNR  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV+  +   +W TCSD V   WKD P +VL++Y+ELI  GLRIW+FSG+TDA+
Sbjct  329  PEVQRALHVNPDHKPDKWQTCSDVVGTNWKDSPRSVLNIYRELIPTGLRIWIFSGNTDAI  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSI+ALKLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LHRPKLA
Sbjct  389  IPVTSTRYSINALKLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLA  448

Query  180  LTLVESFLAGTSMPGLQ  130
            LTL+++FL GTSMP L+
Sbjct  449  LTLIKAFLEGTSMPTLE  465



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 159/219 (73%), Gaps = 18/219 (8%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A +ELG+ID YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN 
Sbjct  272  LEVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQ  330

Query  540  PEVQKALHVHTTNSSFEWVTC-----------------SDEVYDFWKDCPTTVLDVYQEL  412
            PEVQKALHV    +  +W TC                 S  V + W D P TVLD+Y+EL
Sbjct  331  PEVQKALHVIPAVAPAKWETCRWHQQYTLVISLFLLLCSGVVNNNWLDSPRTVLDIYREL  390

Query  411  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  232
            I +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLTFV
Sbjct  391  IHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFV  450

Query  231  AVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  115
             VRGAGHEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  451  TVRGAGHEVPLHRPKPALTLIKSFLSGRSMPCLERVSHS  489



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 153/201 (76%), Gaps = 13/201 (6%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A+ ELG+ID YSIFTP+C+ +             +VG +   YDPCTE H+T+YFNLP
Sbjct  279  DIATKELGNIDPYSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTVYFNLP  325

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVI
Sbjct  326  EVQKALHVSPEFAPARWETCSEVVNINWKDSPRTVLDIYKELIHSGLHVWVFSGDTDAVI  385

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+PK AL
Sbjct  386  PVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQAL  445

Query  177  TLVESFLAGTSMPGLQRISDS  115
            TLV++FL+GT MP LQ +SDS
Sbjct  446  TLVKAFLSGTPMPTLQLVSDS  466



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 2/202 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            + A++ELG+ID YS+FTP C  +  S +SR+++R+ R +G L   YDPCTE+HS +YFN 
Sbjct  269  EIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNR  327

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD V
Sbjct  328  PDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVV  387

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLA
Sbjct  388  IPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLA  447

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL ++FLAGTSMP L+ +  S
Sbjct  448  LTLFKAFLAGTSMPNLELVGAS  469



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 2/202 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            + A++ELG+ID YS+FTP C  +  S +SR+++R+ R +G L   YDPCTE+HS +YFN 
Sbjct  283  EIANEELGNIDPYSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNR  341

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            P+VQ  LHV   +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD V
Sbjct  342  PDVQTVLHVDPDHKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVV  401

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRYSI AL LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGHEV LH PKLA
Sbjct  402  IPVTSTRYSIKALDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLA  461

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            LTL ++FLAGTSMP L+ +  S
Sbjct  462  LTLFKAFLAGTSMPNLELVGAS  483



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD ASDE G+ID+YSIFTPTC  SF+     + +R   VG +   YDPCTE+HST+YFNL
Sbjct  281  LDIASDEAGNIDSYSIFTPTCHASFASSRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNL  340

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV    +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV
Sbjct  341  AEVQKALHVSPIINKSKWETCSDVVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAV  400

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            +PVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LHRPK 
Sbjct  401  LPVTSTRYSINALKLPTVTPWNAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQ  460

Query  183  ALTLVESFLAGTSMPGLQ  130
            AL L++SFLAG+ MP +Q
Sbjct  461  ALILIKSFLAGSPMPSVQ  478



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R R  G +   YDPCTE+HS +YFNL
Sbjct  186  LDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSAGKMGEQYDPCTEQHSIVYFNL  245

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  246  HEVQKALHVNPVIGKSKWETCSEVINTNWKDCDRSVLHIYHELIQYGLRIWMFSGDTDAV  305

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LHRPK 
Sbjct  306  IPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQ  365

Query  183  ALTLVESFLAGTSMPGLQRI  124
            ALTL++SFLAG+ MP L  +
Sbjct  366  ALTLIKSFLAGSPMPVLSDL  385



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   267 bits (683),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSIFTP+CT SF++    L +R    G + + YDPCTE+HS +YFNL
Sbjct  274  LDIASNELGNIDPYSIFTPSCTGSFTLSKNKLLKRLHSAGRIGKKYDPCTEKHSMVYFNL  333

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQK LHV+   +  +WVTCSD V   +KD   +VL +Y+ELI+ GLRIW+FSGDTDAV
Sbjct  334  PEVQKVLHVNPAFAPSKWVTCSDFVDKNYKDSSRSVLPIYRELISHGLRIWMFSGDTDAV  393

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPV STRY+IDALKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHE++L RPK A
Sbjct  394  IPVASTRYNIDALKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEISLLRPKSA  453

Query  180  LTLVESFLAGTSMP  139
            L L+++FL+G  MP
Sbjct  454  LVLIKAFLSGNPMP  467



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL
Sbjct  233  LDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSIVYFNL  292

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  293  HEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAV  352

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LHRPK 
Sbjct  353  IPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQ  412

Query  183  ALTLVESFLAGTSMPGLQRI  124
            ALTL++SFLAG  MP L  +
Sbjct  413  ALTLIKSFLAGRPMPVLSDL  432



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 152/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL
Sbjct  266  LDIASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNL  325

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  326  HEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAV  385

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LHRPK 
Sbjct  386  IPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQ  445

Query  183  ALTLVESFLAGTSMPGLQRI  124
            ALTL++SFLAG+ MP L  +
Sbjct  446  ALTLIKSFLAGSPMPVLSDL  465



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS E G+ID+YSIFTPTC  SF+     + +R    G +   YDPCTE+HST+YFNL
Sbjct  271  MDIASTEAGNIDSYSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNL  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+T     +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAV
Sbjct  331  AEVQKALHVNTVIGKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGHEV LHRPK 
Sbjct  391  IPVTSTRYSIDALKLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQ  450

Query  183  ALTLVESFLAGTSMP  139
            ALTL++SFL G+ MP
Sbjct  451  ALTLIKSFLTGSPMP  465



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 150/193 (78%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D AS+E+G+ID YSIFTP+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNL
Sbjct  276  MDVASEEMGNIDPYSIFTPSCSANASQTKWLLKRR-HMVSQLSEKYDPCTEKHSEVYFNL  334

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQK+LHV    +  +W TCSD V   WKD P T+LDVY+EL   GLRI +FSGDTDAV
Sbjct  335  PEVQKSLHVLPEAAPSKWETCSDIVNTNWKDSPITMLDVYRELTREGLRICIFSGDTDAV  394

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+TSTRYSIDALKL TV PW  WYD+GQVGGWTQEYEGL FV+VRGAGHEV LHRPK A
Sbjct  395  IPITSTRYSIDALKLATVKPWHAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQA  454

Query  180  LTLVESFLAGTSM  142
            L L ++FL+GTSM
Sbjct  455  LALFKAFLSGTSM  467



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 153/202 (76%), Gaps = 3/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C+E+    S  L++R   +G +   YDPCTE+HS  YFNL
Sbjct  270  LEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNL  326

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV
Sbjct  327  PEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAV  386

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+PKLA
Sbjct  387  LPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLA  446

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L++SFLAG S+  LQ  SD+
Sbjct  447  LQLIKSFLAGNSLSPLQLHSDT  468



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL
Sbjct  266  LDVASTEAGNIDSYSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNL  325

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS+ +   WKDC  +VL +Y ELI  GL IW+FSGDTDAV
Sbjct  326  HEVQKALHVNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLHIWMFSGDTDAV  385

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSIDALKLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGHEV LHRPK 
Sbjct  386  IPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQ  445

Query  183  ALTLVESFLAGTSMPGLQRI  124
            ALTL++SFLAG+ MP L  +
Sbjct  446  ALTLIKSFLAGSPMPVLSDL  465



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 150/206 (73%), Gaps = 7/206 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTI  553
             LD A  E+G+ID YSI+TP C  S    +   +++ RK    R +   YDPCTE+HS I
Sbjct  248  ALDKADVEMGEIDPYSIYTPPCLNS----TGTYRKQHRKRYPWRHLFGEYDPCTEKHSEI  303

Query  552  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            YFNLPEVQKALH + T   + W TCSD V D W D P ++L +YQELI AGLRIW+FSGD
Sbjct  304  YFNLPEVQKALHANVTGIPYRWTTCSDAVADHWGDSPRSMLPIYQELIKAGLRIWMFSGD  363

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  193
            TDAVIPVTSTRYSI+ALKLPTV+ W PWYDNGQVGGWTQ YEGLTFV VRGAGHEV LH 
Sbjct  364  TDAVIPVTSTRYSINALKLPTVTQWHPWYDNGQVGGWTQVYEGLTFVTVRGAGHEVPLHE  423

Query  192  PKLALTLVESFLAGTSMPGLQRISDS  115
            P+ A T+ ESFL G  MP   ++ D+
Sbjct  424  PRKAFTVFESFLEGKPMPVSPKLVDT  449



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 151/200 (76%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL
Sbjct  271  LDIASTEAGNIDSYSIFTPTCHSSFASSRNKVMKRLRSVGKMGEQYDPCTEKHSIVYFNL  330

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALHV+      +W TCS  + + W D   +VL +Y ELI  GLRIW+FSGDTDAV
Sbjct  331  AEVQKALHVNPVIGKSKWETCSGVINNNWGDSERSVLHIYHELIQYGLRIWMFSGDTDAV  390

Query  360  IPVTSTRYSIDALKLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            IPVTSTRYSI+ALKLPTV+PW  WY D+G+VGGWTQ Y+GLTFV VRGAGHEV LHRPK 
Sbjct  391  IPVTSTRYSINALKLPTVAPWHAWYDDDGEVGGWTQGYQGLTFVTVRGAGHEVPLHRPKQ  450

Query  183  ALTLVESFLAGTSMPGLQRI  124
            ALTL++SFLAG+ MP L  +
Sbjct  451  ALTLIKSFLAGSPMPVLSDL  470



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C+E   + S  L++R   VG +   YDPCTE+HS  YFNL
Sbjct  270  LEVADKEIGNIDHYSIFTPPCSE---VSSNRLRKRMHMVGRIGERYDPCTEQHSVAYFNL  326

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV
Sbjct  327  PEVQQALHVDPKFAPSKWETCSYVINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAV  386

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+TSTRYS+DALKLP + PWR WYD GQVGGW QEYEG+T V+VRGAGHEV LH+PKLA
Sbjct  387  LPITSTRYSVDALKLPVIGPWRAWYDEGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLA  446

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L ++FLAG S+  LQ  SD+
Sbjct  447  LQLFKAFLAGNSLSPLQLHSDT  468



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 153/202 (76%), Gaps = 3/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C+E+    S  L++R   +G +   YDPCTE+HS  YFNL
Sbjct  344  LEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNL  400

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV
Sbjct  401  PEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAV  460

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+PKLA
Sbjct  461  LPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLA  520

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L++SFLAG S+  LQ  SD+
Sbjct  521  LQLIKSFLAGNSLSPLQLHSDT  542



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A DELG++D YSI+TP C  +         +R   +G LR  YDPCTE+HS  YFN 
Sbjct  286  LEIADDELGNLDPYSIYTPPCHGN----DNHKVKRKHSIGRLRATYDPCTEKHSIKYFNQ  341

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ LHV   +   +W TCSD V   WKD P TVLD+Y+ELI  GLRIW+FSG+TD+V
Sbjct  342  PEVQRILHVDPHHKPEKWETCSDLVNINWKDSPRTVLDIYRELIPTGLRIWMFSGNTDSV  401

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+IDALKLPTVSPWR WYD+G+VGGW QEY GLTFV +RGAGHEV LH+PKLA
Sbjct  402  IPVTSTRYTIDALKLPTVSPWRAWYDDGEVGGWIQEYAGLTFVTIRGAGHEVPLHKPKLA  461

Query  180  LTLVESFLAGTSMPGLQRI  124
            LTL ++FLAGTSMP L+ +
Sbjct  462  LTLFKAFLAGTSMPTLEPL  480



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID+YSIFTPTC  SF+     + +R   VG +   YDPCTE+HST+YFNL
Sbjct  281  LDIASTEAGNIDSYSIFTPTCHSSFAASRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNL  340

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
             EVQKALH     +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV
Sbjct  341  AEVQKALHASPIINKSKWETCSDIVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAV  400

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            +PVTSTRYSIDALKL TV+PW  WYD +G+VGGWTQ Y+GL FV+VRGAGHEV LHRPK 
Sbjct  401  LPVTSTRYSIDALKLLTVTPWSAWYDEDGEVGGWTQGYKGLNFVSVRGAGHEVPLHRPKQ  460

Query  183  ALTLVESFLAGTSMP  139
            AL L++SFLAG +MP
Sbjct  461  ALILIKSFLAGRAMP  475



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 152/202 (75%), Gaps = 3/202 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YSIFTP C+E+    S  L++R   +G +   YD CTE+HS  YFNL
Sbjct  270  LEVADKEIGNIDHYSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDLCTEKHSVAYFNL  326

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV    +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV
Sbjct  327  PEVQQALHVDPKFAPSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAV  386

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+TSTRYS+DALKLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGHEV LH+PKLA
Sbjct  387  LPITSTRYSVDALKLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLA  446

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L++SFLAG S+  LQ  SD+
Sbjct  447  LQLIKSFLAGNSLSPLQLHSDT  468



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 149/196 (76%), Gaps = 4/196 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + +  ELG+ID Y+IFT  C  +       L +R  +VG LR +YDPCT +HST YFNLP
Sbjct  363  EISEKELGNIDPYNIFTTPCHAN----DNQLVKRKHRVGNLRTVYDPCTSKHSTTYFNLP  418

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+TDAV+
Sbjct  419  EVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVL  478

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LHRPKLAL
Sbjct  479  PVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  538

Query  177  TLVESFLAGTSMPGLQ  130
             L +SFLAGTSM  L+
Sbjct  539  ALFKSFLAGTSMQTLE  554



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   259 bits (663),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  ELG+ID YSIF   C  + + M +   R    VG LR +YDPCT +HST YFNLP
Sbjct  275  EIAEKELGNIDPYSIFATPCHANDNQMVKGKHR----VGNLRTVYDPCTSKHSTTYFNLP  330

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ LHVH  +   +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+TDAV+
Sbjct  331  EVQRILHVHPDHRPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVL  390

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDALKLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGHEV LHRPKLAL
Sbjct  391  PVTSTRYSIDALKLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLAL  450

Query  177  TLVESFLAGTSMPGLQ  130
             L +SFLAGTSM  L+
Sbjct  451  ALFKSFLAGTSMQTLE  466



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 151/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D A +ELG ID YS+FT TC +  S +S  L+ +    G +   YDPCTE+HST+YFN 
Sbjct  271  IDQAYEELGGIDPYSVFTITC-QGNSTLSNKLRSKSNSFGRIGEQYDPCTEKHSTVYFNQ  329

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+   +  +W TCSD V   W+D   ++L +Y ELI  GLRIW+FSGDTDA+
Sbjct  330  PEVQKALHVNPAFAPSKWKTCSDVVGVNWRDSVKSILPIYHELIHEGLRIWMFSGDTDAI  389

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPVTSTRY+IDAL+LPTV+PW  WYDNGQVGGWTQ Y+GLTFV VRGAGHEVALH+P+LA
Sbjct  390  IPVTSTRYNIDALRLPTVTPWHAWYDNGQVGGWTQVYKGLTFVTVRGAGHEVALHKPRLA  449

Query  180  LTLVESFLAGTSMPGLQRI  124
            L L+++FL G+ MP L  +
Sbjct  450  LRLIKAFLVGSPMPTLASL  468



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 148/205 (72%), Gaps = 17/205 (8%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A+ ELG+ID YSIFTP+C+ +             +VG +   YDPCTE H+T+YFNLP
Sbjct  279  DIATKELGNIDPYSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTVYFNLP  325

Query  537  EVQKALHVHTTNSSFEWVTCSDEV----YDFWKDCPTTVLDVYQELITAGLRIWVFSGDT  370
            EVQKALHV    +   W TC             D P TVLD+Y+ELI +GL +WVFSGDT
Sbjct  326  EVQKALHVSPEFAPARWETCRGATCPHHLTLIFDSPRTVLDIYKELIHSGLHVWVFSGDT  385

Query  369  DAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRP  190
            DAVIPVTSTRYSIDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGHEV LH+P
Sbjct  386  DAVIPVTSTRYSIDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKP  445

Query  189  KLALTLVESFLAGTSMPGLQRISDS  115
            K ALTLV++FL+GT MP LQ +SDS
Sbjct  446  KQALTLVKAFLSGTPMPTLQLVSDS  470



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LDTA  E+G+ID YS+FTPTC  + +    +LK+R   +G +   YDPCTE+HS +YFNL
Sbjct  274  LDTADKEIGNIDQYSVFTPTCPGNVTQTKFLLKKRP-ILGRVSENYDPCTEKHSIMYFNL  332

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALHV    +  +W TCSD V + WKD P +VL++Y ELI AGL IWVFSGD DAV
Sbjct  333  PEVQTALHVPPELAPSKWETCSDTVGNHWKDSPRSVLNIYHELIAAGLHIWVFSGDADAV  392

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSIDAL L  ++PWRPWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK A
Sbjct  393  VPVTSTRYSIDALNLRPLNPWRPWYIDGQVGGWTQQYVGLNFVTVRGAGHEVPLHRPKQA  452

Query  180  LTLVESFLAGTSMP  139
            L L ++F++G S+P
Sbjct  453  LALFKAFVSGNSLP  466



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD    E+GDID YS+FTP C  + S    +LK+R R  G +   YDPCT +HS +YFN
Sbjct  266  ALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DA
Sbjct  325  LPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADA  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHRPK 
Sbjct  385  VVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKE  444

Query  183  ALTLVESFLAGTSM  142
            AL L ++F++GTS+
Sbjct  445  ALALFQAFISGTSL  458



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 145/194 (75%), Gaps = 1/194 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD    E+GDID YS+FTP C  + S    +LK+R R  G +   YDPCT +HS +YFN
Sbjct  266  ALDIMDMEIGDIDQYSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DA
Sbjct  325  LPEVQEALHVPPGLAPSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADA  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHRPK 
Sbjct  385  VVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKE  444

Query  183  ALTLVESFLAGTSM  142
            AL L ++F+ GTS+
Sbjct  445  ALALFQAFITGTSL  458



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 151/230 (66%), Gaps = 29/230 (13%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD A +ELG+ID YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN 
Sbjct  85   LDVADNELGNIDQYSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQ  143

Query  540  PEVQKALHVHTTNSSFEWVTCS------------------DEVYDFWKDCPTTVLDVYQE  415
            PEVQKALHV    +  +W TC                     V + W D P  VLD+Y E
Sbjct  144  PEVQKALHVIPAVALAKWETCRWHQQHALMIFFIFTALQWGVVNNNWLDSPRIVLDIYHE  203

Query  414  LITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGG----------  265
            LI +GLRIW+FSGDTDAVIPVTSTRYSIDAL LPTV PWR WYD GQV            
Sbjct  204  LIHSGLRIWMFSGDTDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVNYTTKPFITYIL  263

Query  264  WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMPGLQRISDS  115
            WTQEY GLT V VRGA HEV LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  264  WTQEYAGLTLVTVRGADHEVPLHRPKPALTLIKSFLSGRSMPCLERVSLS  313



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E+G+ID YS+FTP C  + S  S +L ++   V  L R+YDPCT++HS +YFNL
Sbjct  283  LKIADKEMGNIDRYSVFTPACVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFNL  342

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            P+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA+
Sbjct  343  PKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAI  402

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALHRPK A
Sbjct  403  VPVTSTRYSINALNLSTISPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEA  462

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  463  LALFKAFISGTPL  475



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   253 bits (646),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E+G+ID YS+FTP C  + S  S +L ++   V  L R+YDPCT++HS +YFNL
Sbjct  307  LKIADKEIGNIDRYSVFTPACVTNSSQSSMLLNKKGPFVSDLSRVYDPCTKKHSKVYFNL  366

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            P+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA+
Sbjct  367  PKVQKALHVPPQVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAI  426

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSI+AL L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALHRPK A
Sbjct  427  VPVTSTRYSINALNLSTLSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEA  486

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  487  LALFKAFISGTPL  499



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LDTA  E+G+ID YS+FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFNL
Sbjct  62   LDTADKEMGNIDQYSVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNL  120

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV
Sbjct  121  PEVQKALHVPPEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAV  180

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHRPK +
Sbjct  181  VPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQS  240

Query  180  LTLVESFLAGTSMPGLQRIS  121
            L L ++F++G  +P  ++ S
Sbjct  241  LELFKAFVSGNPLPTSEKNS  260



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD    E+G+ID YS+FTPTC  + S    +LK+R    G +   YDPCT +HS +YFN
Sbjct  266  ALDIMDMEIGEIDQYSVFTPTCVANASQAKMLLKKRAVG-GRVSEQYDPCTMKHSKVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W  CSD V + WKD P++VL++Y ELI AGLRIWVFSGD DA
Sbjct  325  LPEVQEALHVPPGLAPSKWDVCSDVVSENWKDSPSSVLNIYHELIAAGLRIWVFSGDADA  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDALKL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGHEV LHRPK 
Sbjct  385  VVPVTSTRYSIDALKLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKE  444

Query  183  ALTLVESFLAGTSMP  139
            AL L ++F++GTS+P
Sbjct  445  ALALFQAFISGTSLP  459



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRK-VGLLRRIYDPCTERHSTIYFN  544
            L  A  E+G+ID YS+FTP C  + S  S +L  + R  V  L R+YDPCT++HS +YFN
Sbjct  270  LKIADKEMGNIDRYSVFTPACVVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFN  329

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LP+VQKALHV    +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA
Sbjct  330  LPKVQKALHVPPKVAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADA  389

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            ++PVTSTRYSI+AL L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GHEVALHRPK 
Sbjct  390  IVPVTSTRYSINALNLSTTSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKE  449

Query  183  ALTLVESFLAGTSM  142
            AL L ++F++GT +
Sbjct  450  ALALFKAFISGTPL  463



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 146/193 (76%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+TA  E+G+ID YS+FTP C  + S  + +LK+R R    +   YDPCTE+HS +YFNL
Sbjct  269  LETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNL  327

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  328  PEVQEALHVPPGLAPSKWDTCSDVVNEHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAV  387

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK A
Sbjct  388  VPVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEA  447

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  448  LALFKAFISGTQL  460



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C  + S    +LK+R R    +   YDPCTE+HS +YFNLP
Sbjct  269  EIADKEIGNIDQYSVFTPACIANASQSKMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLP  327

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV    +  +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  328  EVQEALHVPPGLAPSKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVV  387

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK AL
Sbjct  388  PVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  447

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  448  ALFKAFISGTPL  459



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNL
Sbjct  164  LEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNL  222

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  223  PEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAV  282

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK A
Sbjct  283  VPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQA  342

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  343  LALFKAFISGTPL  355



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 140/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD A  E GDID YSIFT  C  + S+   +          + R YDPCTER+ST+YFN
Sbjct  267  ALDAADKEDGDIDPYSIFTRPCNNTASLRHNLRGHYP----WMTRAYDPCTERYSTMYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQK+LH + T  S+ W TCSD V D+W D P ++L +YQELI AGLRIWVFSGDTDA
Sbjct  323  QPEVQKSLHANVTGISYPWKTCSDIVGDYWADSPLSMLPIYQELIAAGLRIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LHRP+ 
Sbjct  383  VVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRE  442

Query  183  ALTLVESFLAGTSMP  139
            A  L +SFL    MP
Sbjct  443  AFILFKSFLENKPMP  457



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
             D A  E G+ID YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NL
Sbjct  264  FDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNL  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V
Sbjct  321  PEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LHRP+  
Sbjct  381  VPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQG  440

Query  180  LTLVESFLAGTSMP  139
            L L E FL G  MP
Sbjct  441  LKLFEHFLRGEPMP  454



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
             D A  E G+ID YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NL
Sbjct  264  FDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNL  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V
Sbjct  321  PEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LHRP+  
Sbjct  381  VPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQG  440

Query  180  LTLVESFLAGTSMP  139
            L L E FL G  MP
Sbjct  441  LKLFEHFLRGEPMP  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
             D A  E G+ID YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NL
Sbjct  264  FDIAEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNL  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V
Sbjct  321  PEVQRALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDAL LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGHEV LHRP+  
Sbjct  381  VPLTATRYSIDALFLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQG  440

Query  180  LTLVESFLAGTSMP  139
            L L E FL G  MP
Sbjct  441  LKLFEHFLRGEPMP  454



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 142/195 (73%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ A  E G+ID YSI+T  C  + S M R L  R      + R YDPCTER+ST YFN
Sbjct  262  ALEAADSEFGNIDPYSIYTRPCKSTAS-MKRSLNGR---YPWMSRAYDPCTERYSTEYFN  317

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQ ALH ++T  S+ W TCSD V ++W + P T+L +YQELI AGLRIWV+SGDTDA
Sbjct  318  RPDVQLALHANSTKISYPWSTCSDIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGDTDA  377

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKLPTV+ W PWYDNG+VGGW+Q YEGLTFV ++GAGHEV LHRP+ 
Sbjct  378  VVPITATRYSIDALKLPTVTNWYPWYDNGRVGGWSQVYEGLTFVTIKGAGHEVPLHRPRQ  437

Query  183  ALTLVESFLAGTSMP  139
            A  L   FL   SMP
Sbjct  438  AFILFNHFLKNKSMP  452



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 141/195 (72%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            LD A  E+G+ID YSI+T  C  + S     L+RR R     + R YDPCTER+S IYFN
Sbjct  271  LDLADKEMGNIDPYSIYTRPCNSASS-----LRRRLRGHYPWMSRAYDPCTERYSEIYFN  325

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ ALH + T  S+ W +CSD V ++W D P +VL +YQELI AG RIWVFSGDTDA
Sbjct  326  LPEVQNALHANVTRISYPWQSCSDIVGNYWADTPLSVLPIYQELIAAGHRIWVFSGDTDA  385

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  386  VVPVTATRYSIDALKLPTITKWYPWYDNGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQ  445

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  446  AFILFRSFLENKPMP  460



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 144/193 (75%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNL
Sbjct  270  LEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  329  PEVQKALHVPPGLAPSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK A
Sbjct  389  VPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQA  448

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  449  LALFKAFISGTPL  461



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ +  E+G+ID YS+FTP C  S S    +LKRR     +  + YDPCTE+HS +YFN
Sbjct  270  ALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFN  328

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DA
Sbjct  329  LPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADA  388

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK 
Sbjct  389  VVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKE  448

Query  183  ALTLVESFLAGTSM  142
            AL L ++F++GT +
Sbjct  449  ALALFKAFISGTPL  462



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C  + S    +LK+R      +   YDPCTE+HS +YFNLP
Sbjct  268  EIADKEIGNIDQYSVFTPACLANASQTKMLLKKRPM-TSRVSEQYDPCTEKHSKVYFNLP  326

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EV+ ALHV +  +S +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  327  EVKTALHVPSRLASAKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVV  386

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK AL
Sbjct  387  PVTSTRYSIDALNLRPLSTYGPWYMDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEAL  446

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  447  ALFKAFISGTQL  458



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 143/194 (74%), Gaps = 1/194 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ +  E+G+ID YS+FTP C  S S    +LKRR     +  + YDPCTE+HS +YFN
Sbjct  270  ALEISYKEMGNIDHYSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFN  328

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DA
Sbjct  329  LPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADA  388

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDAL L + SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK 
Sbjct  389  VVPVTSTRYSIDALNLSSTSPYGPWYTDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKE  448

Query  183  ALTLVESFLAGTSM  142
            AL L ++F++GT +
Sbjct  449  ALALFKAFISGTPL  462



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            +TA  E+G+ID YS+FTP C  + S  + +LK+R R    +   YDPCTE+HS +YFNLP
Sbjct  269  ETADKEIGNIDQYSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLP  327

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV    +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  328  EVQEALHVPPGLAPSKWDTCSDVVNENWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  387

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVT+TRYSIDAL L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK  L
Sbjct  388  PVTATRYSIDALNLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEGL  447

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  448  ALFKAFISGTPL  459



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 145/193 (75%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+TA  E+G+ID YS+FTP C  + S  S++L  + R    +   YDPCTE+HS +YFNL
Sbjct  271  LETADKEIGNIDQYSVFTPACVANAS-QSKMLLNKRRMTSRVSEQYDPCTEKHSKVYFNL  329

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEV++ALHV    +S +W TCS+ V + W D P++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  330  PEVKEALHVPPGLASSKWDTCSNVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAV  389

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDAL L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK A
Sbjct  390  VPVTATRYSIDALNLRPLSTYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEA  449

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  450  LALFKAFISGTPL  462



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -2

Query  621  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  442
            +R   VG +   YDPCTE+HS +YFNLPEVQKALHV    S  +W TCS+ V   W DC 
Sbjct  2    KRLHSVGKMGEQYDPCTEKHSIVYFNLPEVQKALHVSPVISKSKWETCSEVVNTHWGDCE  61

Query  441  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGG  265
             +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYS+DALKLPTV+PW  WYD +G+VGG
Sbjct  62   RSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSVDALKLPTVTPWHAWYDEDGEVGG  121

Query  264  WTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  139
            WT+ YEGLTFV VRGAGHEV LHRPK ALTL++SFLAG+ MP
Sbjct  122  WTEGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMP  163



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 143/193 (74%), Gaps = 1/193 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNL
Sbjct  270  LEIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNL  328

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  329  PEVQKALHVPAGLAPSKWDTCSDVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAV  388

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK A
Sbjct  389  VPVTSTRYSIDALNLRPLSVYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQA  448

Query  180  LTLVESFLAGTSM  142
              L ++F++GT +
Sbjct  449  FALFKAFISGTPL  461



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 142/194 (73%), Gaps = 1/194 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ +  E+G+ID YS+FTP C  S S  SR+L  R      +   YDPCTE+HS +YFN
Sbjct  270  ALEISYKEMGNIDHYSVFTPACVASAS-QSRMLLNRRPVNSRVSEQYDPCTEQHSKVYFN  328

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+ALHV    +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DA
Sbjct  329  LPEVQRALHVPPEVAPSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADA  388

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVTSTRYSIDAL L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGHEV LHRPK 
Sbjct  389  VVPVTSTRYSIDALNLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKE  448

Query  183  ALTLVESFLAGTSM  142
            AL L ++F++GT +
Sbjct  449  ALALFKAFISGTPL  462



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 142/200 (71%), Gaps = 1/200 (1%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LDTA  E+G+ID Y +FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFN 
Sbjct  131  LDTADKEMGNIDQYIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNP  189

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV    +  +W  CSD V + W D P +VL++Y ELI  GLRIWVFSGD DAV
Sbjct  190  PEVQKALHVPPEFAPSKWDICSDTVSEHWNDSPPSVLNIYHELIAVGLRIWVFSGDADAV  249

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSI+AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHRPK +
Sbjct  250  VPVTATRYSIEALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQS  309

Query  180  LTLVESFLAGTSMPGLQRIS  121
            L L ++F++G  +P  ++ S
Sbjct  310  LELFKAFVSGNPLPTSEKNS  329



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 141/191 (74%), Gaps = 3/191 (2%)
 Frame = -2

Query  711  ASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEV  532
            A  E G+ID YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NLPEV
Sbjct  267  AEAEEGNIDAYSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEV  323

Query  531  QKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  352
            QKALH + T   + WVTCSD VYDFWKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+
Sbjct  324  QKALHANVTGIPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPL  383

Query  351  TSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTL  172
            T+TRYSIDAL LPTV+ W PWYD+ +VGGW Q Y+GLT V +RGAGHEV LHRP+  L L
Sbjct  384  TATRYSIDALFLPTVTNWYPWYDDEEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRQGLKL  443

Query  171  VESFLAGTSMP  139
             E FL    MP
Sbjct  444  FEHFLRDEPMP  454



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 142/195 (73%), Gaps = 8/195 (4%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            LD A+ E G+ID YSI++P C  S       LK + R     + R YDPCTERHS +YFN
Sbjct  270  LDLANLEQGNIDPYSIYSPPCNAS-----ATLKNKPRGHYPWMSRAYDPCTERHSKVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQKALH + T   + W TCSD V + W+D P ++L +YQELI AG RIWVFSGDTD+
Sbjct  325  LPEVQKALHANVTGIPYPWATCSDVVGNNWQDSPKSMLPIYQELIAAGFRIWVFSGDTDS  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYS+DALKLPT++ W PWYDNG+VGGW+Q Y GLTFV + GAGHEV LHRP+ 
Sbjct  385  VVPVTATRYSLDALKLPTLTNWYPWYDNGKVGGWSQVYRGLTFVTITGAGHEVPLHRPRQ  444

Query  183  ALTLVESFLAGTSMP  139
            A  L +SFL   +MP
Sbjct  445  AFILFKSFL--QNMP  457



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A  E G ID YSI+TPTC ++     R ++ R      L R YDPCTE++S  Y+NLP
Sbjct  325  DIAEAEHGSIDAYSIYTPTCKKTSLHKRRQIRGR---TPWLPRGYDPCTEKYSEKYYNLP  381

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALH + T   + WV CSD +YD+WKD P ++L +Y+ELI AG+RIWVFSGD D+V+
Sbjct  382  EVQKALHANVTGIPYAWVACSDPIYDYWKDSPKSMLPIYRELIAAGIRIWVFSGDADSVV  441

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYDNG+VGGW Q Y+GLT V VRGAGHEVALHRP+  L
Sbjct  442  PLTATRYSIDALSLPTVTNWYPWYDNGEVGGWCQVYKGLTLVTVRGAGHEVALHRPRQGL  501

Query  177  TLVESFLAGTSM  142
             L E FL    M
Sbjct  502  KLFEHFLRDEPM  513



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
              D A  E G ID YSIFT  C+ + S     L+R  R     + R YDPCTER+S IYF
Sbjct  267  AFDVADKEQGSIDPYSIFTRPCSSAIS-----LRRNLRGHYPWMPRAYDPCTERYSIIYF  321

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T  S+ W TCSD V D+W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  322  NRPEVQKALHANLTAISYPWKTCSDIVGDYWADSPLSMLPIYEELIAAGLRIWVFSGDTD  381

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+P+T+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LHRP+
Sbjct  382  AVVPLTATRYSIDALKLPTVMNWYPWYDHGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPR  441

Query  186  LALTLVESFLAGTSMP  139
              L L + FL    MP
Sbjct  442  QVLILFKYFLENKPMP  457



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   234 bits (596),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S IY+N
Sbjct  36   NLNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSNIYYN  91

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSGDTDA
Sbjct  92   LPEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDA  151

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  152  VVPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  211

Query  183  ALTLVESFLAGTSMP  139
            AL L   FL  T MP
Sbjct  212  ALILFRHFLKDTPMP  226



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 141/194 (73%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S +YFN 
Sbjct  268  LRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNR  323

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W  CSD V ++W D P ++L +YQELI+AGLRIWV+SGDTDAV
Sbjct  324  PEVQKALHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYQELISAGLRIWVYSGDTDAV  383

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LHRP+ A
Sbjct  384  VPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQA  443

Query  180  LTLVESFLAGTSMP  139
              L  SFL   SMP
Sbjct  444  FILFRSFLENKSMP  457



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 140/195 (72%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L  A  E G+ID YSI+TP C  S S     L+RR R     + R YDPCTERHST+YFN
Sbjct  270  LLQAEKEQGNIDPYSIYTPPCNASSS-----LRRRFRVHFPWMPRAYDPCTERHSTVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQ+A H +TT   + W TCSD V  +W D P +VL +YQ L+ AGL+IWVFSGDTD+
Sbjct  325  LPEVQEAFHANTTGIPYPWKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFSGDTDS  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GL FV V GAGHEV LHRP+L
Sbjct  385  VVPITATRYSIDALKLPTITNWYPWYDNKRVGGWSQVYKGLIFVTVTGAGHEVPLHRPRL  444

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  445  AYILFRSFLENEPMP  459



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            +D A  E G+ID YSIFTPTC+ + S    + K R R    +   YDPCTE+HST+YFNL
Sbjct  266  MDIAYVEQGNIDAYSIFTPTCSATISQRRNLRKIRPR----ISVPYDPCTEKHSTVYFNL  321

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TC+D + D WKD P ++L +Y+ELI AG+RIWVFSGDTD+V
Sbjct  322  PEVQKALHANVTGIPYPWATCNDIIGDNWKDSPRSMLPIYRELIAAGIRIWVFSGDTDSV  381

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYS+D L+LPT+  W PWYDNGQ+GGW++ Y+GL+ + VRGAGHEV LH P+ A
Sbjct  382  VPVTATRYSLDTLELPTLVKWHPWYDNGQMGGWSEVYDGLSLIVVRGAGHEVPLHAPRKA  441

Query  180  LTLVESFLAGTSMP  139
              + +SFL    MP
Sbjct  442  YIMFKSFLENKPMP  455



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 141/196 (72%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R +DPCTER+S  YF
Sbjct  265  ALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYSKEYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T   ++W TCSD V   W D P ++L +YQELI AG+RIWV+SGDTD
Sbjct  320  NRPEVQKALHANVTGIPYQWETCSDVVGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+QEY+GLTFV V GAGHEV LHRP+
Sbjct  380  AVVPVTATRYSIDALKLPTINKWHPWYDNGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL   SMP
Sbjct  440  QAFILFRSFLENKSMP  455



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 143/196 (73%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S +YF
Sbjct  264  ALKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYF  318

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  319  NRPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSILPIYRELIAAGLRIWVFSGDTD  378

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT+TRYSIDALKLPT++ W PW +NG+VGGW+Q Y+GLTFV V GAGHEV LHRP+
Sbjct  379  SVVPVTATRYSIDALKLPTITNWYPWNNNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPR  438

Query  186  LALTLVESFLAGTSMP  139
            LA+ L  SFLA  +MP
Sbjct  439  LAVILFRSFLASKAMP  454



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 141/195 (72%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN
Sbjct  265  LKIAETEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  320  RPDVQKALHANVTRVSYPWKTCSDIVGNYWADSPLSMLPIYKELIAAGLRIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PW DNG+VGGW+Q Y+GLTFV V GAGHEV LHRP+L
Sbjct  380  VVPVTATRYSIDALKLPTITNWYPWNDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRL  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL   +MP
Sbjct  440  AFILFRSFLGSKAMP  454



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLP
Sbjct  271  EIADKEIGNIDQYSVFTPACVANASQSNMLLKKRPM-TGRVSEQYDPCTEKHTKVYFNLP  329

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  330  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK AL
Sbjct  390  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLKFVTVRGAGHEVPLHRPKQAL  449

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  450  ALFKAFISGTPL  461



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C  + S  + +LK+R      +R  YDPCTE+H+ +YFNLP
Sbjct  271  EIAEKEIGNIDQYSVFTPACLSNASQSNMLLKKRTM-TSRVREQYDPCTEKHTKVYFNLP  329

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV    +  +W TCSD V + W D  ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  330  EVQRALHVPPGLAPSKWDTCSDVVNEHWNDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  389

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK AL
Sbjct  390  PVTSTRYSIDALNLRPLSAYGPWYSDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  449

Query  177  TLVESFLAGTSMPGLQRI  124
             L ++F++G  +   + I
Sbjct  450  ELFKAFISGAPLSTHENI  467



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S +YFN
Sbjct  266  ALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFN  321

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCSD V D+W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  322  HPEVQKALHANVTGIPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDA  381

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LHRP+ 
Sbjct  382  VVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQ  441

Query  183  ALTLVESFLAGTSMPG  136
            A  L  SFL   SMPG
Sbjct  442  AFILFRSFLKNKSMPG  457



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++  +  R++K     +  L R YDPCTE++ST Y+NLP
Sbjct  214  EVAEAEQGNIDAYSIYTPTCKKTSFLKRRLIKG---NMPWLPRGYDPCTEKYSTKYYNLP  270

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+
Sbjct  271  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  330

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  331  PLTATRYSIDALHLPTVTNWYPWYDDDEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  390

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  391  KLFEHFLQDNPMP  403



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 143/193 (74%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A DE GDID YS++TPTC ++  +  R ++ R   +  L R YDPCTE + T Y+NLP
Sbjct  269  EVAYDEQGDIDFYSLYTPTCKKTSLLKRRQIRGR---MPWLPRGYDPCTELYFTKYYNLP  325

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+A H + T   + W+ CSD VY++W+D P ++L +Y+ELI+AGLRIWVFSGDTD+V+
Sbjct  326  EVQEAFHANVTGIPYAWIGCSDPVYEYWQDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  385

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LHRP+  L
Sbjct  386  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGL  445

Query  177  TLVESFLAGTSMP  139
             L+E FL G  MP
Sbjct  446  KLLEHFLQGEPMP  458



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 138/194 (71%), Gaps = 3/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G IDTYSI+TPTC ++     R+++ R      L R YDPCT ++ST Y+NL
Sbjct  264  LEVASAEQGKIDTYSIYTPTCKKTSLHRHRLIRGR---TPWLPRGYDPCTTQYSTKYYNL  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + WV CSD +Y +WKD P ++L +Y+ELI AG RIWVFSGD DAV
Sbjct  321  PEVQKALHANVTGIPYAWVACSDPIYKYWKDSPRSMLPIYRELIAAGKRIWVFSGDADAV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+  TRYSIDAL LPT+S W  WYD G+VGGW Q Y+GLT V +RGAGHEV LHRP+L 
Sbjct  381  VPLPGTRYSIDALFLPTISNWYAWYDQGEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRLG  440

Query  180  LTLVESFLAGTSMP  139
            L L E FL    MP
Sbjct  441  LKLFEHFLRDEPMP  454



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 141/196 (72%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R +DPCTER+S  YF
Sbjct  265  ALEVAEAEQGNIDPYSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYSKEYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T   ++W TCSD +   W D P ++L +YQELI AG+RIWV+SGDTD
Sbjct  320  NRPEVQKALHANVTGIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPT++ W PWY+NG+VGGW+QEY+GLTFV V GAGHEV LHRP+
Sbjct  380  AVVPVTATRYSIDALKLPTINKWHPWYENGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL   SMP
Sbjct  440  QAFILFRSFLENKSMP  455



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN 
Sbjct  267  LRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNC  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V
Sbjct  323  PEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH+P+ A
Sbjct  383  VPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREA  442

Query  180  LTLVESFLAGTSMP  139
              L  SFL    MP
Sbjct  443  FILFRSFLENKDMP  456



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S +YFN
Sbjct  265  ALYLAQLEQGNIDPYSIFTRPCNNTASLRHNLRGHYP----WMSRAYDPCTERYSKLYFN  320

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWV+SGDTDA
Sbjct  321  RPEVQKALHANATGISYPWKTCSDIVGNYWADAPLSMLPIYKELIAAGLKIWVYSGDTDA  380

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW+Q Y+GLTFV V GAGHEV LHRP+ 
Sbjct  381  VVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQ  440

Query  183  ALTLVESFLAGTSMP  139
            A  L +SFL    MP
Sbjct  441  AFILFKSFLENKPMP  455



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 143/200 (72%), Gaps = 8/200 (4%)
 Frame = -2

Query  711  ASDELGDIDTYSIFTPTCTESFSIM---SRVLKRRDRKVG----LLRRIYDPCTERHSTI  553
            +S+E G+ID YSI+TPTC  + S +   S V+ RR    G    +    YDPCTER+ST 
Sbjct  275  SSEEQGNIDAYSIYTPTCNTNASALPTPSSVVSRRQHPKGRYPWMTGGSYDPCTERYSTA  334

Query  552  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            Y+N PEVQKALH + T  ++ W  CSD +   W D P ++L +Y+E+I AGLRIWVFSGD
Sbjct  335  YYNRPEVQKALHANVTGINYAWAACSDTINGNWSDSPRSMLSIYKEIIQAGLRIWVFSGD  394

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHEVALH  196
            TD+V+P T+TRYSIDAL LPT + W PWYD+ Q VGGW+Q YEGLT V VRGAGHEVALH
Sbjct  395  TDSVVPSTATRYSIDALVLPTTTDWYPWYDDNQEVGGWSQVYEGLTLVTVRGAGHEVALH  454

Query  195  RPKLALTLVESFLAGTSMPG  136
            RP+ AL L ++FL G  MPG
Sbjct  455  RPRQALILFQNFLQGKPMPG  474



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 142/192 (74%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLP
Sbjct  290  EIADKEIGNIDHYSVFTPACVANASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLP  348

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  349  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  408

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK AL
Sbjct  409  PVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  468

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  469  ALFKAFISGTPL  480



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN 
Sbjct  267  LRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V
Sbjct  323  PEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGHEV LH+P+ A
Sbjct  383  VPLTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREA  442

Query  180  LTLVESFLAGTSMP  139
              L  SFL    MP
Sbjct  443  FILFRSFLENKDMP  456



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 141/198 (71%), Gaps = 6/198 (3%)
 Frame = -2

Query  729  Q*GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRD-RKVGLLRRIYDPCTERHSTI  553
            Q  +D A  ELG+ID YSI+TP+C  S S   ++      R  G     YDPCTE +S +
Sbjct  142  QRAMDLADLELGNIDQYSIYTPSCNISGSQRHKLRSHHPWRSYG-----YDPCTESYSAL  196

Query  552  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            YFN PEVQKA H + T+ S+ W TCSD +  +W+D P ++L +YQEL+ AG+RIWVFSGD
Sbjct  197  YFNRPEVQKAFHANVTSISYSWTTCSDILEKYWQDSPRSMLPIYQELLRAGIRIWVFSGD  256

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  193
            TDAV+PVT+TRYSIDAL+L T+  W PWYDN +VGGWTQ Y+GLT V +RGAGHEV LH+
Sbjct  257  TDAVVPVTATRYSIDALRLRTIVNWYPWYDNQEVGGWTQIYKGLTLVTIRGAGHEVPLHQ  316

Query  192  PKLALTLVESFLAGTSMP  139
            P+ A  L ++FL G  MP
Sbjct  317  PRKAFILFKAFLKGKPMP  334



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++   +          + R YDPCT+R+S +YFN
Sbjct  266  ALMLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTDRYSKVYFN  321

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   ++W TCSD V D+W D P ++L +Y+EL+ AGLRIWV+SGDTDA
Sbjct  322  HPEVQKALHANVTGIPYQWKTCSDIVGDYWADSPLSMLPIYKELMAAGLRIWVYSGDTDA  381

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGHEV LHRP+ 
Sbjct  382  VVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQ  441

Query  183  ALTLVESFLAGTSMPG  136
            A  L  SFL   SMPG
Sbjct  442  AFILFRSFLENKSMPG  457



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L  A  E G+ID YSI+T  C  + S     L+R  R     + R YDPCTER+S +YF
Sbjct  265  ALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYSEVYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            NLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQELI+AGLRIWVFSGDTD
Sbjct  320  NLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELISAGLRIWVFSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGHEV LHRP+
Sbjct  380  SVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L+ SFL    MP
Sbjct  440  QAFILLRSFLENKPMP  455



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 139/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L  A  E G+ID YSI+T  C  + S     L+R  R     + R YDPCTER+S IYF
Sbjct  265  ALLLAEQEQGNIDPYSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYSEIYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            NLPEVQKA H + T  ++ W TCSD V ++W D P ++L +YQELI AGLRIWVFSGDTD
Sbjct  320  NLPEVQKAFHANVTKVAYPWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVFSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGHEV LHRP+
Sbjct  380  SVVPVTATRYSIDALKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L+ SFL    MP
Sbjct  440  QAFILLRSFLENKPMP  455



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER++ +Y+NL
Sbjct  260  LNLASSEEGNIDPYSLYTKPCNNSASLKLGLGGRYP----WLSRAYDPCTERYANVYYNL  315

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  316  PEVQMALHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAV  375

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ A
Sbjct  376  VPVTATRYSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQA  435

Query  180  LTLVESFLAGTSMP  139
            L L   FL  T MP
Sbjct  436  LILFRHFLKDTPMP  449



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YSI+T  C +S S + R L+ R      + R YDPCT+R++ +Y+N 
Sbjct  271  LNVASTEQGNIDPYSIYTSPCNDS-SALKRNLRGR---YPWMSRAYDPCTDRYAKVYYNR  326

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  327  PEVQRALHANVTGIHYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAV  386

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LHRP+ A
Sbjct  387  VPVTATRYSIDALKLPTLLRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQA  446

Query  180  LTLVESFLAGTSMP  139
            L L   FL    MP
Sbjct  447  LILFRHFLQNKPMP  460



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 139/194 (72%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S+IY+N 
Sbjct  263  LNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSSIYYNR  318

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  319  PEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAV  378

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LHRP+ A
Sbjct  379  VPVTATRYSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREA  438

Query  180  LTLVESFLAGTSMP  139
            L L   FL  T MP
Sbjct  439  LILFRHFLQNTPMP  452



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 139/194 (72%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S+IY+N 
Sbjct  263  LNLASSEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSSIYYNR  318

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  319  PEVQIAMHANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAV  378

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LHRP+ A
Sbjct  379  VPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREA  438

Query  180  LTLVESFLAGTSMP  139
            L L   FL  T MP
Sbjct  439  LILFRHFLQNTPMP  452



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 140/194 (72%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S +YFN 
Sbjct  268  LRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNR  323

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKA H + T   + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SGDTDAV
Sbjct  324  PEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAV  383

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LHRP+ A
Sbjct  384  VPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQA  443

Query  180  LTLVESFLAGTSMP  139
              L  SFL   SMP
Sbjct  444  FILFRSFLENKSMP  457



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 140/194 (72%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S +YFN 
Sbjct  267  LRVATVEQGNIDPYSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKA H + T   + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SGDTDAV
Sbjct  323  PEVQKAFHANVTGIPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGHEV LHRP+ A
Sbjct  383  VPMTATRYSIDALKLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQA  442

Query  180  LTLVESFLAGTSMP  139
              L  SFL   SMP
Sbjct  443  FILFRSFLENKSMP  456



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 137/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S +YFN
Sbjct  266  ALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFN  321

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  322  RPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDA  381

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGHEV LHRP+ 
Sbjct  382  VVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLHRPRQ  441

Query  183  ALTLVESFLAGTSMPG  136
            A  L  SFL   SMPG
Sbjct  442  AFILFMSFLGNKSMPG  457



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S + R L R +     L R YDPCTE++ST Y+NLP
Sbjct  273  EVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLP  329

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+
Sbjct  330  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  389

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  390  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  449

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  450  KLFEHFLQDKPMP  462



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 140/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L+ A  E G+ID YSIFT  C ++ S     L+R+ R     + R YDPCTER+S +YF
Sbjct  261  ALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRKLRGHYPWMSRAYDPCTERYSEVYF  315

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            NLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFSGDTD
Sbjct  316  NLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTD  375

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGHEV LHRP+
Sbjct  376  AVVPVTATRYSIDALKLPTITNWYXWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPR  435

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL    MP
Sbjct  436  QAYILFRSFLENKPMP  451



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E G ID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S+ YF
Sbjct  258  AMEAADKEQGGIDPYSIYTITCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSSTYF  314

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H +TT  +++W TCSD V + W D P ++L +Y+ELI AG+RIWVFSGDTD
Sbjct  315  NSPEVQKAMHANTTGLAYQWKTCSDIVGEKWSDSPLSMLPIYKELIAAGIRIWVFSGDTD  374

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT TRYSI ALKLP VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  375  SVVPVTGTRYSIRALKLPPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  434

Query  186  LALTLVESFLAGTSM  142
                L +SFLA   M
Sbjct  435  RGFLLFKSFLANKPM  449



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C ++    S +          + R YDPCTER+S +YFN
Sbjct  113  ALRAAQIEQGNIDPYSIFTQPCKDT----STLRHNMRGHYPWMSRAYDPCTERYSKVYFN  168

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  169  RLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDA  228

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  229  VVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQ  288

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  289  AFILFRSFLENKLMP  303



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   236 bits (601),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSI+TP C ++ S + R L  R      + R YDPCTER+S +YFN
Sbjct  268  ALRVAVAEQGNIDPYSIYTPPCNDTAS-LRRGLNGR---YPWMSRAYDPCTERYSDLYFN  323

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQELI A LRIWV+SGDTDA
Sbjct  324  RPEVQKALHANVTGISYPWKTCSDIVGNYWTDSPLSMLPIYQELINASLRIWVYSGDTDA  383

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TR+SIDALKLPT+  W PWYD+G+VGGW+Q Y+GLTFV VRGAGHEV LHRP+ 
Sbjct  384  VVPLTATRHSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRE  443

Query  183  ALTLVESFLAGTSMP  139
            +  L  SFL    MP
Sbjct  444  SFILFRSFLENKYMP  458



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 136/194 (70%), Gaps = 4/194 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S +YFN
Sbjct  206  ALKMAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSEVYFN  261

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  262  HPEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDA  321

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LHRP+ 
Sbjct  322  VVPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQ  381

Query  183  ALTLVESFLAGTSM  142
            A  + +SFL G  M
Sbjct  382  AFIVFKSFLEGKPM  395



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S IY+NL
Sbjct  253  LNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSNIYYNL  308

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSGDTDAV
Sbjct  309  PEVQTALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAV  368

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ A
Sbjct  369  VPITATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQA  428

Query  180  LTLVESFLAGTSMP  139
            L L   FL  T MP
Sbjct  429  LILFRHFLKDTPMP  442



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S + R L R +     L R YDPCTE++ST Y+NLP
Sbjct  273  EVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLP  329

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+
Sbjct  330  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  389

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  390  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  449

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  450  KLFEHFLQDKPMP  462



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 140/206 (68%), Gaps = 3/206 (1%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTI  553
             L+ ++ E GDID YS++TPTC E+ S  +R  ++R  K G    +   YDPCTE +ST 
Sbjct  259  ALNASTAEQGDIDMYSLYTPTCNETSSPAARARQQRRLKRGHYPWMTGSYDPCTEIYSTA  318

Query  552  YFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            Y+N PEVQ ALH + T  ++ W TCSD + + W+D P TVL +Y ELI AGLRIWVFSGD
Sbjct  319  YYNRPEVQTALHANVTGINYTWATCSDILNNNWRDSPRTVLPIYHELIAAGLRIWVFSGD  378

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHR  193
            TDAV+P+T TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GLT V VRGAGHEV LHR
Sbjct  379  TDAVVPLTGTRYSIDALGLPTTINWYPWYDAIKVGGWSQVYKGLTLVTVRGAGHEVPLHR  438

Query  192  PKLALTLVESFLAGTSMPGLQRISDS  115
            P+ A  L   FL G  MP    I  +
Sbjct  439  PRQAFILFNHFLKGKPMPNAPTIKSA  464



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A+ E G+ID YS++T  C  + S + R LK R      + R YDPCTER+S  YFN
Sbjct  267  ALRVATVEQGNIDPYSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDSYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKA H + T   +EW  CSD V ++W D P ++L +YQELI AG RIWV+SGDTDA
Sbjct  323  RPEVQKAFHANVTGIPYEWKACSDIVGNYWTDSPLSMLPIYQELIRAGYRIWVYSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V VRGAGHEV LHRP+ 
Sbjct  383  VVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYKGLTMVTVRGAGHEVPLHRPRE  442

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL   SMP
Sbjct  443  AFILFSSFLQNKSMP  457



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE + T Y NLP
Sbjct  142  EVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLP  198

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+
Sbjct  199  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  258

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LHRP   L
Sbjct  259  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  318

Query  177  TLVESFLAGTSMP  139
             L E FL G  MP
Sbjct  319  KLFEHFLRGEPMP  331



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTIY  550
            L+ ++ E GDID YS++TPTC E+ S  S   ++R  K G    +   YDPCTER+ST Y
Sbjct  278  LNASTVEQGDIDMYSLYTPTCNET-STSSAAARQRRLKQGHYPWMTGSYDPCTERYSTEY  336

Query  549  FNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDT  370
            +N PEVQ+ALH + T  ++ W TCSD + D W+D P +VL +Y ELI AGLRIWVFSGDT
Sbjct  337  YNRPEVQRALHANVTGINYTWATCSDILNDNWRDSPRSVLPIYHELIAAGLRIWVFSGDT  396

Query  369  DAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRP  190
            DAV+P+T+TRYSIDAL LPT   W PWYD  +VGGW+Q Y+GL+ V VRGAGHEV LHRP
Sbjct  397  DAVVPLTATRYSIDALGLPTTVSWYPWYDAMKVGGWSQVYKGLSLVTVRGAGHEVPLHRP  456

Query  189  KLALTLVESFLAGTSMP  139
            + AL L + FL G  MP
Sbjct  457  RQALILFKHFLQGKPMP  473



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 139/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L+ A  E G+ID YSIFT  C ++ S     L+R  R     + R YDPCTER+S +YF
Sbjct  265  ALNLAEAEQGNIDPYSIFTRPCNDTSS-----LRRNLRGHYPWMSRAYDPCTERYSEVYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            NLPEVQ ALH + T  S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFSGDTD
Sbjct  320  NLPEVQTALHANVTQVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGHEV LHRP+
Sbjct  380  AVVPVTATRYSIDALKLPTITNWYAWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL    MP
Sbjct  440  QAYILFRSFLENKPMP  455



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 141/194 (73%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E G+ID YSI+T  C +S S + R LK R      + R YDPCT+R++ +Y+N 
Sbjct  272  LNIAGSEQGNIDPYSIYTRPCNDS-SALKRNLKGR---YPWMSRAYDPCTDRYAKVYYNR  327

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  328  PEVQRALHANVTGIRYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAV  387

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDAL+LPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGHEV LHRP+ A
Sbjct  388  VPVTATRYSIDALELPTLRRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQA  447

Query  180  LTLVESFLAGTSMP  139
            L L   FL    MP
Sbjct  448  LILFRHFLQNKPMP  461



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 135/190 (71%), Gaps = 1/190 (1%)
 Frame = -2

Query  690  IDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVH  511
            +D Y +FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV 
Sbjct  2    VDQYIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVP  60

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
               +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI
Sbjct  61   PEFAPSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSI  120

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAG  151
            +AL L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGHEV LHRPK +L L ++F++G
Sbjct  121  EALNLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSG  180

Query  150  TSMPGLQRIS  121
              +P  ++ S
Sbjct  181  NPLPTSEKNS  190



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  S S+   +  R       L R YDPCTER+S IY+NL
Sbjct  279  LNLASSEEGNIDPYSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSNIYYNL  334

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +Y ELI AG++IWVFSGDTDAV
Sbjct  335  PEVQAALHANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIKIWVFSGDTDAV  394

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ A
Sbjct  395  VPVTATRYSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQA  454

Query  180  LTLVESFLAGTSMP  139
            L L   FL  T MP
Sbjct  455  LILFRHFLKDTPMP  468



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S + R L R +  +  L R YDPCTE++S  Y+NLP
Sbjct  276  EVAEAEQGNIDAYSIYTPTCKKT-SFLKRRLIRGN--LPWLPRGYDPCTEKYSMKYYNLP  332

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA H + T   + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+
Sbjct  333  EVQKAFHANVTGIPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVV  392

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  393  PLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQAL  452

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  453  KLFEHFLQDKPMP  465



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 138/196 (70%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L +A  E G+ID YSIFT  C  + S     L+R  R     + R YDPCTER+S +YF
Sbjct  265  ALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYSEVYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFSGDTD
Sbjct  320  NHPEVQKALHANVTGISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGHEV LHRP+
Sbjct  380  AVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL    MP
Sbjct  440  QAFILFRSFLENKPMP  455



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSI+T  C  S + + R L+        + R YDPCTER+S +YFN
Sbjct  265  ALLIAEHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSDVYFN  320

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
            LPEVQKA H + T  ++ W TCSD V D+W D P ++L +YQELI AGLRIWVFSGDTD+
Sbjct  321  LPEVQKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYQELIAAGLRIWVFSGDTDS  380

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGHEV LHRP+ 
Sbjct  381  VVPLTATRYSIDALKLPTITNWYPWYDNKKVGGWSQLYKGLTLVTITGAGHEVPLHRPRQ  440

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  441  AFILFRSFLENKPMP  455



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 135/193 (70%), Gaps = 4/193 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSIFT  C  + S+   +          + R YDPCTER+S +YFN 
Sbjct  265  LKIAEMEQGNIDPYSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSEVYFNH  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+A H + T  S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SGDTDAV
Sbjct  321  PEVQRAFHANVTGISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDAV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGHEV LHRP+ A
Sbjct  381  VPVTATRYSIDALKLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQA  440

Query  180  LTLVESFLAGTSM  142
              +  SFL G  M
Sbjct  441  FIVFRSFLEGKPM  453



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS++T  C  + S+   +  R       L R YDPCTER+S IY+N 
Sbjct  264  LNIASTEEGNIDPYSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSNIYYNR  319

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV
Sbjct  320  PEVQIAMHANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAV  379

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ A
Sbjct  380  VPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPREA  439

Query  180  LTLVESFLAGTSMP  139
            L L   FL    MP
Sbjct  440  LILFRHFLQNIPMP  453



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 136/196 (69%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++   +          + R YDPCTER+S +YFN
Sbjct  266  ALKLAELEQGNIDPYSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFN  321

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  322  RPEVQKALHANVTGIPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDA  381

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGHEV L RP+ 
Sbjct  382  VVPVTATRYSIDALKLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLRRPRQ  441

Query  183  ALTLVESFLAGTSMPG  136
            A  L  SFL   SMPG
Sbjct  442  AFILFMSFLGNKSMPG  457



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTE-SFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            D A+ E GDID YSI+TPTC + S S  +R   R       +R  YDPCTE HST+Y+N 
Sbjct  291  DAATVEQGDIDPYSIYTPTCNQTSSSTTARKNWRLKGHYPWMRGSYDPCTEMHSTVYYNR  350

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T  ++ W TCS  +   W D P ++L +Y+ELI AGLRIWV+SGDTD+V
Sbjct  351  PEVQRALHANVTGINYTWTTCSGIINTNWGDSPRSMLPIYKELIAAGLRIWVYSGDTDSV  410

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +P+T+TRYSIDAL LPTV  W PWYD  +VGGW+Q Y+GLT V +RGAGHEV LHRPK A
Sbjct  411  VPLTATRYSIDALGLPTVVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPKQA  470

Query  180  LTLVESFLAGTSMP  139
            L L   FL G  MP
Sbjct  471  LILFRHFLHGKPMP  484



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 140/192 (73%), Gaps = 1/192 (1%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E+G+ID YS+FTP C    S  + +LK+R    G +   YDPCTE+H+ +YFNLP
Sbjct  272  EIADKEIGNIDQYSVFTPACVAKASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLP  330

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKALHV    +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+
Sbjct  331  EVQKALHVPPGLAPSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVV  390

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            PVTSTR+SIDAL L  +S + PWY + QVGGW+Q+Y GL FV VRGAGHEV LHRPK AL
Sbjct  391  PVTSTRHSIDALNLHPLSVYGPWYLDEQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAL  450

Query  177  TLVESFLAGTSM  142
             L ++F++GT +
Sbjct  451  ALFKAFISGTPL  462



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 141/208 (68%), Gaps = 15/208 (7%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIY  550
            D A+ E GDID YSI+TPTC ++ +  S    RR R  G    +    YDPCTERHST+Y
Sbjct  277  DKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVY  336

Query  549  FNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  385
            +N PEVQ+ALH + T  +     + W TCSD + + W D P +VL +Y+ELI AGLRIWV
Sbjct  337  YNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWV  396

Query  384  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD------NGQVGGWTQEYEGLTFVAVR  223
            FSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD        +VGGW+Q YEGLT V VR
Sbjct  397  FSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQKQQQEVGGWSQVYEGLTLVTVR  456

Query  222  GAGHEVALHRPKLALTLVESFLAGTSMP  139
            GAGHEV LHRP+ AL L   FL G  MP
Sbjct  457  GAGHEVPLHRPRQALILFRHFLRGKPMP  484



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YF
Sbjct  256  AIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYF  312

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  313  NSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTD  372

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  373  SVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  432

Query  186  LALTLVESFLAGTSM  142
                L +SFL    M
Sbjct  433  RGFLLFQSFLNNKPM  447



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 138/196 (70%), Gaps = 6/196 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN 
Sbjct  267  LRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V
Sbjct  323  PEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQ--VGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +P+T+TRYSIDALKLPT+  W PWYD+G+  VGGW+Q Y+GLT V +RGAGHEV LH+P+
Sbjct  383  VPLTATRYSIDALKLPTIINWYPWYDSGKVGVGGWSQVYKGLTLVTIRGAGHEVPLHKPR  442

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL    MP
Sbjct  443  EAFILFRSFLENKDMP  458



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 138/196 (70%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L  A  E G+ID YSIFT  C+ +       LKR  R     + R YDPCTER+S  YF
Sbjct  267  ALKLADSEQGNIDPYSIFTRPCSSA-----AALKRNLRGHYPWMSRAYDPCTERYSEKYF  321

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T  S+ W TCSD V ++W D P ++L +YQELI AGL+IWV+SGDTD
Sbjct  322  NHPEVQKALHANVTGLSYPWKTCSDFVGNYWSDSPRSMLPIYQELIAAGLKIWVYSGDTD  381

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPT++ W PW D+G+VGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  382  AVVPVTATRYSIDALKLPTINNWSPWSDSGKVGGWSQIYKGLTLVTITGAGHEVPLHRPR  441

Query  186  LALTLVESFLAGTSMP  139
             A  L +SFL    MP
Sbjct  442  EAFILFKSFLENKPMP  457



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 139/195 (71%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L+ A++ELG+ID YSI+T  C E+       LKR+ R     + R YDPCTE ++ +Y+N
Sbjct  281  LEAAANELGNIDPYSIYTRACNET-----TTLKRKLRGHYPWMSRAYDPCTENYAEVYYN  335

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQ ALH + T   + W TCS+ V + W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  336  RPEVQMALHANVTGIPYPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSGDTDS  395

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDAL L TV  W PWYDNG+VGGWTQ YEGLTFV V GAGHEV LHRP+ 
Sbjct  396  VVPVTATRYSIDALNLSTVISWYPWYDNGKVGGWTQVYEGLTFVTVXGAGHEVPLHRPRQ  455

Query  183  ALTLVESFLAGTSMP  139
            AL L + FL    MP
Sbjct  456  ALVLFKHFLQNRPMP  470



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 135/194 (70%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSI TP C  + S+ S +  R       + R YDPC ER+S +YFN 
Sbjct  267  LTVAITEQGNIDGYSINTPPCNNTASLRSGLHDRYP----WMYRAYDPCAERYSDVYFNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T  S+ W  CS  V+D+W D P ++L +YQELI A LRIWV+SGDTDAV
Sbjct  323  PEVQKALHANVTGISYAWKACSGTVWDYWTDSPLSMLPIYQELINADLRIWVYSGDTDAV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IP+T+TRYSI ALKLPT+  W PWYDNG+V GW+Q Y+GLT V VRGAGHEV LHRP+ A
Sbjct  383  IPLTATRYSIGALKLPTIMNWYPWYDNGKVCGWSQVYKGLTLVTVRGAGHEVPLHRPREA  442

Query  180  LTLVESFLAGTSMP  139
              L  SFL   +MP
Sbjct  443  FILFRSFLENKNMP  456



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YF
Sbjct  256  AIEAADKEQGDIDPYSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYF  312

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  313  NSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTD  372

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T TRYSI ALKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  373  SVVPITGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  432

Query  186  LALTLVESFLAGTSM  142
                L +SFL    M
Sbjct  433  RGFLLFQSFLNNKPM  447



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E GDID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YF
Sbjct  256  AIEAADKEQGDIDPYSIYTVTCKREAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYF  312

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H +TT  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  313  NSPEVQKAMHANTTGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTD  372

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT TRYSI ALKL  VS W PWYDNGQVGGW+Q Y GLT V + GAGHEV LHRP+
Sbjct  373  SVVPVTGTRYSIRALKLQPVSKWYPWYDNGQVGGWSQVYNGLTLVTIHGAGHEVPLHRPR  432

Query  186  LALTLVESFLAGTSM  142
                L +SFL    M
Sbjct  433  RGFLLFQSFLNNKPM  447



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 138/196 (70%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L +A  E G+ID YSIFT  C  + S     L+R  R     + R YDPCTER+S +YF
Sbjct  265  ALKSAEMEQGNIDPYSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYSEVYF  319

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T  S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFSGDTD
Sbjct  320  NHPEVQKALHANVTWISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTD  379

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+PVT+TRYSIDALKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGHEV LHRP+
Sbjct  380  AVVPVTATRYSIDALKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPR  439

Query  186  LALTLVESFLAGTSMP  139
             A  L  SFL    MP
Sbjct  440  QAFILFRSFLENKPMP  455



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSR-------VLKRRDRKVGLLRRIYDPCTERHS  559
            D A+ E GDID YSI+TP C ++ S  ++       ++ R       +   YDPCTE HS
Sbjct  273  DVAAVEQGDIDMYSIYTPLCGQTSSSSTKRSSQSSPLIGRHYHHPWRMGGSYDPCTESHS  332

Query  558  TIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFS  379
            T+Y+N PEVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFS
Sbjct  333  TVYYNRPEVQRALHANLTGINYPWATCSDLINTNWGDSPKSMLPIYKELIAAGLRIWVFS  392

Query  378  GDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVAL  199
            GDTDAVIP+TSTRYS+DAL LPT + W PWYD  QVGGW+Q YEGLT V VRGAGHEV L
Sbjct  393  GDTDAVIPLTSTRYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLTLVTVRGAGHEVPL  452

Query  198  HRPKLALTLVESFLAGTSMP  139
            HRP+ AL L + FL G  MP
Sbjct  453  HRPRQALILFQQFLKGEPMP  472



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S +YFN
Sbjct  260  ALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFN  315

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  316  RLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDA  375

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  376  VVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQ  435

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  436  AFILFRSFLENKLMP  450



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S +YFN
Sbjct  261  ALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFN  316

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  317  RLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDA  376

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  377  VVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQ  436

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  437  AFILFRSFLENKLMP  451



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   231 bits (590),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE + T Y NLP
Sbjct  276  EVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLP  332

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+
Sbjct  333  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  392

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LHRP   L
Sbjct  393  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  452

Query  177  TLVESFLAGTSMP  139
             L E FL G  MP
Sbjct  453  KLFEHFLRGEPMP  465



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN
Sbjct  265  LXLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTD+
Sbjct  320  RPDVQKALHANVTKVSYPWQTCSDXVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PW DNG+VGG +Q Y+GLTFV V GAGHEV LHRP+L
Sbjct  380  VVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRSQIYKGLTFVTVTGAGHEVPLHRPRL  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  440  AFILFRSFLESKPMP  454



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C ++ ++   +          + R YDPCTER+S +YFN
Sbjct  261  ALRAAQIEQGNIDPYSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFN  316

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDA
Sbjct  317  RLEVQKALHANVTALSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDA  376

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+  W PWYDNG+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  377  VVPVTATRYSIDALKLPTIINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQ  436

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  437  AFILFRSFLENKLMP  451



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   231 bits (590),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 139/193 (72%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G+ID YSI+TPTC ++ S+  R L R   ++  L R YDPCTE + T Y NLP
Sbjct  286  EVAEAEQGNIDLYSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLP  342

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ A H + T   + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+
Sbjct  343  EVQDAFHANVTGIPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVV  402

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPT++ W PWY + +VGGW Q YEGLT V VRGAGHEV LHRP   L
Sbjct  403  PLTATRYSIDALSLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGL  462

Query  177  TLVESFLAGTSMP  139
             L E FL G  MP
Sbjct  463  KLFEHFLRGEPMP  475



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L TA  E G+ID YSIFT  C  + ++   ++ R       + R YDPCTER+S  YFN
Sbjct  265  ALRTAELEQGNIDPYSIFTRPCNNTVTLKRFLMGRYP----WMSRAYDPCTERYSNSYFN  320

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P VQKALH + T   + W  CSD V  +W D P ++L +Y+ELI AG++IWVFSGDTDA
Sbjct  321  RPNVQKALHANVTRLPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIWVFSGDTDA  380

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSI+ALKLPT++ W PWYD G+VGGW+Q Y+GLTFV+V GAGHEV LHRP+ 
Sbjct  381  VVPVTATRYSINALKLPTITNWYPWYDQGKVGGWSQVYKGLTFVSVAGAGHEVPLHRPRQ  440

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  441  AFILFRSFLEDKPMP  455



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 141/209 (67%), Gaps = 16/209 (8%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIY  550
            D A+ E GDID YSI+TPTC ++ +  S    RR R  G    +    YDPCTERHST+Y
Sbjct  277  DKATAEQGDIDPYSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVY  336

Query  549  FNLPEVQKALHVHTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWV  385
            +N PEVQ+ALH + T  +     + W TCSD + + W D P +VL +Y+ELI AGLRIWV
Sbjct  337  YNRPEVQRALHANVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWV  396

Query  384  FSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-------NGQVGGWTQEYEGLTFVAV  226
            FSGDTDAV+P+T+TRYSIDAL LPTV  W PWYD         +VGGW+Q YEGLT V V
Sbjct  397  FSGDTDAVVPLTATRYSIDALNLPTVVSWYPWYDAKEQQKQQQEVGGWSQVYEGLTLVTV  456

Query  225  RGAGHEVALHRPKLALTLVESFLAGTSMP  139
            RGAGHEV LHRP+ AL L   FL G  MP
Sbjct  457  RGAGHEVPLHRPRQALILFRHFLRGKPMP  485



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 136/191 (71%), Gaps = 4/191 (2%)
 Frame = -2

Query  711  ASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEV  532
            A  E G+ID YSI+T  C  S + + R L+        + R YDPCTER+S +YFNLPEV
Sbjct  269  ADHEQGNIDPYSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSDVYFNLPEV  324

Query  531  QKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  352
            QKA H + T  ++ W TCSD V D+W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+
Sbjct  325  QKAFHANVTKIAYPWKTCSDIVGDYWDDSPLSMLPIYHELIAAGLRIWVFSGDTDSVVPL  384

Query  351  TSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTL  172
            T+TRYSIDALKLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGHEV LHRP+ A  L
Sbjct  385  TATRYSIDALKLPTITNWYPWYDNKKVGGWSQIYKGLTLVTITGAGHEVPLHRPRQAFIL  444

Query  171  VESFLAGTSMP  139
              SFL    MP
Sbjct  445  FRSFLENKPMP  455



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 138/195 (71%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L  A  E G+ID YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN
Sbjct  265  LKLAEMEQGNIDPYSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTD+
Sbjct  320  RPDVQKALHANVTKVSYPWQTCSDIVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT++ W PW DNG+VGG  Q Y+GLTFV V GAGHEV LHRP+L
Sbjct  380  VVPVTATRYSIDALKLPTITNWFPWNDNGKVGGRCQIYKGLTFVTVTGAGHEVPLHRPRL  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  440  AFILFRSFLESKPMP  454



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++IY+N 
Sbjct  276  LNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYASIYYNR  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ A+H +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV
Sbjct  332  PEVQMAMHANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LHRP+ A
Sbjct  392  VPVTATRYSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQA  451

Query  180  LTLVESFLAGTSMP  139
            L +   FL    MP
Sbjct  452  LIMFRHFLQNKPMP  465



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  +   + R LK R      + R YDPCTER+S +YFN
Sbjct  269  ALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCTERYSNVYFN  324

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W +CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  325  RVEVQKALHANVTRLPYPWKSCSDIVGSYWTDSPVSMLPIYRELITAGLKIWVFSGDTDA  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  385  VVPVTATRYSIDALKLETITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  444

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  445  AFILFRSFLENKPMP  459



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            DTA+ E G+ID YS++TP C ++ S+ SR   R   +   +   YDPCTER+ST+Y+N P
Sbjct  268  DTAATEQGNIDMYSLYTPVCNQTASV-SR--PRPRGRYPWMSGSYDPCTERYSTVYYNRP  324

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALH + T  ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+
Sbjct  325  EVQRALHANVTGINYTWATCSDTINKNWGDAPRSMLPIYKELIQAGLRIWVFSGDTDAVV  384

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPT   W PW D+ +VGGW+Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  385  PLTATRYSIDALDLPTTIGWYPWSDSKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPRQAL  444

Query  177  TLVESFLAGTSMP  139
             + ++FL G  +P
Sbjct  445  IMFQNFLRGMPLP  457



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 138/196 (70%), Gaps = 6/196 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             LD A  E+G+ID YSI+T  C ++ S     L+R  R     + R YDPCTER+S +Y+
Sbjct  281  ALDDADTEMGNIDPYSIYTLPCNDTGS-----LRRNLRGHYPWMSRAYDPCTERYSMVYY  335

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKALH + T   + W TCSD + D W D P +VL +Y ELI AGLRIWVFSGDTD
Sbjct  336  NRPEVQKALHANVTGIPYSWETCSDTIGDNWGDSPKSVLPIYHELIAAGLRIWVFSGDTD  395

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T+TRYSIDALKL T+  W PWY +G+VGGW+Q YEGLTFV V GAGHEV LHRP+
Sbjct  396  SVVPLTATRYSIDALKLKTLKNWYPWYYDGKVGGWSQIYEGLTFVTVTGAGHEVPLHRPR  455

Query  186  LALTLVESFLAGTSMP  139
             AL L + FL    MP
Sbjct  456  QALILFKRFLKNKPMP  471



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ A+ E G+ID YSI+TP C +  +I  R+  R       L R YDPCTER+ST+YFN
Sbjct  53   ALELATLEQGNIDPYSIYTPVCNDIAAIKRRLGGRYP----WLSRAYDPCTERYSTLYFN  108

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+
Sbjct  109  RPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLSIYQELIEGGIRIWVFSGDTDS  168

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH+P+ 
Sbjct  169  VVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQ  228

Query  183  ALTLVESFLAGTSMP  139
               L ++FL   +MP
Sbjct  229  GFILFKTFLEDKNMP  243



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN
Sbjct  267  ALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDA
Sbjct  323  RVEVQKALHANVTRLSYSWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  +  SFL    MP
Sbjct  443  AFIIFRSFLENKPMP  457



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++IY+N 
Sbjct  276  LNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYASIYYNR  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV
Sbjct  332  PEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LHRP+ A
Sbjct  392  VPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQA  451

Query  180  LTLVESFLAGTSMP  139
            L +   FL    MP
Sbjct  452  LIMFRHFLQNKPMP  465



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS+ T  C ++ S+   +  R       L R YDPCTER+++IY+N 
Sbjct  276  LNLASAEEGNIDPYSLNTKPCNDTASLKLGLGGRYP----WLSRAYDPCTERYASIYYNR  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV
Sbjct  332  PEVQMALHANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAV  391

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGHEV LHRP+ A
Sbjct  392  VPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQA  451

Query  180  LTLVESFLAGTSMP  139
            L +   FL    MP
Sbjct  452  LIMFRHFLQNKPMP  465



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  +  + S +  R       + R YDPCTER+S +YFN
Sbjct  264  ALRNAELEQGNIDPYSIFTKPCNNTVQLKSFLRGRYP----WMSRAYDPCTERYSNVYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W +CSD V  +W+D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  320  RVEVQKALHANVTRLPYPWKSCSDIVGSYWRDSPVSMLPIYRELITAGLKIWVFSGDTDA  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  380  VVPVTATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  440  AFILFRSFLESKPMP  454



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN
Sbjct  258  ALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFN  313

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDA
Sbjct  314  RVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDA  373

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  374  VVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQ  433

Query  183  ALTLVESFLAGTSMP  139
            A  +  SFL    MP
Sbjct  434  AFIIFRSFLENKPMP  448



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 137/194 (71%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ AS E G+ID YS+ T  C  + S+   +  R       L R YDPCTER+++IY+N 
Sbjct  266  LNLASAEEGNIDPYSLNTKPCNYTASLKVSLGGRYP----WLSRAYDPCTERYASIYYNR  321

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ ALH +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV
Sbjct  322  PEVQMALHANTTGIHYPWQTCSDIVGTYWADSPRSMLPIYQELIAAGMKIWVFSGDTDAV  381

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGHEV LHRP+ A
Sbjct  382  VPVTATRYSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQA  441

Query  180  LTLVESFLAGTSMP  139
            L +   FL    MP
Sbjct  442  LIMFRHFLKNKPMP  455



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  +   + R LK R      + R YDPC+ER+S +YFN
Sbjct  267  ALRNAELEQGNIDPYSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCSERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  323  RVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  443  AFILFRSFLENKPMP  457



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN
Sbjct  267  ALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDA
Sbjct  323  RVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  +  SFL    MP
Sbjct  443  AFIIFRSFLENKPMP  457



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L +A  E G+ID YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN
Sbjct  267  ALRSAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T  S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDA
Sbjct  323  RVEVQKALHANVTRLSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSIDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  +  SFL    MP
Sbjct  443  AFIIFRSFLENKPMP  457



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 136/193 (70%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A  E G ID YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLP
Sbjct  271  DVAEAEEGLIDAYSIYTPTCKKASLRKRRLIKGRRP---WLPRGYDPCTEKYSTKYYNLP  327

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA H + T   + W  CSD++++ WKD P ++L +Y ELI AG+RIWVFSGD D+V+
Sbjct  328  EVQKAFHANVTGMPYAWNPCSDDLFEHWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVV  387

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWY+  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  388  PLTATRYSIDALYLPTVTNWYPWYEEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  447

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  448  KLFEHFLQDKPMP  460



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSI+T  C  + S+   +          + R YDPCTER+S  YFN
Sbjct  266  ALTVAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSVAYFN  321

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQKA H + T  ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSGDTD+
Sbjct  322  HPDVQKAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIVSGIRIWVFSGDTDS  381

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LHRP+ 
Sbjct  382  VVPVTATRYSIDALKLPTISNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPRE  441

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    +P
Sbjct  442  AFILFRSFLEDKPLP  456



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            LD A+ E G ID YSI+T  CT++ S     LKR+ R     + R YDPCTE ++ +Y+N
Sbjct  287  LDAATIEQGHIDPYSIYTSPCTDATS-----LKRKIRGHYPWMSRAYDPCTENYARVYYN  341

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  342  HPEVQKALHANVTGIPYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDS  401

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDAL L TV  W PWYD+G+VGGWTQ YEGLTFV VRGAGHEV LHRP+ 
Sbjct  402  VVPLTATRYSIDALNLSTVISWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPLHRPRQ  461

Query  183  ALTLVESFLAGTSMP  139
            AL L   FL    MP
Sbjct  462  ALILFRHFLQDKLMP  476



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + + + R LK R      + R YDPCTER+S +YFN
Sbjct  267  ALRNAELEQGNIDPYSIFTKPCNSTVA-LKRFLKGR---YPWMSRAYDPCTERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              +VQKALH + T  S+ W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  323  RLDVQKALHANVTRLSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  443  AFILFRSFLESKPMP  457



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A  E G ID YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLP
Sbjct  159  DVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLP  215

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA   + T   + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+
Sbjct  216  EVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  275

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  276  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  335

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  336  KLFEHFLQDKPMP  348



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   228 bits (582),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 5/197 (3%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             LDTA  E+G+ID YSI+T  C +      R LKR  R     + R YDPCTER+S IY+
Sbjct  280  ALDTADSEMGNIDPYSIYTLPCNDH----PRSLKRNLRGHYPWMSRAYDPCTERYSRIYY  335

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N  +VQ+A+H + T   + W TCSD + + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  336  NRADVQRAMHANVTGIPYGWDTCSDTISENWGDSPKSMLPIYRELIAAGLRIWVFSGDTD  395

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            AV+P+T+TRYSIDAL+L T+  W PWYD+G+VGGW+Q Y+GLT+V V GAGHEV LHRP+
Sbjct  396  AVVPLTATRYSIDALRLRTLEKWYPWYDHGKVGGWSQIYKGLTYVTVTGAGHEVPLHRPR  455

Query  186  LALTLVESFLAGTSMPG  136
             AL L E FL    MP 
Sbjct  456  QALMLFEHFLKNKPMPA  472



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 138/195 (71%), Gaps = 6/195 (3%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFN  544
            L+ AS+E+G+ID YSI+T  C ++       LKR+ R     + R YDPCTE ++ +Y+N
Sbjct  278  LEAASNEMGNIDPYSIYTRPCNDA-----TTLKRKLRGHYPWMSRAYDPCTENYANVYYN  332

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  333  RPEVQKALHANVTGIPYPWDTCSNIVGKYWTDSPRSMLPIYRELIAAGLRIWVFSGDTDS  392

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDAL L TV  W  WYD G VGGWTQ Y+GLTFV VRGAGHEV LHRP+ 
Sbjct  393  VVPLTATRYSIDALNLSTVISWYAWYDQGMVGGWTQVYKGLTFVTVRGAGHEVPLHRPRQ  452

Query  183  ALTLVESFLAGTSMP  139
            AL L + FL    MP
Sbjct  453  ALVLFKHFLQNRPMP  467



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A  E G ID YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLP
Sbjct  221  DVAEAEEGLIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLP  277

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA   + T   + W +CSD ++++WKD P ++L +Y ELI AG+RIWVFSGD D+V+
Sbjct  278  EVQKAFRANVTGIPYAWTSCSDVLFEYWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVV  337

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  338  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  397

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  398  KLFEHFLQDKPMP  410



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G ID YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLP
Sbjct  126  NVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRR---PWLPRGYDPCTEQYSTKYYNLP  182

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA   + T   + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+
Sbjct  183  EVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  242

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  243  PLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  302

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  303  KLFEHFLQDKPMP  315



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 138/197 (70%), Gaps = 4/197 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A+ E G+ID YSI+T  C  S S+ S +    + +   + R YDPCT+R++ +Y+N 
Sbjct  267  LNAATAEQGNIDPYSIYTQPCNSSRSLKSSL----NGRYPWMSRAYDPCTDRYAKVYYNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV
Sbjct  323  PEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH P+ A
Sbjct  383  VPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQA  442

Query  180  LTLVESFLAGTSMPGLQ  130
            + L   FL    MP  Q
Sbjct  443  MILFRQFLKNRPMPRCQ  459



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   228 bits (581),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 134/193 (69%), Gaps = 4/193 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS E G+ID YSIFT  C  + S+   +          + R YDPCTER+S +YFN 
Sbjct  277  LDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSEVYFNK  332

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIWV+SGDTDAV
Sbjct  333  PEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAV  392

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L RP+ A
Sbjct  393  VPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQA  452

Query  180  LTLVESFLAGTSM  142
              L  SFL    M
Sbjct  453  FILFRSFLENKPM  465



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  +  + S  LK R      + R YDPC+ER+S +YFN
Sbjct  267  ALRNAELEQGNIDPYSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCSERYSNVYFN  322

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  323  RVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDA  382

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  383  VVPITATRYSIDALKLTTITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  442

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  443  AFILFRSFLENKPMP  457



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++ +  LK R      + R YDPCTER+S +YFN
Sbjct  268  ALRNAELEQGNIDPYSIFTKPCNNTVALKT-FLKGR---YPWMSRAYDPCTERYSNVYFN  323

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  324  RVEVQKALHANVTRLRYPWKACSDIVGSYWTDSPMSMLPIYRELITAGLKIWVFSGDTDA  383

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  384  VVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  443

Query  183  ALTLVESFLAGTSMP  139
            A  L +SFL    MP
Sbjct  444  AFILFKSFLENKPMP  458



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 136/194 (70%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A+ E G+ID YSI+T  C  S S+ S +  R       + R YDPCT+R++ +Y+N 
Sbjct  267  LNAATAEQGNIDPYSIYTQPCNSSRSLKSSLNGRYP----WMSRAYDPCTDRYAKVYYNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQ+ALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV
Sbjct  323  PEVQRALHANVTGIQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDAL L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGHEV LH P+ A
Sbjct  383  VPVTATRYSIDALNLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQA  442

Query  180  LTLVESFLAGTSMP  139
            + L   FL    MP
Sbjct  443  MILFRQFLKNRPMP  456



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            D A  E G ID YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLP
Sbjct  265  DVAEAEEGPIDAYSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLP  321

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA   + T   + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+
Sbjct  322  EVQKAFRANVTGIPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  382  PLTGTRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQAL  441

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  442  KLFEHFLQDKPMP  454



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 135/193 (70%), Gaps = 25/193 (13%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E+G+ID YS+FTP C  + S                   YDPCTE+H+T+YFNL
Sbjct  240  LEIADKEIGNIDQYSVFTPACVANAS----------------HEQYDPCTEKHTTVYFNL  283

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH+        W+ CSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV
Sbjct  284  PEVQKALHL--------WL-CSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAV  334

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVTSTRYSIDAL L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGHEV LHRPK A
Sbjct  335  VPVTSTRYSIDALNLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQA  394

Query  180  LTLVESFLAGTSM  142
            L L ++F++GT +
Sbjct  395  LALFKAFISGTPL  407



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 134/194 (69%), Gaps = 4/194 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             LD AS E G+ID YSIFT  C  + S+   +          + R YDPCTER+S +YFN
Sbjct  337  ALDAASVEQGNIDPYSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSEVYFN  392

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W TCSD V ++W D P ++L +YQELI AGLRIWV+SGDTDA
Sbjct  393  KPEVQKALHANVTGLPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDA  452

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT++RYSIDALKL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGHEV L RP+ 
Sbjct  453  VVPVTASRYSIDALKLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQ  512

Query  183  ALTLVESFLAGTSM  142
            A  L  SFL    M
Sbjct  513  AFILFRSFLENKPM  526



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 137/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  + ++ S  LK R      + R YDPCTER+S +YFN
Sbjct  264  ALRNAELEQGNIDPYSIFTKPCNSTVALKS-FLKGR---YPWMSRAYDPCTERYSNVYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              +VQKALH + T   + W  CSD V  +W+D P ++L +Y+ELITAGL+IW+FSGDTDA
Sbjct  320  RADVQKALHANVTRLPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSGDTDA  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYS+DALKL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  380  VVPVTATRYSVDALKLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  440  AFILFRSFLDSKPMP  454



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSI+T  C  + S+   +          + R YDPCTER+S  YFN
Sbjct  264  ALTIAEFEQGNIDPYSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSVAYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             P+VQ+A H + T  ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSGDTD+
Sbjct  320  HPDVQEAFHANVTGITYPWSTCSDLVGNYWADSPLSMLPIYQELIGSGIRIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT+TRYSIDALKLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGHEV LHRP+ 
Sbjct  380  VVPVTATRYSIDALKLPTLSNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPRE  439

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    +P
Sbjct  440  AFILFRSFLENKPLP  454



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A++E+G ID YS++TP CT S S  S +L +R   + L  + YDPCTE HS IYFNLP
Sbjct  290  NFAANEIGRIDYYSVYTPKCTSSSSTTSNLLSKRWPTL-LRSQGYDPCTEAHSIIYFNLP  348

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQ+ALHV    S  +W TC   V+  WKD   ++L+  +EL T+G+RIW++SG+TDAVI
Sbjct  349  EVQQALHVR--GSPVKWETCGLTVHYAWKDSARSLLNTIKELTTSGIRIWIYSGNTDAVI  406

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+TSTRYS+ AL LPTV  + PWY++GQVGGWTQ+YEGLTFVAV  AGHEV LH+PK AL
Sbjct  407  PITSTRYSLRALNLPTVGSYLPWYEDGQVGGWTQQYEGLTFVAVNAAGHEVPLHKPKQAL  466

Query  177  TLVESFLAGTSMPGLQRISD  118
            T+ ++FLAGT +   ++ SD
Sbjct  467  TIFKAFLAGTPLATSKQFSD  486



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C  +  + S  LK R      + R YDPC+ER+S +YFN
Sbjct  265  ALRNAELEQGNIDPYSIFTKPCNNTVELKS-FLKGR---YPWMSRAYDPCSERYSNVYFN  320

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
              EVQKALH + T   + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDA
Sbjct  321  RVEVQKALHANVTRLPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDA  380

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSIDALKL T++ W PWYD+G+V GW+Q Y+GLT V V GAGHEV LHRP+ 
Sbjct  381  VVPITATRYSIDALKLATITNWYPWYDHGKVAGWSQVYKGLTLVTVAGAGHEVPLHRPRQ  440

Query  183  ALTLVESFLAGTSMP  139
            A  L  SFL    MP
Sbjct  441  AFILFRSFLENKPMP  455



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 141/196 (72%), Gaps = 4/196 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNL  541
            D A+ E G+ID YS++TP C  + S  S + +RR R +   L   YDPCTER+ST Y+N 
Sbjct  267  DVATAEQGNIDMYSLYTPVCNITSS--SSLSQRRPRGRYPWLTGSYDPCTERYSTAYYNR  324

Query  540  PEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDA
Sbjct  325  RDVQMALHANVTGAMNYTWTTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDA  384

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LHRP+ 
Sbjct  385  VVPLTATRYSIGALGLPTTTSWHPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQ  444

Query  183  ALTLVESFLAGTSMPG  136
            AL L + FL G  MPG
Sbjct  445  ALVLFQYFLQGKPMPG  460



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 139/229 (61%), Gaps = 39/229 (17%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYF  547
             L  A  E G+ID YSIFT  C ++       LKR  R     + R YDPCTER+S +YF
Sbjct  328  ALRVAEVEQGNIDPYSIFTQPCKDT-----ATLKRNMRGHYPWMSRAYDPCTERYSKVYF  382

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            NLPEVQKALH + T  S+ W TCSD V ++W D P ++L +Y+ELI AG RIWV+SGDTD
Sbjct  383  NLPEVQKALHANVTGISYPWQTCSDLVGNYWADAPLSMLPIYKELIAAGFRIWVYSGDTD  442

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNG------------------------------  277
            AV+PVT+TRYSIDALKLPTV+ W PWYDNG                              
Sbjct  443  AVVPVTATRYSIDALKLPTVTNWYPWYDNGKVSTDNVIQFLELVSVEIGLHRCLSHQISH  502

Query  276  ---QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  139
               QVGGW+Q Y GLTFV V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  503  FLIQVGGWSQAYRGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  551



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLP  538
            + A  E G ID YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLP
Sbjct  265  NVAEAEEGLIDAYSIYTPTCKKTSLHRRRLIKGRRP---WLPRGYDPCTEQYSTKYYNLP  321

Query  537  EVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVI  358
            EVQKA   + T   + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+
Sbjct  322  EVQKAFRANVTGIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVV  381

Query  357  PVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLAL  178
            P+T+TRYSIDAL LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGHEV LHRP+ AL
Sbjct  382  PLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQAL  441

Query  177  TLVESFLAGTSMP  139
             L E FL    MP
Sbjct  442  KLFEHFLQDKPMP  454



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ A+ E G+ID YSI+TP C +    ++ + +R   +   L R YDPCTER+ST+YFN
Sbjct  264  ALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+
Sbjct  320  RPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH+P+ 
Sbjct  380  VVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQ  439

Query  183  ALTLVESFLAGTSMP  139
               L ++FL   +MP
Sbjct  440  GFILFKTFLEDKNMP  454



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 136/195 (70%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L+ A+ E G+ID YSI+TP C +    ++ + +R   +   L R YDPCTER+ST+YFN
Sbjct  264  ALELATLEQGNIDPYSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFN  319

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKALH + T   + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+
Sbjct  320  RPEVQKALHANVTGIPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDS  379

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+PVT++RYSI AL L T+  W  WYDN +VGGW+Q YEGLT V VRGAGHEV LH+P+ 
Sbjct  380  VVPVTASRYSIRALNLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQ  439

Query  183  ALTLVESFLAGTSMP  139
               L ++FL   +MP
Sbjct  440  GFILFKTFLEDKNMP  454



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S +YF
Sbjct  257  AMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYSGMYF  313

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H + T  S+ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  314  NSPEVQKAMHANITGLSYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  373

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  374  SVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  433

Query  186  LALTLVESFLAGTSMP  139
             A  L +SFL    +P
Sbjct  434  RAYLLFQSFLDNKPLP  449



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S +YF
Sbjct  257  AMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYSGMYF  313

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H + T  S+ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  314  NSPEVQKAMHANITGLSYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  373

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T TRYSI ALKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  374  SVVPITGTRYSIRALKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  433

Query  186  LALTLVESFLAGTSMP  139
             A  L +SFL    +P
Sbjct  434  RAFLLFQSFLDNKPLP  449



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 135/196 (69%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             +  A  E G ID YSI+T TCT E+ ++ SR  + R      + R YDPCTER+S +YF
Sbjct  258  AMKAADLEQGKIDPYSIYTITCTKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYF  314

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  315  NSPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  374

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT TRYSI ALKL  VS W PW DNGQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  375  SVVPVTGTRYSIRALKLQPVSKWYPWNDNGQVGGWSQVYQGLTLVTIHGAGHEVPLHRPR  434

Query  186  LALTLVESFLAGTSMP  139
                L +SFL    +P
Sbjct  435  RGFLLFQSFLDNKPLP  450



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   214 bits (545),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 137/200 (69%), Gaps = 6/200 (3%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  553
            D A+ E G+ID YS++TP C       S S      +R   +   L   YDPCTER+ST 
Sbjct  53   DVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTERYSTA  112

Query  552  YFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
            Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSG
Sbjct  113  YYNRRDVQTALHANVTGAMNYTWSTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSG  172

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  196
            DTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH
Sbjct  173  DTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLH  232

Query  195  RPKLALTLVESFLAGTSMPG  136
            RP+ AL L + FL G  MPG
Sbjct  233  RPRQALVLFQYFLQGKPMPG  252



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 138/226 (61%), Gaps = 36/226 (16%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L  A  E G+ID YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN 
Sbjct  267  LRVAVAEQGNIDPYSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNR  322

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T   + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V
Sbjct  323  PEVQKALHANVTGIPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSV  382

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNG--------------------------------  277
            +P+T+TRYSIDALKLPT+  W PWYD+G                                
Sbjct  383  VPLTATRYSIDALKLPTIINWYPWYDSGKVGANFCKEKLFKFILIGMNSGKFDTKIYSSV  442

Query  276  QVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  139
            +VGGW+Q Y+GLT V +RGAGHEV LH+P+ A  L  SFL    MP
Sbjct  443  KVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKDMP  488



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 129/202 (64%), Gaps = 32/202 (16%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            LD AS+ELG+ID YSIFTP+C  S +     L +R    G     YDPCTE+HST+YFNL
Sbjct  272  LDVASNELGNIDPYSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHSTVYFNL  331

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALHV+   +  +W TCS                                GDTDAV
Sbjct  332  PEVQKALHVNPAVAPSKWETCS--------------------------------GDTDAV  359

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            IPV STRYS+D+LKLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGHEV LHRPK A
Sbjct  360  IPVASTRYSVDSLKLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQA  419

Query  180  LTLVESFLAGTSMPGLQRISDS  115
            L L +SFL+G+ MP L    DS
Sbjct  420  LVLFKSFLSGSPMPTLSEFDDS  441



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
            ++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YFN
Sbjct  261  MEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFN  317

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  318  SPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDS  377

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T TRYSI ALKL  +S W PW DNGQVGGW Q Y+GLT V + GAGHEV LHRP+ 
Sbjct  378  VVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWIQVYKGLTLVTIHGAGHEVPLHRPRR  437

Query  183  ALTLVESFLAGTSMP  139
               L +SFL    +P
Sbjct  438  GFLLFQSFLDNKPLP  452



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKA  523
            E G ID YSI+TPTCT S ++     K      G     YDPCTE ++  Y+NLPEVQKA
Sbjct  187  EFGKIDQYSIYTPTCTTSQTVRHIRFKNLHMISG-----YDPCTENYAEKYYNLPEVQKA  241

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            +H + TN  ++W  CS+ +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+T
Sbjct  242  MHANLTNIPYKWTACSEVLLKNWKDSEISVLPIYKELIAAGLKIWVFSGDTDSVVPVTAT  301

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVES  163
            R+S++ L L   + W PWY  GQVGGWT+ Y GLTF  VRGAGHEV L +PK A TL +S
Sbjct  302  RFSLNHLNLSIKTRWYPWYSGGQVGGWTEVYNGLTFATVRGAGHEVPLFQPKRAYTLFKS  361

Query  162  FLAGTSMP  139
            FLAG  +P
Sbjct  362  FLAGKELP  369



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
            ++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YFN
Sbjct  259  MEAADLEQGSIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFN  315

Query  543  LPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDA  364
             PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+
Sbjct  316  SPEVQKAMHANITGLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDS  375

Query  363  VIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKL  184
            V+P+T TRYSI ALKL  +S W PW DNGQVGGW+Q Y+GLT V + GAGHEV LHRP+ 
Sbjct  376  VVPITGTRYSIRALKLQPLSKWYPWNDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRR  435

Query  183  ALTLVESFLAGTSMP  139
               L +SFL    +P
Sbjct  436  GFLLFQSFLDNKPLP  450



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 3/188 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKA  523
            E G+ID YSI+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A
Sbjct  275  EFGNIDQYSIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIA  331

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            +H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+T
Sbjct  332  MHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTAT  391

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVES  163
            R+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L +PK A  L +S
Sbjct  392  RFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKS  451

Query  162  FLAGTSMP  139
            FLAG  +P
Sbjct  452  FLAGNELP  459



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E G ID YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YF
Sbjct  261  AMEAADLEQGHIDPYSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYF  317

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H + T  ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  318  NSPEVQKAMHANITGLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  377

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV LHRP+
Sbjct  378  SVVPITGTRYSIRALKLQPLSKWYPWNDSGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPR  437

Query  186  LALTLVESFLAGTSMP  139
                L +SFL    +P
Sbjct  438  RGFLLFQSFLDNKPLP  453



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKA  523
            E G+ID YSI+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQKA
Sbjct  274  EFGNIDQYSIYTPTCTASQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQKA  330

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            +H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+T
Sbjct  331  MHANVTNIPYKWTACSDVLLKNWKDSAISVLPIYKELIAAGLKIWVFSGDTDSVVPVTAT  390

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVES  163
            R+S++ L L   + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L +PK A  L +S
Sbjct  391  RFSLNHLNLSIRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKS  450

Query  162  FLAGTSMP  139
            FLA   +P
Sbjct  451  FLAAKELP  458



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 134/197 (68%), Gaps = 6/197 (3%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEV  532
            E GDID YSI+TP+C    ++ +  ++    K  LLRR    YDPCTE ++  Y+N  EV
Sbjct  186  EFGDIDQYSIYTPSC---IALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEV  242

Query  531  QKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  352
            QKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PV
Sbjct  243  QKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPV  302

Query  351  TSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTL  172
            T+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L +P+ AL L
Sbjct  303  TATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALIL  362

Query  171  VESFLAGTSMPGLQRIS  121
              SFLAG  +P  + IS
Sbjct  363  FRSFLAGKQLPKSRHIS  379



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E G+ID  SIFT  C  + ++   +        G   R YDPC ER+S  YFN 
Sbjct  268  LELADSEFGNIDPTSIFTRPCGSAAALKGNL-------SGHYSRAYDPCAERYSEKYFNH  320

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGDTDAV
Sbjct  321  PEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAV  380

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L RP+ A
Sbjct  381  VPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREA  440

Query  180  LTLVESFLAGTSMP  139
              L +SFL    MP
Sbjct  441  FILFKSFLENKPMP  454



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 135/195 (69%), Gaps = 4/195 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A +E G+ID YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YF
Sbjct  258  AMEAAYNEQGNIDPYSIYTITCKKEAEALRSRFLRVRHP---WMWRAYDPCTERYSGMYF  314

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N  EVQKA+H + T  S+ W +CSD V   W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  315  NSLEVQKAMHANRTGISYPWTSCSDIVGAKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  374

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+PVT TRYSI +LKL  +S W PWYDN QVGGW Q Y+GLT V + GAGHEV L RP+
Sbjct  375  SVVPVTGTRYSIRSLKLQPISKWYPWYDNEQVGGWCQVYKGLTLVTIHGAGHEVPLFRPR  434

Query  186  LALTLVESFLAGTSM  142
             A  L +SFL    M
Sbjct  435  RAFLLFKSFLENKPM  449



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 137/200 (69%), Gaps = 6/200 (3%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTI  553
            D A+ E G+ID YS++TP C       S S      +R   +   L   YDPCTER+ST 
Sbjct  239  DVATAEQGNIDMYSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTERYSTA  298

Query  552  YFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
            Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSG
Sbjct  299  YYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSG  358

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  196
            DTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGHEV LH
Sbjct  359  DTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLH  418

Query  195  RPKLALTLVESFLAGTSMPG  136
            RP+ AL L + FL G  MPG
Sbjct  419  RPRQALVLFQYFLQGKPMPG  438



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 133/192 (69%), Gaps = 4/192 (2%)
 Frame = -2

Query  708  SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPE  535
            + E GDID YSI+TP+C    +  +R +  R +   L RR+  YDPCTE ++  Y+N P+
Sbjct  274  NHEFGDIDQYSIYTPSCLALTNNSARHI--RLKNTLLHRRVSGYDPCTENYAEKYYNRPD  331

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQKA+H +TT   ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+P
Sbjct  332  VQKAMHANTTGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWVFSGDTDSVVP  391

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S+  L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L +PK A  
Sbjct  392  VTATRFSLSHLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEVPLFQPKRAFI  451

Query  174  LVESFLAGTSMP  139
            L +SFLAG  +P
Sbjct  452  LYKSFLAGKELP  463



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKA  523
            E G+ID Y I+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A
Sbjct  274  EFGNIDQYIIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIA  330

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            +H + TN  ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+T
Sbjct  331  MHANVTNIPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTAT  390

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVES  163
            R+S++ L L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGHEV L +PK A  L +S
Sbjct  391  RFSLNHLNLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKS  450

Query  162  FLAGTSMP  139
            FLAG  +P
Sbjct  451  FLAGNELP  458



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = -2

Query  723  GLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHST  556
             ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++ 
Sbjct  134  AINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAE  190

Query  555  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
             Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSG
Sbjct  191  KYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSG  250

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  196
            DTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L 
Sbjct  251  DTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLI  310

Query  195  RPKLALTLVESFLAGTSMP  139
            + +  LTL +SFLAG  +P
Sbjct  311  QAERGLTLFKSFLAGKKLP  329



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 4/194 (2%)
 Frame = -2

Query  720  LDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNL  541
            L+ A  E G+ID  SIFT  C  + ++   +      K     R YDPC ER+S  YFN 
Sbjct  268  LELADSEFGNIDPTSIFTRPCGSAAALKGNLSGHYPWK----SRAYDPCAERYSEKYFNH  323

Query  540  PEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAV  361
            PEVQKALH + T  S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGDTDAV
Sbjct  324  PEVQKALHANVTGLSYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAV  383

Query  360  IPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLA  181
            +PVT+TRYSIDALKLPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L RP+ A
Sbjct  384  VPVTATRYSIDALKLPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREA  443

Query  180  LTLVESFLAGTSMP  139
              L +SFL    MP
Sbjct  444  FILFKSFLENKPMP  457



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 134/199 (67%), Gaps = 4/199 (2%)
 Frame = -2

Query  708  SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPE  535
            + E GDID YSI+TP+C    +  S V   R +   L RR+  YDPCTE ++  Y+N  E
Sbjct  274  NHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQE  331

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+P
Sbjct  332  VQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVP  391

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L +P+ AL 
Sbjct  392  VTATRFSVSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALI  451

Query  174  LVESFLAGTSMPGLQRISD  118
            L  SFLAG  +P  + IS 
Sbjct  452  LFRSFLAGKQLPKSRHISQ  470



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 134/199 (67%), Gaps = 4/199 (2%)
 Frame = -2

Query  708  SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPE  535
            + E GDID YSI+TP+C    +  S V   R +   L RR+  YDPCTE ++  Y+N  E
Sbjct  274  NHEFGDIDQYSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQE  331

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQKALH + T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+P
Sbjct  332  VQKALHANVTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVP  391

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S+  L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L +P+ AL 
Sbjct  392  VTATRFSLSHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALI  451

Query  174  LVESFLAGTSMPGLQRISD  118
            L  SFLAG  +P  + IS 
Sbjct  452  LFRSFLAGKQLPKSRHISQ  470



>gb|KDP38690.1| hypothetical protein JCGZ_04043 [Jatropha curcas]
Length=254

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 130/191 (68%), Gaps = 3/191 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLR-RI--YDPCTERHSTIYFNLPEV  532
            E GDID YSI+TP+C +  +  S +   R  K  LLR RI  YDPCTE ++  Y+N P+V
Sbjct  62   EFGDIDQYSIYTPSCIQLQNNKSNLRPLRLFKNTLLRGRISGYDPCTENYAEKYYNRPDV  121

Query  531  QKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPV  352
            QKA+H + T   ++W  CSD +   W+D  ++VL +Y+ELI AGLRIWVFSGDTD+V+PV
Sbjct  122  QKAMHANVTGIPYKWTACSDVLIKNWRDSESSVLPIYKELIAAGLRIWVFSGDTDSVVPV  181

Query  351  TSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTL  172
            T+TR+S+  L L   + W PWY   QVGGWT+ Y GLTF  VRGAGHEV L +P+ A  L
Sbjct  182  TATRFSLSHLNLTVKTRWYPWYSGNQVGGWTEAYNGLTFATVRGAGHEVPLFQPRRAFIL  241

Query  171  VESFLAGTSMP  139
              SF+AG  +P
Sbjct  242  FRSFVAGKELP  252



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 136/196 (69%), Gaps = 4/196 (2%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYF  547
             ++ A  E G+ID YSI+T TC  E+ ++ SR  + R      + R YDPCTE++S +YF
Sbjct  259  AMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTEKYSGMYF  315

Query  546  NLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTD  367
            N PEVQKA+H + T  ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD
Sbjct  316  NSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTD  375

Query  366  AVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPK  187
            +V+P+T TRYSI ALKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGHEV L RP+
Sbjct  376  SVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPR  435

Query  186  LALTLVESFLAGTSMP  139
             A  L +SFL    +P
Sbjct  436  RAFLLFQSFLDNKPLP  451



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 135/225 (60%), Gaps = 34/225 (15%)
 Frame = -2

Query  723  GLDTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFN  544
             L  A  E G+ID YSIFT  C ++    S +          + R YDPCTER+S +YFN
Sbjct  261  ALRAAQIEQGNIDPYSIFTQPCKDT----STLRHNMRGHYPWMSRAYDPCTERYSKVYFN  316

Query  543  LPEVQKALHVHTTNSSFEWVTC------------------------------SDEVYDFW  454
              EVQKALH + T  S+ W TC                              SD V ++W
Sbjct  317  RLEVQKALHANVTALSYPWQTCRYDHFLNTSRIFKIFVSNIYFIRICKSLFYSDIVGNYW  376

Query  453  KDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ  274
             D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+
Sbjct  377  TDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGK  436

Query  273  VGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVESFLAGTSMP  139
            VGGW+Q Y+GLT V V GAGHEV LHRP+ A  L  SFL    MP
Sbjct  437  VGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLMP  481



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQ  529
            E GDID YSI+TP+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+VQ
Sbjct  188  EFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPDVQ  246

Query  528  KALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVT  349
            KA+H ++T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+PVT
Sbjct  247  KAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVPVT  306

Query  348  STRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLV  169
            +TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV L +P  A  L 
Sbjct  307  ATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFLLF  366

Query  168  ESFLAGTSMP  139
             SFL G  +P
Sbjct  367  RSFLGGKQLP  376



>ref|XP_002440854.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
 gb|EES19284.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
Length=495

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 138/211 (65%), Gaps = 18/211 (9%)
 Frame = -2

Query  717  DTASDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIY  550
            D A+ E GDID YS++TPTC ++ S  S    RR R++      +R  YD CTERHST+Y
Sbjct  279  DAATAEQGDIDPYSMYTPTCNQTSSSSSSSTPRRIRRLKGRYPWMRASYDTCTERHSTVY  338

Query  549  FNLPEVQKALHVHTTNSSFEW-------------VTCSDEVYDFWKDCPTTVLDVYQELI  409
            +N PEVQ+ALH + T                      SD + + W D P ++L +Y+ELI
Sbjct  339  YNRPEVQRALHANVTGIKLHMGHLQFGAYMHVLLNDSSDTISNNWGDSPKSMLHIYKELI  398

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDN-GQVGGWTQEYEGLTFV  232
             AGLRIWVFSGDTD+V+P+T+TRYSIDAL LPTV  W PWYD+  +VGGW++ Y GLT V
Sbjct  399  AAGLRIWVFSGDTDSVVPLTATRYSIDALDLPTVVSWYPWYDDIKEVGGWSKVYNGLTLV  458

Query  231  AVRGAGHEVALHRPKLALTLVESFLAGTSMP  139
             VRGAGHEV LHRP+ AL L + FL G  MP
Sbjct  459  TVRGAGHEVPLHRPRQALMLFQHFLNGEPMP  489



>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-ii, 
With The Microbial Peptide Aldehyde Inhibitor, Antipain, 
And Arginine At Room Temperature
 pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, 
With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, 
And Arginine At 100 Degrees Kelvin
 prf||1408164B CPase II B
Length=160

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  63

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  123

Query  228  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  124  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  154



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 2/188 (1%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKA  523
            E GDID YSI+TP C    +  +R L  R +   L RR YDPC+E ++  Y+N P+VQKA
Sbjct  282  EFGDIDQYSIYTPFCLTQITNSARNL--RLKNTLLCRRGYDPCSENYAEKYYNRPDVQKA  339

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            +H + T   ++W  CSD +   W D   ++L  Y+EL+ AGL+IWVFSGDTD+V+PVT+T
Sbjct  340  MHANITKIPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFSGDTDSVVPVTAT  399

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLVES  163
            R+S+  L L   +PW PWY  GQVGGWT+ Y GLTF  +RGAGHEV L +PK A  L +S
Sbjct  400  RFSLSHLNLTIKTPWYPWYTGGQVGGWTEVYHGLTFATIRGAGHEVPLFQPKRAFVLFQS  459

Query  162  FLAGTSMP  139
            FLAG  +P
Sbjct  460  FLAGKQLP  467



>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   202 bits (515),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase 
Ii At 2.2- Angstroms Resolution
Length=152

 Score =   202 bits (515),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHEVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGHEV LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>emb|CAN79972.1| hypothetical protein VITISV_010072 [Vitis vinifera]
Length=434

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 129/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQ  529
            E GDID YSI+TP+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+VQ
Sbjct  241  EFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPDVQ  299

Query  528  KALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVT  349
            KA+H ++T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+PVT
Sbjct  300  KAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVPVT  359

Query  348  STRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALTLV  169
            +TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV L +P  A  L 
Sbjct  360  ATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFHLF  419

Query  168  ESFLAGTSMP  139
             SFL G  +P
Sbjct  420  RSFLGGKQLP  429



>ref|XP_008394313.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Malus domestica]
Length=472

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 7/199 (4%)
 Frame = -2

Query  723  GLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHST  556
             ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++ 
Sbjct  274  AINYATDHDFGDIDPYSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAE  330

Query  555  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
             Y+N P+VQKA+H + T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSG
Sbjct  331  KYYNRPDVQKAMHANVTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSG  390

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  196
            DTD+V+PVT+TR+S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L 
Sbjct  391  DTDSVVPVTATRFSLNHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLI  450

Query  195  RPKLALTLVESFLAGTSMP  139
            + +  LTL +SFLAG  +P
Sbjct  451  QAERGLTLFKSFLAGKKLP  469



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 137/202 (68%), Gaps = 7/202 (3%)
 Frame = -2

Query  723  GLDTASD-ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHST  556
             ++ A+D + GDID YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++ 
Sbjct  274  AINYATDHDFGDIDPYSIYTPFCLTMLNNRKRHLRLKNT---LLRRRASGYDPCTENYAE  330

Query  555  IYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
             Y+N P+VQKA+H + T   ++W  CSD ++ +WKD   +VL  Y+ELI AGLRIWVFSG
Sbjct  331  KYYNRPDVQKAMHANVTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLRIWVFSG  390

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALH  196
            DTD+V+PVT+TR S++ L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGHEV L 
Sbjct  391  DTDSVVPVTATRLSLNHLNLTIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHEVPLI  450

Query  195  RPKLALTLVESFLAGTSMPGLQ  130
            + +  LTL +SFLAG  +P L 
Sbjct  451  QAERGLTLFKSFLAGKKLPKLN  472



>gb|KFK29637.1| hypothetical protein AALP_AA7G159500 [Arabis alpina]
Length=462

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 134/204 (66%), Gaps = 12/204 (6%)
 Frame = -2

Query  723  GLDTA-----SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI----YDPCT  571
            G DTA     + E GDID YSI+TPTC  S +     ++ ++    LLRR     YDPCT
Sbjct  259  GCDTAVNYAMNHEFGDIDQYSIYTPTCMASKNKTGFYVRMKNT---LLRRRLVSGYDPCT  315

Query  570  ERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRI  391
            E ++  Y+N P+VQ+A+H + T   ++W  CSD +   WKD   T+L VY+EL   G+RI
Sbjct  316  ESYAEKYYNRPDVQRAMHANVTGIRYKWTACSDVMIKNWKDSDKTMLPVYKELAATGMRI  375

Query  390  WVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGH  211
            W+FSGDTD+V+PVT+TR+S+  L LP  + W PWY   QVGGWT+ Y+GLTF  VRGAGH
Sbjct  376  WIFSGDTDSVVPVTATRFSLSHLNLPVKTRWYPWYSGNQVGGWTEVYKGLTFATVRGAGH  435

Query  210  EVALHRPKLALTLVESFLAGTSMP  139
            EV L  PK AL L +SFLAG  +P
Sbjct  436  EVPLFEPKRALILFQSFLAGKELP  459



>emb|CDY39224.1| BnaA03g50360D [Brassica napus]
Length=463

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = -2

Query  702  ELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI----YDPCTERHSTIYFNLPE  535
            E GDID YSI+TPTC  S    +  L+ ++    LLRR     YDPCTE ++  Y+N  +
Sbjct  272  EFGDIDQYSIYTPTCVASKQKKTGFLRMKNT---LLRRRFVSGYDPCTESYAEKYYNRKD  328

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQ+A+H + T   ++W  CSD +   WKD   T+L VY+EL  AGLRIWVFSGDTD+V+P
Sbjct  329  VQRAMHANVTGIRYKWTACSDVLIKNWKDSDKTMLPVYKELAAAGLRIWVFSGDTDSVVP  388

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S+  L LP  + W PWY   QVGGWT+ Y+GLTF  VRGAGHEV L  PK AL 
Sbjct  389  VTATRFSLSHLNLPVKTRWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALI  448

Query  174  LVESFLAGTSMP  139
            L +SFLAG  +P
Sbjct  449  LFKSFLAGKELP  460



>ref|XP_002275684.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 ref|XP_010656614.1| PREDICTED: serine carboxypeptidase 24 isoform X1 [Vitis vinifera]
 emb|CBI36538.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 130/192 (68%), Gaps = 3/192 (2%)
 Frame = -2

Query  708  SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPE  535
            + E GDID YSI+TP+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+
Sbjct  274  NHEFGDIDQYSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPD  332

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQKA+H ++T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+P
Sbjct  333  VQKAMHANSTGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVP  392

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S++ L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGHEV L +P  A  
Sbjct  393  VTATRFSLNHLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFL  452

Query  174  LVESFLAGTSMP  139
            L  SFL G  +P
Sbjct  453  LFRSFLGGKQLP  464



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -2

Query  708  SDELGDIDTYSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCTERHSTIYFNLPE  535
            + E GDID YSI+TP C  S +    +   R +   L RR+Y  DPCTE ++  Y+N P+
Sbjct  235  NHEFGDIDQYSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCTENYAEKYYNRPD  291

Query  534  VQKALHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIP  355
            VQKA+H + T   + W  CSD +   WKD   ++L  Y+EL+  GLRIWVFSGDTD+V+P
Sbjct  292  VQKAMHANATGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRIWVFSGDTDSVVP  351

Query  354  VTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHEVALHRPKLALT  175
            VT+TR+S++ L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGHEV L +P+ ALT
Sbjct  352  VTATRFSLNHLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPERALT  411

Query  174  LVESFLAGTSMP  139
            L  SFLAG  +P
Sbjct  412  LFRSFLAGAELP  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515